current user: public

If you have questions about the server, please let us know.

Query: TM0005 TM0005 281886 Purified-2001-01-30, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650
# E-value Template Links and tools%idFirst MTVQQFIKKLVRLVELERNAEINAMLDEMKRLSGEEREKKGRAVLGLTGKFIGEELGYFLVRFGRRKKIDTEIGVGDLVLISKGNPLKSDYTGTVVEKGERFITVAVDRLPSWKLKNVRIDLFASDITFRRQIENLMTLSSEGKKALEFLLGKRKPEESFEEEFTPFDEGLNESQREAVSLALGSSDFFLIHGPFGTGKTRTLVEYIRQEVARGKKILVTAESNLAVDNLVERLWGKVSLVRIGHPSRVSSHLKESTLAHQIETSSEYEKVKKMKEELAKLIKKRDSFTKPSPQWRRGLSDKKILEYAEKNWSARGVSKEKIKEMAEWIKLNSQIQDIRDLIERKEEIIASRIVREAQVVLSTNSSAALEILSGIVFDVVVVDEASQATIPSILIPISKGKKFVLAGDHKQLPPTILSEDAKDLSRTLFEELITRYPEKSSLLDTQYRMNELLMEFPSEEFYDGKLKAAEKVRNITLFDLGVEIPNFGKFWDVVLSPKNVLVFIDTKNRSDRFERQRKDSPSRENPLEAQIVKEVVEKLLSMGVKEDWIGIITPYDDQVNLIRELIEAKVEVHSVDGFQGREKEVIIISFVRSNKNGEIGFLEDLRRLNVSLTRAKRKLIATGDSSTLSVHPTYRRFVEFVKKKGTYVIFLast
1 0.000e+00UniRef50_UPI000D1C3463 regulator of nonsense transcripts 1-like n=2 Tax=Selaginella moellendorffii TaxID=88036 RepID=UPI000D1C3463  ali  36  144.........................................................................................................................................................................GLNTSQKAAVEAALC-RKVTLWQGPPGTGKTKTLVQFVRIHCRSGQKVLACADSNIAVDNLLEGLLSEGLVVRIGQPVKVKEELRAVTLEARVSVHPL---------------------------------------------LKRAIEIKQMAKTRRQNKNKDTPGSLWEEATELEGRACREVISRADVVAATCIGAGDPVLDGLRFTACVIDEATQATEPATLIPLLKADCFVLVGDPAQLPPTVVSKEACGLEVSLFEHLQ-ACGLSPMLLDTQYRMHPVLARFSSRNFYEGKLFSQPLPAERMAPK-----------GYDWPNVEKPLAFVNCSNGKELM----RHDSSWQNEVEALQVVKTVKDLVSGGIEGGCIGIIAPYSAQVKLLQDLFLSKLEIKSVDGFQGREKEVIVFCTVRSNDHGALGFVANPRRMNVAITRARRGLVVVGNASTLESSCHWNLWLKEIREQGLF... 574
2 0.000e+00UniRef50_R7QDA8 Uncharacterized protein n=1 Tax=Chondrus crispus TaxID=2769 RepID=R7QDA8_CHOCR  ali  23  45.SYDRYKEYFEPLLLAEVAAELLSASEKFQRSKPARRQEPGLVLVSKVSRRHSWGFGWAVDLDSNDRKGPVGCIDNDVVVLTRQRPPRARVLGVVVRITGSRAVVVLSKFPDGNERVWNLLRLGSLTTMKREFDALQTIKTSVLLPVLLRPAQQSTGFFRNEEVIASKTGLNPSQARAILHATCRNGFSVVQGPPGTGKTRTLISLLNVIHMTQYQELLASKTFSMVSE---------------------SKLVRISKRARRPRLLICAPSNSAVDEILTRLTSSKFVDGQGREYCPELARIGAESAHPTIIDLHEKLERMDRDLRRLSIAASDGAKDLKREEKLRQIARTYV-EDAQLVFSTLSGAASSILTKRLFDTVVIDEGAQATEPSCLIPMALGRRCLLVGDPQQLPATVLSSGAAGYGQSLLERVCK-GGQNAQMLDTQYRMHPAISSFPRRYFYHGRLVDDESVQESRARPYHRDAIRPK---------LGPYVFLDIADGEEMRSR---DDRSIFNRSEAELASLIYTNLKKNYPKDSSVGVVTPYKRQMQELRQSFDRDVEIDTVDSFQGREKDVIVFSCVRASAHRGIGFVRDVRRMNVGLTRARSSLIILGSAHALEGSTDWAELVEDASSRGCLIS. 757
3 0.000e+00UniRef50_M2Y7F8 DNA helicase, putative n=1 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2Y7F8_GALSU  ali  27  6.SVCEFVEKQKTLLSWEAEEEQRRIEIALQNKHWKKLQLTGLAVYNLRITSVSKSSIDETVQVVLEKNSSQKLHKGDPILFRFQVHSTPVYRGVLNQLTGDKMILSLREQLQEYNERVVVVKDFENITMKRCLKALEELESMDSNHRAYSIRQFMENNYEKLFVRPENPELNSSQNQACFMGTWKYPITVIHGPPGTGKTTTLVALIRKLLQRGETLLVCAPSNVAVDNVMEMLIKKEPHLRIGHPARYNSELYKYSMAYQMKENDQGKLXXXXXXXXXXXXXXXXXXXXXHQQY-------------------------------EWKKVRKSLQKEWKERKSLAMC---QSFQQTQIIFCTCAGAGHSRLGRNGLDTIIIDEAGQALESLCWIPLLKGKRAILAGDPFQLPPTVLSQRANGLAKSILDRIFQHKQSIVSVLQIQYRMHLCISEWSSHTFYRGLLSPDKDVECHLLCDLPGV--------RRDRNTEIPLLWIDTAGCDCIEETESSGYESKRNRNEVQLCFQHLEELLDAKVEPKQIGIISPYAAQXXXXXXXXXXX-------GFQGREKEAIILSLVRSNDIQELGFLTDYRRINVAITRARRHICIIGNSDMMEKDSVLSQLVSYCFENGEI... 670
4 0.000e+00UniRef50_A0A151Z2M5 Helicase n=1 Tax=Tieghemostelium lacteum TaxID=361077 RepID=A0A151Z2M5_9MYCE  ali  29  86...QSYFEKFKKLLILESIAEKSNFEKKLISTPLEKLQRNGLTLLNLSSTYCKTMSDEYIIRFYIDANNSSKILLGDLVLISRENPLTEVYEATLVSFQKSEFEKSIRTLFSNSGSKWRIDVGNNKISMERMMLALIKVSSADLIYHTKLYDMESYHTIKSFPIDYSQWKLNSTQRDIIEKCAQRR-LSLVVGPPGTGKTYTAIHLIRLLVHLHRFILVTAYTNVGVDNIMEPLIQGIRVLRIGVPSKIRSELEEHTLEYILEK--------------------------------------RMARILSQHQKQKKTTHTPTALFNYQQKERQEI---------------DSILQEYDVICTTCISSGREILSQQIFPIVLIDEASQATEPSLLIPLLKSSQLIMFGDHNQLPPTVVSLEAQGLSTSLFERLIIQDKVEALQLTNQYRMHSAISKFSSDEFYNGTIINAVDDQYRLPPKHYY-----------------PIQFID-----LPNSKDQITHQSYYNSMEIQTVCDIVRDLSSNRISPKRIGIISPYGAQSQKLNESLSDKMFCSTVDSYQGREKDIIILSTVRSNSSHSIGFLSDWRRLNVSLTRAKSSLIIVGNSQTLSTDKHW................ 728
5 0.000e+00UniRef50_A0A090M5S1 p-loop containing nucleoside triphosphate hydrolase n=2 Tax=Ostreococcus tauri TaxID=70448 RepID=A0A090M5S1_OSTTA  ali  31  169..........QELLDIERACELASSSSEASDFDEESLAEREMRASGLRVGATRGGDGRALLVLRATDGKDNALTVGDRVTISAVGGDIAPAQATVRFMGDGSITLEYEGDESLSGLEVCLSRAPDETTYERQRRALNILASIPAVKRSKPACARIVRTIFHENRPTLFDGGDGVHVEAVAASTKKYPVVCVQGPPGTGKTAVVIEMIAQACARGERVLACAPSNLAVDNLVERLDGIDAVVRFGAPERISAAALSCSIDAKVAEATEA-----------YFQKQRVDSSETSATLRELMERYQKATNVPSAV--------KEKLQGEIEATKRKLKSIVGGGTKHRKAAQTKIVREANVVLTTNAGAGLDALQTLPFDLVVIDEAAQASEPLSWIPLVRGKRAILIGDPCQLAPVILSREAAGLARSLMSRLMPSAGILTLTLSTQYRSHEAISSWSSKEAYAGRLRAADSVRGALLRDLPGV--------QDTVLTRTPMLMITTQGRIPSEYSERRVGGSYINEGEAKTAMAHVKMLLKAGVRAKDIVVISPYAAQVRLLRSMIARVVDVSSVDSFQGREAECVIISTVRSNGAGRVGFLSDSRRMNVAVTRGKRQVAIIGDDQTIKSDDFLRRLVHHIESAGLFIP. 890
6 0.000e+00UniRef50_A0A091DNS4 Putative helicase senataxin n=1 Tax=Fukomys damarensis TaxID=885580 RepID=A0A091DNS4_FUKDA  ali  23 2776....EYFDVFLPLIILNTFETVAQEWIGSPN-------KKNFYQLHLRKFTDYKKTWEFVVYLEECELKQFHPKENDLVFLVPEQDLYEYHCGYVHRFRRTSVTLSIQTQDDLSNELMKCIIISSLVTTQRKLKAMSLLSGRNQLARAILNPNPMDFCTKDERIIAYLKDFNEEQKKAVETAYAMAKICLIHGPPGTGKSKTIVGLLFRLLMKQNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLRFSLDSQVNHR--------MKKDLPSHXXXXXXXXXXXXXXXXXXXXXRALCRGGREIQVQG----------------------------RPQKTQSIIILESHIICCTLSTSGGLLLEGVPFSCVIVDEAGQSCEVETLTPLIHCNKLILVGDPKQLPPTVISMKAQGYDQSMMARFCRLLEEPVLQLTVQYRMHPDICLFPSNYIYNKSLKTHRFTEALRCS---------------SDWPFQPYLVFDVGDG-----SERRDNDSYVNAQEIKLVMEIIKLIKKREINFRNIGIITHYKAQKMMIQKDLDREFEVDTVDAFQGRQKDCIIVTCVRANAQGAIGFLASLQRLNVAITRAKYSLFILGHLRTLVENHHWNELIQDAQKRGAIV.. 3458
7 0.000e+00UniRef50_T1L4Q6 Uncharacterized protein n=3 Tax=Tetranychus urticae TaxID=32264 RepID=T1L4Q6_TETUR  ali  24  492...QKYYDTYEPLVLHEIWSQIMQSYESEKQSN----------VLMVAVSSYELIDGFLQATMLPSDFRDQYLNEGDLALVELQSEEKRVVFGYIYRVPPGHIKIKFRQVKLDCASLMRVRSIYYLKPLLRNIEAILALQNSKLCEDILSPRMVTCQMAV-PSIKFSNPDYNESQLKAILASVTMPKLLMIQGPPGTGKTTTLVGIIKKIFETWPKVLVCAPSNGAIDEIARRLHSARHCVRVGMPNQMHPSVRKMSLDELVTENISRQKSDHQRGIQEKIDNLERDV-----ACKDRLVADYRAKNDKNNVDRCLSEMFICNREXXXXXXXXXXXXXXXXXXXXXKSLRADILKKADVVLSTLNSCRQSLLEGLQFNCVIIDEASQCCEPEILMPLTYTSKMILIGDPMQLPATVISPVASEYDRSLFERFFHHFGSPVLMLDTQYRMHSSICSFPSKKFYSNRLKTAPDLDKR-------------------PFPLKPYLIIDLKGTTF----DQSNFKNIHNELEADFVINLYSAVREICHRDTTVGIITPYQGQKKLLSNKLEKNVDVNTIDGFQGQERDVIIISLVRSKRDCGIGFLGSANRLNVALTRARHSLIICISDISDVNNDLWKSLVDNAASRKLLL.. 1175
8 0.000e+00UniRef50_F1L0K9 DNA-binding protein SMUBP-2 (Fragment) n=3 Tax=Ascaris TaxID=6251 RepID=F1L0K9_ASCSU  ali  28  53......LRRWQKLLKMEIDANERVIREHLSNSSWRDLSRRGLAIGNLRLVSHVEPLCGRVVELETSDSEHWKFKRGVPLVLCSGERISHLGECVLLSASERRIRLKLDGRAPELSPSVTAGVLHSLTKFLSESSSWKGLPGERILQYAYRAVPMPVVHRDRKL--QCIQKLNDDQQRAVAAALRSRPIVTIQGPPGTGKTAVVIEIILQAIRTKQKVLVCAPSNLAIENIIGRIRGETEASRMSLDPSISME----------EDLKQHNSYSDLLRLYEQLNESIRLTGDSSIT-----------------------------------------RKISQEATRLRDSMRKSVVVEKQVILCTVSSGSLHTLRGLGFDVVIVDEAAQAMECATWVPLLQAPRCVLAGDHCQLPTVLHSSEAQGLGTSLMETLDKEFGSVVHFLSVQHRMNEKIMRWSADYFYESKLQAHRSVAGISLSDI--------SAIDGSDLMNEPLLMIDTHSVGLSVSVERIHQQSYRNHGEAEIVCAYVQFLMRKGVRQCDVGVISPYFAQVELLRKTLGEEI-VNTVDGFQGQQREVIVMSLVRNNYEGRIGFLSDARRLNVAVTRARRQFLLVGSSSMMRHAEHLRSLLECIRTVGKVLR. 659
9 0.000e+00UniRef50_UPI000462AA27 LOW QUALITY PROTEIN: probable helicase senataxin n=1 Tax=Anolis carolinensis TaxID=28377 RepID=UPI000462AA27  ali  24 1379.DYNEYFDTFFPLMMX----XXXXXXXXXXXXXXXXXXXXPFCLSLLNFNADMKKADFIVHIPQSDLVRQLHPKEDDLVFLESEKPSFVRFVGLVTRFSQCHLSVQTQADLSRADKRLRCLVGSSLVTTQRRFRALLLLNRSPLAKALLSPSPRPRACLSPEPAASSGREFNEEQRQAIEVAFSMPKVCLVHGPPGTGKSKAIVGLLHCILSQRPRVLICAPSNAAVDDLMKKICGDINLVRLGQQKSISKDVRRFSLNDQIDHRISKATLGK--------XXXXXXXXXXXXXXXXXXXXXRAIYRSEKREKMQPLDDEICRLSQERQRLASQLK----EVRGRSQELKASVILESHVVCCTLTTSGGRRLGGDPVSCVIVDEAGQTCEVETLIPLIHGKKLVLVGDPKQLPPTVKSMKAQDFDQALMSRLCRLLESPVLRLSTQYRMHPEICLFPAKYIYGGALFTDRQTAENRFS---------------LEWPFQPYLLFDVLDG-----KEERDSDSYSNPAEVRLVIELMKLIKEKDLGFRHVGIITPYNAQKRRIRKQLDAEFEVDTVDGFQGREKDCVIVTCVRANSQGSIGFLRSLQRLNVTITRAKFSLFILGKLKTLMENKDWNELIQDAQKRGNIV.. 2098
10 0.000e+00UniRef50_A0A1D5PTG2 Immunoglobulin mu binding protein 2 n=9 Tax=Amniota TaxID=32524 RepID=A0A1D5PTG2_CHICK  ali  41  5.................................................................................................................................................................................................................................................................................................................................................................LTHASVVLATNTGASSKLLPENYFDLVVIDECAQALEASCWIPLLKAPKCILAGDHKQLPPTIISHKAKGLSLSLMERVIERYGEKVVMLTVQYRMHEAIMQWASSEMYGGRLTAHPSVAQHLLKDLPGVTC--------TEETTIPLLLIDTAGCG-LLELEVEDEQSKGNPGEVQLVGLHIQALVDAGVKARDVAVVAPYNLQVDMLREHLYPELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVAVTRARRHVAIICDSRTVGSQAFLGRLLEHFRQHGQV... 299
11 0.000e+00UniRef50_D8RYZ6 Uncharacterized protein (Fragment) n=1 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8RYZ6_SELML  ali  21  44.SLEDYIAVFEPLLLEECRAQIVRGDDDGGKSAAE---------CHVALTHCEKVNEFYSAKVAVRAEIGELFPDNELILITKEDLPKTYALAMVESDSSNDRDARLRLALQASGSGKRADLLFNLSTISREYVALCSLGSIAFSDTIVSASASDVSTIPRGLKDYLQTTHNQSQINAIQAGLSGQPLVLIQNGH-------CLCRLDHWLKASPW--------LGVGNPRDLIMPEDGDDGFCAPNQFRAEVVGTTRKHRAHVLVCAPSNSALDEIVLRLLKSGIRDENGDSYVPSIVRMGLNAHHSVQSVCMDHLVDQRLQ-----SIDRSMSSARGGGGGRERERVRLAILEEAAIVCSTLSFSGSSVFSRMKFDVVVIDEAAQAVEPSTLVPLTHGKQAFLVGDPIQLPATVLSTEAHGYGTSMFKRFQKA-GYPVQMLNTQYRMHPQIRDFPSKEFYGEALEDGAEVEQQTSRAWHEYCC------------FGPFAFFDIEG----RETQPPGSGSYINSDEAEFVLVLYRHLIALYPELKHVAVISPYKYQVTTLRTRFAEVIDINTVDGFQGREKDIAIFSCVRANKSKGIGFVSDFRRMNVGLTRARASMLVVGCAAALRQDEHWGNLIKHAQQRNR.... 700
12 0.000e+00UniRef50_W5L4T9 Senataxin n=2 Tax=Astyanax mexicanus TaxID=7994 RepID=W5L4T9_ASTMX  ali  25 1524.THEEYFSTMYPLLLANLFEEMVSEWQR----SGRVEISLKEMLHLVTVMTSHFTDYSYMLQLSEQEMRQYYPKEDDLVLLWLPKNKSAYAFGCVSRSSTLNLTIQTRGNVSSVNTQVRCEVIGSLITTMREFRALCHLKSGIMARPYILLKPHVSVFTPCQESLPYLQEYNTDQAKAISCGVSAPKILLIHGPPGTGKSKTIVGLLRHSKSHRMRVLLCAPSNAAIDNLMKKVCGDINLVRLGSEKTISKSLTGFSLDSQTSKKTQMRADPDVQRQKHRLDQAIENLSRQCAITQK--------QSPEEFLQFKQLMDKKQHYLSEREKLSRHL----REFRSKRQEVQAGVLRDAHVICCTLSTSGSLVLEREPFSCVIVDEAGQAKEAESLIPLLHCPALILVGDPDQLTPTVVSQKAKGYDQSLMARLWKSLHNPSIFLSIQYRMHPDICSFPSKYIYGNRLKNDCETAQKRCS---------------VNWPFEPYRVFDVMDGRENKE-----NDSFSNQKE---VKLILMLLKLIGEKQVRVGVITPYNAQKQQILRAVNAEVEVDTVDGFQGREMECIIVSCVRSSEMGSIGFVGNRQRMNVTITRAKQSLFILGHLRTLREHSDWGALIKDADRRGTII.. 2234
13 0.000e+00UniRef50_A0A1V9YY97 Uncharacterized protein n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9YY97_9STRA  ali  24  519.SLDEYMRTMKRAIVEEALTGVQ------------DINQHGVGSDQVRFVSLSLYTKGLLVAFTLPE--TLLLTNHDLLAISPSKDKRAKFRGIVYSTNTKEVTVILSDKHFVSAGSYTISILSNLTTCSREFQAIAALPTLPPVLQNLIVAAHVPTTSRPLMRAALEAQYNKAQLAAITAAVE-RPLTLIQGPPGTGKTRTIVGLIGALLSGSGMQLVTAPSNAAVDVIIQRLQADGVYNVKTKTYEVPSMVRIGALPGL--------------RQVPTSKRKSQPTTRTSSIYLEHLLDQQHAQRGNHH--------------------------------WNPMLARQELLQKAQIVFCTLSGAGSIAMCDFRFDAVIVDEAAQATEASSLIPLKFATRWILVGDHKQLPATVLSQRKMGYETSMFQRLVAS--NEVQFLTKQYRMHPSIAQFPSAMFYDGQLTHGGRPRGRPY---------------HARPELGPYVFYDIVQGEQSKAE---GSTSYRNLPEVEFIVSLVTSLVGGYPDYSKIGIISPYKSQIHELSSAFTKMVEVNTVDGFQGREKEIIIVSCVRTVRGRENAFWGDVRRMNVALTRAISSCWVVGNSTLLSQNTAWCALIEDCKSRHCYVDL 1144
14 0.000e+00UniRef50_E7FBJ2 Senataxin n=12 Tax=Cyprinidae TaxID=7953 RepID=E7FBJ2_DANRE  ali  23 1529.SYLEYFNTLYPLLLINAFEEMANEWL-----------KEGRVKLYLKVQGIEYSNRTASASFQECDVKQIYPKEDDLVLLWLPDNTGAYAFGYVSRRSTLNLTIQTRGNVSSVNSQPVLEVVGSLISIFREFRALCLLRNGPMLRPLLAPHVSFFTHSLDGPSDLDAPEFNRDQARAIACGIKTPKFLLIHGPPGTGKSKTIGGLLYKLLSRRTRVLLCAPSNAAIDSLMKKVCGDINLVRLGNERTISKSLKPFSLDHQTKARA---------QRAQQTVESDVHRRXXXXXXXXXXXXXXXXXXXXXSTEFKNLLEQKKQFLKEREGLSRQIK----ECRGRRQESQALVLQNAHVICCTLSTSGSRRLGHEPFSCVIIDEASQAKETETLIPMLYCPSVILVGDPNQLPPTVVSQKAKGFDQSLMARLCKSLHPPILLLSMQYRMHPDICEFPSKYIYNSALKNDCETAQKRCS---------------LSWPFKPYKVFDVMDGRETKERD-----SFINHKEVSLVGLLLKLLCKE--QAVRVGVITPYNAQKHRILDAIKTQVEVDTVDGFQGREMDCIIVSCVRSSEMGSIGFVGNRQRMNVTITRAKFSLFILGHLRTLREQSDWGALIEDAGRRECIIN. 2222
15 0.000e+00UniRef50_A0A0F7S4T6 Uncharacterized protein n=11 Tax=Ustilaginaceae TaxID=5268 RepID=A0A0F7S4T6_9BASI  ali  29  333.....YREKWNELLNYERTQELA-AIAERRKAPIDKLIQEGIAIDGLQAYWQDDSFGKRVAVFKLDPLPRTLFRAGDKVTISSDDPESFVIKAEVVERQRTYIRLKFDENDEDVDPSWRLDYGFNDLTFERIKAALEALEHWEDARVQSWYDRFARQHPIVIDGDP-QPELNCSQTQAVAMMLRER-VSLIQGPPGTGKTRTIVTLLKQDFRVPHPIMLAAHTNVAVDNLADGIKAGLRVVRTGPSARARAGIDQYTLDAYFLRHPAKPRLDQIKKRLDTLDRLKSEYELGRMTLRDELEDGEAAMSQKEAQSWEDAMAEREEERQEYEAIKKQLNRLKATYFFLRASIRGEILNSADVICGSAIAAGSPELDMIDLPVVFFDEASMATEPVSLVPLMKGCRLSIIGDHKQLPPVVTSVEAKGLSRSLFERLIQSESNPSTMLNVQFRMHPSLAEFPNRTFYDGALENGTGT-ELIAPVASSYWPSSSNTAENGAHR---LCFIDHKG----RESKAENSSSLCNASEARIVIDVVVDLLRQNPEGNDIGIVTPYAGQQILLEKMLHNEIDIHTVDGFEGREKKVILFSTVRTNAQGYVGFLADGRRLSVALTRAQSALFLIGNIDTFKRAQLLRKYAAYLKERGAVVS. 1095
16 0.000e+00UniRef50_UPI0009A3C489 LOW QUALITY PROTEIN: probable helicase senataxin n=1 Tax=Rhincodon typus TaxID=259920 RepID=UPI0009A3C489  ali  23 1859.SYEEYFQTFYPLLMLNLFEQLAQKLKESKQTN--RVIQNFLTLKNYRVVGRIYCAEFQVSLRDHEIEKQLHPKEDDVVFLWLPQNQNYYMQSHISRISRIHLSIRTRGNVSAVNQPVRCGVIGSLVTTLRQFKGLLFLAKTPLIRPILSANSAYFIQRDLVECPKLNHDYNEHQQKAIHVAYAMPNICLIQGPPGTGKSKTIVGFLHHLLNEEQRILVCAPSNAAIDDLMKKICGDVNLVRLGPERAIHSDVLKFSLDYQVNHR--------IKKGQSDADQVIQRRKDWLDRKLDELGKKCAIXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXXTQDIQLNIILESHIICCTLSTCGIRKLGHEPFSCIVVDEAGQACETEILIPLIYCPKLVLVGDHEQLPPTIISMKAKEYGRSMMCRLQKCLHDPVTMLLTQYRMHPDICLFPSKYIYRSLLKTDEMIEMQRCS---------------LTWPFQSYMLFDVTDGYECRERD-----SYVNTQEVKLVIALISMIKQKGI-CRNIGVITPYNAQKQKIMNQIDQEVQVGTVDGFQGCEKDCIIVTCVRANFQGSIGFLADRQRLNVTITRARLSLFILGNLKTLMENKDWKALIQDAQKRGAIV.. 2569
17 0.000e+00UniRef50_A0A2Y9QWX7 probable helicase senataxin isoform X5 n=3 Tax=Eutheria TaxID=9347 RepID=A0A2Y9QWX7_TRIMA  ali  23  362......................EKTKKVAQEWISSPNKDNFYQLHVRKFPADYTKYWEFVVRLEECEARQLHPKENDLVFLVPEDPHEYYC-GYVYKFRRTSVMRNQDSLPVSLNELVKCIVISSLVTTQRMLKAMSLLSGRNQLARAVLNPNPMDFCTKDERIITYLRDFNEDQKKAIETAYTMAKICLIHGPPGTGKSKTIVGLLYRLLTKQNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLKFSLDSQVNHR--------MKKDLPCHXXXXXXXXXXXXXXXXXXXXXRALCRGGREVQXXXXXXXXXXXXXXXXXXXXXIK----EVQGRPQKTQSIIILESHVICCTLSTSGGLLLEGVPFSCVIVDEAGQSCEIETLTPLIHCNKLILVGDPKQLPPTVISMKAQGYNQSMMARFCKLLEEPVLQLTVQYRMHPDICLFPSNYVYNRNLKTNRVTETNRCS---------------SDWPFQPYLVFDVGDG-----SERRDNDSYINVQEIKLVMEIIKLIKRRDVTFRNIGIITHYKAQKMMIQKDLDKEFEVDTVDAFQGRQKDCVIVTCVRANAQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNHLIQDAQKRGAII.. 1055
18 0.000e+00UniRef50_G1N2M5 Senataxin n=2 Tax=Amniota TaxID=32524 RepID=G1N2M5_MELGA  ali  26  12.....................................................................................................HLSVQTRGNLSFINNQVKCVVVGSLVPTQRSFKGLLLLSRSPLAKPIINPFCPRDLPVASENATFSMSEYNEDQKRAIETAYAMAKICLIHGPPGTGKSKTIVGLLSRVLMKQSRFLVCAPSNAAVDELMKKICGDIKLVRLGAERSINSEVRAFSLDKQVEHR--------MKRKPTDRDQDIQKKKAALDEKLDMLSRQRAMHRCYRFLKSQMLDDEIGRLSKERQQLASQLK----EVRGHSQKVQTDIILESDIICCTLSTSGGGLLESDPFSCVIVDEAGQSCEVETLIPLIHCNKLVLVGDPRQLPPTIKSIKAQGYGQSLMARLQRHLEDPVVQLTVQYRMHPDICLFPSSYVYGRTLKTDKATEENRCS---------------SEWPFQPYLVFDVGDG-----REERDKDSFSNPQEVKLVLEIIRTIKEKDLGLRRIGIITPYSAQKKKIQEELDRVFEVDTVDAFQGREKDCIIVTCVRANSKGSIGFLASLQRLNVTITRARFSLFILGRLKTLMQNKDWNELIQDAQRRGAII.. 623
19 0.000e+00UniRef50_A0A2A9NKY3 Uncharacterized protein n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9NKY3_9AGAR  ali  26  107.....YKKRFTELIDLEQEEEEGVLRERLSTWSLHRLKEEGYCLTGLSAFWQATQFGRPVASFSLGPLPDSRFENGTQVLVSRIDPLKEEALGSVVSTDESRINVCFLEKHELEDGSWRLDVGTSNLIFDRMRVAVNSFNHDVSSQEAIETCSHQALQSPDDVDYPSHQGLDDMRIQSWARRYAEIDPLVIEGDPGLNKSRALAMMIGQRICLIQGPPGTGKTKTIIEAIRLLKVHFEVPHPLLVCTYTNVAVDNLVLAAADVKPLRVGFGEKVRASLLEYTLDYQLERHPLQPILASVVKDEKYLDESLQDLFISIAEHKRTKSSDTPKSMKQLERLQWKYYAIQQEMLQDVVSNADVVCTTCISSACVALNVVDFPVVFLDEASMSTEPASMIPLMKGSRQVLIGDHKQLPPIIVSREAAGLDISLFERLTEEGVVPSLMLDTQYRMHPSISRFPAAEFYNLSLIDGTIDAYGNVHPRLYPPTSQYLLENNGNGNRPSVIFLDHGG------SESMKDRSRVNYNEAHIVASIVEDLLLNNIQGYDIGIIAPYVAQISLLTRLLKNDIEIKTVDGFEGREKEVIIFSTVRNNNGGHIGFLADRRRLNVGLTRAKRGLFVVGSLHTLRRSETWRRYAKFLDEQGLVVKL 862
20 0.000e+00UniRef50_UPI0004575B0F probable helicase senataxin n=1 Tax=Callorhinchus milii TaxID=7868 RepID=UPI0004575B0F  ali  22 1869.SYEEYFRVYYPLMMLNTFEQLAKEWTESRQ--SHRLIQNSLTLKNHWVQEQIY-RAEFQVSLHDTNFNKHQPKEDDVVFLWLLQSHIPYHLGHISRASYSHLSVQTRGNVSAVKSQIKCEVIGSLVTTIRQFKALLFLHKTPLALPVISISSPFFTQRDDDAKWSSANEYNEFQQRAINVAYTMPKICLIQGPPGTGKSKTIVGFLHRLLNEEERILVCAPSNAAIDDLMKKICGDVNLVRLGLEKSISSDVVKFSLDYQVD----YKIKKNQPGVDQQIQWRKQYLDKRLDELGRQ---------CAIXXXXXXXXXXXXXXXXXXXXXRQKLGRTMKEHHRQMQDVQLNIILESHIICCTLSTSGGGLLEHEPFSCVIVDEAGQSCESETLIPLVYCPKLILLGDPEQLPPTIISMKARGYGRSMMQRLQKGLYDDVKQLLTQYRMHPDICLFPSKHIYGGKLKTNKTVEMQRCS---------------LSWPFEPYMLFDVIDGCEIRKK-----GSFSNLQEVKLVIALITLIAEQKGKCNNIAVITPYNAQKQEIQNQIEQAIQVGTVDGFQGCEKDCIIVTCVRANNQQNIGFLADRQRLNVTITRARFSLFILGHLKTLTDSKDWNALIQDAQRRGAIV.. 2576
21 0.000e+00UniRef50_A0A287TG67 Uncharacterized protein n=4 Tax=Hordeum vulgare subsp. vulgare TaxID=112509 RepID=A0A287TG67_HORVV  ali  24  12.......................................................................SLSENDLLLLSKEKNPTAYAFAVVEQRGGKSLRLRFASILSKPDSFLWILKMCSLSTILREYSGMHSVASHPFKDLILSADQNRAWNVPQPLMDYLKANLNGSQLDAVNAGLSRRSFVLIQGPPGTGKTQTILGLLSAVLHSAPRMQTRGGFDVQKHGPELDIESKHANWMKASPWLIGANPRDMIMPVDGDDG-FYPTGNDLKPEVVSSNRKYRAHRVLQTGIRDENNNTYNPKIVRIGLKAHHSVKAVSMDYLMDQKQSGVASDGGRPGAGERDRLRASLLDEAAIVFSTLSFSGSAIFTRMTFDVVIIDEAAQAIEPATLVPLVHGCRQVLVGDPVQLPATVISTTARGYGRSLFQRFQAA-GFPVQMLKIQYRMHPEISVFPSKEFYEGILEDGEGLDKKR--PWHSYSC------------FGPFCFFDVDGVESHLS----GSGSMVNEDEVEFITLLYHQLATRYPSSSQVAVISPYRGQVKLLTDHFKEVIDVNTVDGFQGREKELVIFSCVRCNKEQSIGFVSDFRRMNVAITRARSAVLV............................. 611
22 0.000e+00UniRef50_A0A151S0P0 Helicase sen1 n=1 Tax=Cajanus cajan TaxID=3821 RepID=A0A151S0P0_CAJCA  ali  23  39LSTKDYMNSFIPALIEETHSDLSTSLISVSQAPFCEIMTLER-----SRDFELPNDLFYQISLKSTSFRNYEPEVGDLIAFTSKKTKRHFHIAYVTGPRDDEIPLLSSMILDNDKQKLYAVYLSNMTTNIRIWRALNADSKSGENCGVCLSGENRSLAYSSVQNTISAQNLNESQKDAVLSCVTNDTIKLIWGPPGTGKTKTVASLLLSLLKQKTRTLTCAPTNTAVLQVAVRLHGLGDIVLFGNSSRMKIELGKIFLDNRVNDLLRCFSPLTGWKHYLESMIKFLKDPEEAYVLYKHEQFVEKEFPYIAEQYLMYKDDEKLSAGFERDECLGILNSLSKSISRNKYGISKFCLMNACLVFCTASGSSKLYSEGMPFKFLVIDEAAQLKECESTIPLQLPNSCILIGDERQLPAMVKSKIAAEFGRSLFERL-GLLGYKKHMLNVQYRMHPSISMFPSKEFYDQQLSDAPTVRETSYDRRFLDGKMYSS-----------YSFINIPKGK----EQSNHDHSLMNKIEVAAISEIIGCLKKEFFKTRSIGIISPYKAQVSEIQKKVKKSVTVRSVDGFQGGEEDIIIFSTVRSNGCGKVGFLSNRQRANVALTRARYCLWILGNAATLNSNSVWRKLVLDAKKRHCF... 752
23 0.000e+00UniRef50_I7M805 AAA domain protein n=2 Tax=Hymenostomatida TaxID=31277 RepID=I7M805_TETTS  ali  25  97.DPEDYVKTFEQHLFSEAKAQIIKAQVTESRAPEIMRLKNSQVI---ALKNNSELF-FRKLTMEKVADSETKYGTHDFIVISLQDPSKEHMLGVVERAEGNEIKVVFDENSSDPRRNWYVKKFCSIVTIQREYEALHNFNDLLLKEFILNPEKEEKFSIPEQLSIRLNQIYNPSQIQAINSTLKKQGVTLIQGPPGTGKTRTVLGTVSVLINSFNEDQLKQKHSMEIEKLVEQSGEFHFELAMPWMQPNYVDWRDSTFDHLHNDFSNFTKTKKITADQTDKVIPILKAQEEHAPPEKILICGNIYDPSKIIVRIGENYDKDLEDVSLDYLVKQKLGEQNIRSE-DAQEIRKKILKEAKIICGTLSSTGSQILANFKFDTVVIDEAAQSTEISTLIPLQYCTRLILIGDHNQLPATIFSKKCEKFNQSLFER-FEKCKVEVHMLNQQYRMNPIISKFISQTFYQDKISDAEKINELVGQP-----------EIYQLRLFQPVVFFNVEGNEIFEKS------SYKNEEESKAIVEIYNKLRTTFPNFNKLGIITAYSRQVKEIEKKIKAHVEVHTVDGFQGREKDIIIFSTVRANTKKTIGFLNDRRRMNVSLSRARLCVIVVGDLKQLKFSKLWKGLAEYIEQRSCY... 794
24 0.000e+00UniRef50_A0A0F4X5J9 DNA polymerase alpha-associated DNA helicase A n=5 Tax=Hanseniaspora TaxID=29832 RepID=A0A0F4X5J9_HANUV  ali  28  5........RFKEALFCEQTEDVDQIRELLLESNFKQLETIGFMARHLSINSLSTGPGKLLYNKKKDEISSFNLKIGDIVLLSKGSSNLKTCLGHVYKQNKDSITLLVDQDLSDSNDFYFLIKTINEITYRKMFKTIEKLKKIEEDEYHDSLLLDILLNKIDKNTSYINPLLNDSQKSAVHFAL-NNPISIIHGPFACGKTSTIVEILEQINCTPEHVMVCGPSNVSVDTVLEKVIKSDQMVRIGNPTRIHGNA-TYSLDNKVNTGEEGSICKDIKSEINTLLKQSTKGNSKS-------------------KKNIAKPALKGKAK------WNEIKLLRKDLNKRENKVVKDIIKRSKFIFATLHGSSNRQVLTMDFNAVIIDEVSQSLEVQCWIPLKKLKRIIFAGDNKQLPPTIKSQVTKNLNTTIFDRLEETYSNTFIFLNTQYRMNEKIMEFPSNEMYNGEVISGDTNRDILLSDLN----CDFLSLDEDEIFNEPLLWYDTQCDLSFMEDQKKDDNSKSNINEVFIALKHIEKLIGMHLQEEHIGIITPYQAQVQLMKHHIYPNIDIHTVDGFQGNEKECIILSLVRFNEQNELGFVKDERRLNVAITRAKRQLCVIGNLETFQSNKFLKNWCKFIEAKGVI... 699
25 0.000e+00UniRef50_A0A2R8Q0K5 Senataxin n=1 Tax=Danio rerio TaxID=7955 RepID=A0A2R8Q0K5_DANRE  ali  23 1457.SYLEYFNTLYPLLLINAFEEMANEWL-----------KEGRVKLYLKVQGIEYSNRTASASFQECDVKQIYPKEDDLVLLWLPDNTGAYAFGYVSRSTLN-LTIQTRGNVSSVNSQPVLEVVGSLISIFREFRALCLLRNGPMLRPLLAPHVSFFTHSLDGPSDLDAPEFNRDQARAIACGIKTPKFLLIHGPPGTGKSKTIGGLLYKLLSRRTRVLLCAPSNAAIDSLMKKVCGDINLVRLGNERTISKSLKPFSLDHQTKAR---------------AQRAQQTVESDVHRRXXXXXXXXXXXXXXXXXXXXXSTEQKKQFLKEREGLSRQIK----ECRGRRQESQALVLQNAHVICCTLSTSGSRRLGHEPFSCVIIDEASQAKETETLIPMLYCPSVILVGDPNQLPPTVVSQKAKGFDQSLMARLCKSLHPPILLLSMQYRMHPDICEFPSKYIYNSALKNDCETAQKRCS---------------LSWPFKPYKVFDVMDGRETKERD-----SFINHKEVSLVGLLLKLLCKE--QAVRVGVITPYNAQKHRILDAIKKQVEVDTVDGFQGREMDCIIVSCVRSSEMGSIGFVGNRQRMNVTITRAKFSLFILGHLRTLREQSDWGALIEDAGRRECIIN. 2125
26 0.000e+00UniRef50_A0A2U2XCJ6 Uncharacterized protein n=1 Tax=Brumimicrobium sp. C305 TaxID=2100725 RepID=A0A2U2XCJ6_9FLAO  ali  30  44.........MRELLRLEEETQEKKWFE--KDVSLKELRKEGAILHPVKIQNKSFGYTDITVTFHTPGGVNNSFSQGTPVAVFLPSS-NAICNGQLLSISDRKAEVLLDDFPDWDEKNIGIKRLPDNRTFQMMHGVLKRIVKIKQLFEYVHGIKKQKELENAELNINVGDHLNEFQVKAVENGMCDSQLQIIHGPPGTGKTTTIVALIQALRKQGLSIVASAPSNAAVDHLAQQLNSGLKVLRLGNTAKVNKVVWEHTPEGILSDDKYSKKIKRLKIQEAEYRKMAHQYKRSFG----------------------------KSEREQRKLLFNEVYAIRDQIKNLSSAYLAQFFDAADVILGTPIGLMDKMLLNKKFDVAFLDEAGQCIEPLAWLVLEKGNRAILSGDHLQLPPTVISEEAKGLSTSVLERAIDA-GVQSDLLGIQYRMTPEIAGFSSNYFYEGKLQSHASVPE-------------------------SMIFYDTAGAG-FDEKRQENSRSTSNPEELRIVRENAENWIEKGQSAV---FISPYSSQVELAKEEL-KDIVVSTIDSFQGQEADVIILSLVRSNPEGKIGFLSDYRRMNVALTRAKKKLIVIGDSATLANDKFYKEFVEYVEEIRGY... 635
27 0.000e+00UniRef50_A0A2P6TEF8 Regulator of nonsense transcripts 1 (RENT1) n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TEF8_CHLSO  ali  29  62.............VRAENEEQARLQRAAYRRGSARRLQDDGLVLLGLRAAPQGRLYGEFVWRFQQSALPYHRFKRGDTVVVAQQPGPDEPLEGTVLEVQREALLITLPREAADALSTWRLDQGSSSVTVARQLDALNRLFAERLAFKPTEWVQQQGWLQKARQQLAAVPHLNTSQKEAIAFAL-SRTLTLWQGPPGTGKTRTLLAFIQVLVKRQGAILAVGDTNAAADNLLEGLLERINVVRVGNPAKVRPELRSACLDALAERTPQGRQXXXXXXXXXXXXXXXXXXXXXQSSWQEQVRAYKAAGNQLTPEQEQRLQ----QLGRKIRELQRQADGLWRGADNLVKEAAIEVLRGAAVVVSTCNGSGESRLEGQRFRIVVLDEASQATEPASLVPLVKGAECIMAGDQKQLPPTVLSKKALGLDVPLFNRLLKA-GVTSKLLDVQYRMHPAIAAFPSQHFYKGRVKSGVQPEDR-----------PPVQGVPWPSPECPVLFINVDGREQSGGRRSGEQSSYCNPAEAEVAMRALQRLLERDAELQSVALLSPYSGQVRLLSSLLRCSLAVSTVDGYQGREADAVIFSAVRCNQAGRVGFLADERRLNVAITRPRRGLIVVGNQTTLAADPNWRA.............. 772
28 0.000e+00UniRef50_UPI000814A823 probable helicase senataxin isoform X1 n=2 Tax=Pygocentrus nattereri TaxID=42514 RepID=UPI000814A823  ali  25 1511.NYEEYFNIMYPLLLINAFDEMASEWL-----------RSGRIGLDLKLQGFEYSNRTATASFSQQEMRQLYPKDDDLVLLWLPENSGAYHFGCVSRISNGNLTIQTRGNVSSVNQPVRCEVIGSLISTVREFRALCLLRSGIMARPHILLTPHVSVFTPSQEGLPDMPEYNVDQTKAISCGVSNAKILLINGPPGTGKSKTIVGLLQRLFSRRMRVLLCAPSNAAVDSLMKKVCGDINLVRLGSEKTISKDLIAFSLDRQTAKKTQMHADSDVQRQXXXXXXXXXXXXXXXXXXXXXS------------HEFKQLMDRKQQCLSEREKLSRQLKEF----RSKRQEVQAGLLRDAHVICCTLSTSGSRRLGHEPFSCVIVDEAGQAKEPETLIPLLHCPSFILVGDPAQLPPTVVSQKAKGYGQSLMARLCKSLPSSSIFLSTQYRMHPDICEFPSKYIYNKNLKNDWAPQQRRLYRFGLPWCETAQKRCSFNWPFEPYRVFDVTDG-----RESKIKDSFYNLKEVKLVLMLLKQIGERQV--VRVGVITPYNAQKQRILEAVNKEVDVDTVDGFQGREMDCVIVSCVRSSEAGSIGFVANRQRMNVTITRAKYSLFILGHLRTLRQSGDWGALIKDAACRGTII.. 2230
29 0.000e+00UniRef50_K8FDD3 Uncharacterized protein n=1 Tax=Bathycoccus prasinos TaxID=41875 RepID=K8FDD3_9CHLO  ali  30  256..YKAHKERYSKAITCEFEEEREQFKERLESWPLSRLKNEGYCLSDVRARYEGTIGRDALVRVLRPELPFHRISVGDMVILSDNESSSSSIVGIVASRQMFYLTIAIPEDDLENGRRLRIDLSANTVAYDRAISALEAFSSSSVNSLASTPISWKNDQRIDQAMSSYAKNLNPSQRKAVKAAMQN-TLTLWRGPPGTGKTRTLVALIAQASWRGPKVLACAASNVAVDNILEKIDRSMNILRLGSPARVQPWLLESTLSHKVALHPKGKEANSIRERFRGITSL------------------------------------------EAAKARKQAQQLDREAAI-------QVVNASDVILATCVGAGDDLLADRVFRYAFVDEAAQCVEPHTLIPLTKALAGVLVGDTKQLPPTVVSRDAVGLQRSLIERL-ELLGVEPYLLEEQYRMHPGLAAFSSVRFYDRRLKSVPKPSERVAP-----------NGVNWPSTMVPLAFVEVKG----EEMRAPDGNSIFNVQEAEECVRVVQKLLLSGKNAGDIGIIAPYAAQVRAISEEWNRKVEIRSVDGFQGREKEVIVLCTVRNNRQNQLGFVADPRRLNVAITRAKRGLIVLGHRDTLSTDQLWQKWLQFVDKYECEVE. 976
30 0.000e+00UniRef50_A0A1U8D7Y5 DNA-binding protein SMUBP-2 n=6 Tax=Amniota TaxID=32524 RepID=A0A1U8D7Y5_ALLSI  ali  41  4................................................................................................................................................................................................................................................................................................................................................................VLTQADVVLATNTGASLKLLPENHFDLVVIDECAQALEASCWIPLLKARKCILAGDHKQLPPTIISHKAKGLSLSLMERLIQKYGESVRMLTVQYRMHQAIMQWASTEMYGGRLTAHPSVAHHLLKDLPGVA--------STEETRIPLLLVDTAGCGLF-ELEVEDEQSKGNQGEVRLVGLHVQALVNAGVKAKDIAVIAPYNLQVDMLREHLYPELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVAVTRARRHVAVVCDSRTVSNQVFLKRLMDYLSEHGEV... 299
31 0.000e+00UniRef50_UPI000719CFB7 probable helicase senataxin isoform X1 n=2 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719CFB7  ali  27  295ISYDDYVYSLLPCMLCETWEAIYRDWKEAQKSNYK---NKSYVWKVLSPKSRLTVWNCEVLITKEDFLKWQYPREYDLLILDKAESIATCVFAYVVRSKTHHMQVCFNPGILIDTKPFYIKKCTTLVTFVRQFEALLYLPHSALARDVLQPRQQSFRIRLPVNVPPHQYRLNESQQAIVTTAVRSPKICLIQGPPGTGKSLTIQHLINAPVDRRPKILLTAPSNNALDLLMQRLLDRERMLRIGKTKHMHADVHCISLDAQVER----ARMKDKAGVIKSVDAEIHRLTTHIAAFRQECDRKKAKEIDKLVLRLKSLNAEKNKMVGMPGG-------------GEGMKWRSFVLTRADIIGCTLCGCGSSILNILKFTCAIVDEATQCTELDCLIPLQFGSKLVLVGDPEQLPATVLSQKALGYDRSLFSRFYNYFNSPMVMLDTQYRMHPAIAEFPSDHIYGGKLKTARNDCARI--------------------PLHPLIVLDIPNG-----RESTSNSSILNILEAEFTVELLTMMNDHQIN-SSIGVIVPYSQQKALLRRKLSQQVEVNTVDGFQGREKDVVVLSCVRANSSGSIGFLTNRQRLNVALTRAKHSLIILGCMDTMKVDKDWSALVSHAEEKKAI... 981
32 0.000e+00UniRef50_A0A133U3E3 Uncharacterized protein (Fragment) n=1 Tax=candidate divison MSBL1 archaeon SCGC-AAA259B11 TaxID=1698260 RepID=A0A133U3E3_9EURY :  ali  51  1.............................................................................................................................................................................................................................................................................................................................................................IDEIIDWADVVCATNSGCGSDLMSERRFDTVIIDEATQTTEPSCWIPIKLSSRVIMAGDHKQLPPTVLSEDAKDLNKTLFESLIERQDVDIRTLKIQYRMHEKIMNFSNREFYDGVLKADSSVAGHTLRDLFHPNSDYGKVSEKVIHPDKPIVFIDTKNLEAS-ERVRKGSTSKENPKEAHIATSISSKFLGLGLEPEDIAIIAPYDDQVDLINGRIEEELEVDTVDGFQGREKEVVILSLVRSNREKNVGFLEDVRRLNVSITRAKRKLIIIGDSSTVSAHGTYSSLIDYISENGEVI.. 302
33 0.000e+00UniRef50_A0A058Z016 Uncharacterized protein n=1 Tax=Fonticula alba TaxID=691883 RepID=A0A058Z016_9EUKA  ali  27  282.SAIHYRRVFEPLVKLERDYALEMANSVIEYDAKGWLDPYGRSFLHIPLDS------------------SLRLSDGCFLCISHPDLQGVELFACVTRITHGAVKLRFHEPLLLRESGLSVKLSENPVHFMRVLGALEGFSNRTLCMGRQMPAGFRPLHMADDFQAPGVSPPNESQLRVMQKVVSQA-FSLIQGPPGTGKTATIANLVHFLWLQGRSILLCAPSNVAVSNMCGRVHASGLDV-----LWMESDAREFMVSP------------------HKHLTLLERLKKDDPRARSIIDGRRRGHYNPKGAQGRDDA--------------QYLRDLRDTY-----------LRRARIVAATLSSSAA---FERRFDVLIVDEATQCTDPEVLVALMHGPSVILVGDHMQLGPVVMNPEAAGLSRSLFERLI-LLGSQPLRLDVQYRMHPCLSAFPSEAFYEGTLADGVRADQRRRPAVDFPWP----------DPDSPMMVYSDAGV----EKSSASRTSFLNYSEAQKVLEVLNRLLGQGVRPEEIGVISPYDGQCQHIRRLLERRVDVASVDSFQGSERDYIILSTVRT---QTVGFLTDLRRLNVAITRARYGMIVICNTGLLRRIPLWDKLIRRFHSQGLLV.. 874
34 0.000e+00UniRef50_UPI000642C3BF probable helicase senataxin isoform X3 n=1 Tax=Condylura cristata TaxID=143302 RepID=UPI000642C3BF  ali  24  950.................TDSQVAQ---EWMSSPNKEK------YYQLHVRKFYKKSWEFVAYLKECELKQLHPKENDLVFLVPEKDPYDYYCGYVHKFRRTSVMRNQDTLPVGLNELVRCTVISSLVTTQRKLKAMSLLSGRNQLARAVLNPNPMDFCTKDERIVAYLRDFNEDQKKAIETAYAMAKICLIHGPPGTGKSKTIVGLLYRLLTKQNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLKFSLDSQVSHR--------MKKDLPSHVQEMHRRKDYLDLQLDELSRQRALCRVGREMQXXXXXXXXXXXXXXXXXXXXXIK----EVQGRPQKTQSIIILESHVICCTLSTSGGLLLEGVPFSCVIVDEAGQSCEVETLTPLIHCNKLILVGDPKQLPPTVISMKAQGYDQSMMARFCKLLGEPIVQLTTQYRMHPDICLFPSNYVYNRSLKTNRVTETNRCS---------------SDWPFQPYLVFDVGDG-----SERRDNDSYVNIQEIKLVMEIIKLIKEKDVTFRNIGIITHYKAQKTMIQKDLDKEFEVDTVDAFQGRQKDCVIVTCVRANTQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNHLIQDAQKRGAII.. 1642
35 0.000e+00UniRef50_A0A2G3CU96 DNA-binding protein SMUBP-2 (Fragment) n=3 Tax=Capsicum TaxID=4071 RepID=A0A2G3CU96_CAPCH  ali  37  1................................................................................................................................................................................................................................................................................................................................................SLSREERKRQQLAVADVIKNADVVLTTLTGALTKKLDGLSFDVIIIDEAAQALEIACWIALLKGSRCILAGDHLQLPPTIQSVEAKGLGKTLFERLADLYGDEIMMLTVQYRMHELIMNWSSGELYENKIEAHSSVASHMLYHLEDVKKSP--------STENALLLIDTAGCDM--EEKKDEEDSTLNEGEAEVAIVHAKRLVESGVQASDIGVITPYAAQLKTLKSYVEKEMEISTVDGFQGREKEAIIISMVRSNSKKEVGFLSDRRRMNVAVTRARRQCCLVCDTETVSGDKFLKRLIEYFEEHGEYLS. 311
36 0.000e+00UniRef50_A0A0H5C7H6 SEN1 protein n=1 Tax=Cyberlindnera jadinii TaxID=4903 RepID=A0A0H5C7H6_CYBJA  ali  28  29......................................................................................................................................................................................................................RKVLVCAPSNAAVDELVIRMKDGIMLVRLGRTDAINSAVKDMTLEELVDSQLGKPSAAS--NNMDGLFKELSEVKKQIEICKAKIADEKNPASDEVYKEKRELTKKANLIKQKMDTERETQNSNYRSREINRRNLQAKILGEADIICSTLSGSAHDMVANLKFDSVIIDEACQCTELSAVIPLRYGRRCIMVGDPNQLPPTVISTEAANYDQSLFVRMAKN--MKPLLLNVQYRMNSAISKFSSEVFYNGELHDGPENDQLTKRIWH------------ENSFFPPFRFYDIIEGHQI---QNQKTFSYTNEIEVKIAVELINTLFTLYRNKNKIGIITPYKEQNRLLQRIFKKEITFNTVDGFQGQEKEIIIMSCVRADPSRGVGFLRDFRRLNVALTRSKCSLWILGNRDSLTKNELWRKLINDADSRGCFCE. 471
37 0.000e+00UniRef50_B0EMP1 Splicing endonuclease positive effector sen1, putative n=8 Tax=Entamoeba TaxID=5758 RepID=B0EMP1_ENTDS  ali  27  104.STEHYINCFKPILFDEIRATIQKSLIEN---------EEPFVIEGIINKIEITGN-DVLLSLIVKREEWGEF---DLIVVSNVSFETPFIIGVVVKKKESSLTLRCLKTKEQNNKKVYMRKITSIISSAREYLSLCTIQHLSLIKTLLKPSLKDTSPSNGIFGKYLQTMFNSSQIECINSALSKKGFSLIQGPPGTGKTKTLLGILGAIIMKHSKILVCAPSNAAVDEIVLRIKQKVNIIRIGNYAGINSKVNEVLIDTLISNELTKRGFNE-QKRTENVSSKIASIEQKMRALTKEIEDTVIALNNEKEKSSTKENDKKINRIHKYTQTXXXXXKIQREFAKIRKEITKQIFEEADILCCTLNTSGSDIFLNEKIENVIVDEAAQSVEISTLIPLRFGERCILIGDPQQLPATVISVAAQGYDRSLFERLYK-CGVSVDMLKIQYRMHPLIREFPSKQFYSGELIDG---------------RDESILPCSIDKGFGPVVFYDACGGL-----EERVGQTLANEVEVQIVIGLLEGLIKKYPKEWDIGIVTPYRQQLLLIKIAIESKLCVNTIDGFQGREMDIIIFSCVRSSQIKSIGFLSDIRRMNVALTRAKNALWVIGNSNTLCTNKTWKQYIEWLKEKDLIIEI 805
38 0.000e+00UniRef50_A0A1R2CBN7 Uncharacterized protein n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2CBN7_9CILI  ali  24  181..YDDYKETFESLLDLEHEYDK-------FYSSIENALEVEPTWIN--------DYRKFTYKIT---EEKMHFNSKDEVVVS---ADLFKANGVIEKVSQGEVTVELGKKGKDDLRKVHIKSVYTDVAYNRMIRGLKSFRSMESSLKNLILGYDVPIGDIDDFSVPNLPRLNSSQQSAVRKALTTK-ISLIQGPPGTGKTVTTASIVYHFSKILNQPSEYEKTKEAVDVITE--MMQELKLRKKIKELILAKSQGKSDYELIXXXXXCQIDFKLSKTSPDTGKKMILVCAPSNVAVDHLVRKCIQAGLKVVRFFSKSKEDIENDISYLSELEKPENKIAKELKIKYNKLEEEILTDVEVVCCTCIGALDHRLQGLKFHIVIIDEACQSQEPETLIPLLKPEQIVLVGDHFQLGPIIKCKEAAGLENSLFKRLID-LGNEKTMLNYQYRMHPAIALFPSLSFYNKELKNGVTEYERHDRYSNFAWPSRS-----------PVFFYHVD----SFEEHSSSGKSFVNRGEAETVLEIIKRL----GSDAEIGIITFYDAQRVTILNYTKSNIEIASVDSFQGREKDYIILSCVRANERLGVGFLGNYRRLNVAITRARYGLIICGHAPTLARSPTWNYLLNFYQDNGLV... 856
39 0.000e+00UniRef50_A4S6G7 Uncharacterized protein n=1 Tax=Ostreococcus lucimarinus (strain CCE9901) TaxID=436017 RepID=A4S6G7_OSTLU  ali  37  10..........................................................................................................................................................................LNPSQRVAVKSALSSS-LAVWQGPPGTGKTRTLIAYIGAAVHRGPIVLASAASNVAVDNILEGLAKESFIVRVGAPAKVQPWLQQLTLDAQIALHPLGRQAAAMREAI-------------------------------------------------RGQSGPAFARQRKQATQLELTAAKSILKSVDVVCTTCVGAGDELLEDFTFPVAVVDEATQCTEPGALISLTKALSAVLVGDSKQLPPTVVSRDAAGLQVSIFERM-ERLGVKVSLLDMQYRMHPQIAEFPSLAFYKGKVGSVPTPQDRPLVP-----------GIAWPSPNVPVAFVEIS----APESRAPDGNSLYNVGEAKMAIGVVRKLLAAGDGPGDIGVISPYAAQVRRLRNYLDEELEIRSVDGFQGREKEVIVLCTVRSNPSGDIGFVADPRRLNVGITRAKRGLIVLGNRKTLSNNEMWRSWFKWIDEQNCAVS. 461
40 0.000e+00UniRef50_UPI000515058D probable helicase senataxin n=2 Tax=Neognathae TaxID=8825 RepID=UPI000515058D  ali  26  644...............................................................................VISKEGQKEQHTVCHLTVQTRGNLSF-------FINKQVKCVVVGSLVTTHRTFKGLLLLSRSPLNPSYNDFCPRHLPVTSESAVSAYMNEYNDDQKRAIETAYAMPKICLIHGPPGTGKSKTIVGLLSRVLRKPNRFLVCAPSNAAVDELMKKICGDIKLVRLGAEKAINSEVRGFSLDKQVEHR--------MKRKPADYDQDIQKKKAALDQQLDMLSRQRAMHRCEKREISQKLDDEIGRLSKERQQLASQLK----EVRGHSQKVQADIILESDIICCTLSTSGGGLLESDPFSCVIVDEAGQSCEVEALIPLIHCNKLVLVGDPRQLPPTVKSVKAQGYDQSLMARLHRHLEEPVVQLTVQYRMHPDICLFPSNYVYGRTLKTDKATEENRCS---------------SEWPFQPYLIFDVGDGH-----EERDNDSFSNPQEVKLVMELIRTIKEKDLGIRRIGIITPYSAQKKKIQEQLDRVFEVDTVDAFQGREKDCIIVTCVRANSKGSIGFLASLQRLNVTITRARFSLFILGRLKTLMENKDWNELIQDAQKRGAII.. 1247
41 0.000e+00UniRef50_A0A250Y5M0 Putative helicase senataxin n=1 Tax=Castor canadensis TaxID=51338 RepID=A0A250Y5M0_CASCN  ali  26  16...........................................................................................................DNLPANLNGLMKCIVISSLVTTQRKLKAMSLLSGRNQLARAVLNPNPMDFCTKDERIIAYLKDFNEDQKKAIETAYAMAKICLIHGPPGTGKSKTIVGLLYRLLTKQNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLKFSLDSQVNHR--------MKKDLPSHXXXXXXXXXXXXXXXXXXXXXRALCRGGREIQRQELDGKIARVSKERQELASKIK----EVQGRPQKTQNIIILESHVICCTLSTSGGLLLEGVPFSCVIVDEAGQSCEVETLTPLIHCNKLILVGDPKQLPPTVISMKAQGYDQSMMARFYKLLEEPILQLTIQYRMHPDICLFPSNYVYNKSLKT---------------NRLTETNRCSSDWPFQPYLVFDVGDG-----SERRDNDSYVNVQEIKLVMEIIKLIKERDITFRNIGIITHYKAQKTMIQKDLDKEFEVDTVDAFQGRQKDCIIVTCVRASAQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENEHWNHLIQDAQKRGAII.. 599
42 0.000e+00UniRef50_UPI000BB088C7 LOW QUALITY PROTEIN: probable helicase senataxin n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BB088C7  ali  25  84.SYKDYVNIFIPHLLQEAWEQSYQSWKQMKSLSGVER-NSSPASSNLTCTWYSVINKETYNAMRKQDHLGEKF----LVIISKERPMDEKFIGYIEKIQPHSRRGSLEQTINAFK------PIGSLVTIVRQFQAVSSLPRSPVYQHILLPGQQYEKVTISDSMKQSLKRFNESQRLAICTASQMPKIGLLHGPPGTGKSSTVVAIVEKVLTSFGRICLCAPSNNAVDLLIKRLDDHKKIVRIGNAESIHRDVKKFSLSEILQKESFKLRTEKKKENIPRSVLENYNDLKERLKTLREQWRQCQGKKEEXXXXXXXXXXXXXXXXXXXXXHFKQINDVS-LSRAEENNLKRAILQRATVVCGTLSAFGQHFISDLLFDCVIVDEASQANELDCIIPLQYVNKLILVGDPEQLPPTITSQKAAKFGQSLFERFYRHFQSPVLMLDTQYRMHPDIAYWPSQYIYQGKLKTDHSVISRCRQ----------------SGRLKPFLLFDVQDSQEALSQTTG---SVSNPTEVEFIVQLVMVILETGVRPRDVGIIAPYKNQKHLLGSSLARDIEISTVDGFQGQEKEVIVFSCVRANQSKSIGFMADXKRMNVALTRAKSALYIAAHLDSLKEDVDWRNMIEDARRRHLI... 777
43 0.000e+00UniRef50_A0A2H9TNS8 Uncharacterized protein n=1 Tax=Paramicrosporidium saccamoebae TaxID=1246581 RepID=A0A2H9TNS8_9FUNG  ali  25  922.DAAHYTSIFEPLLFIECRAQLARSREESVNNET----------LSLRIAGVAHVDDFHEVVLQDDRDRDDWMCDQDYLIVFFDNPRETQTAIIVQSGTKGEIVIRLSIPNEKEGLKLKFQKIGNVITSLREYTAMHHLTLAPAIFSPKLASVKAIGVSTELGGISKALDINMSQARAISAVVQNNPITLIQGPPGTGKTKTIEALLGVLLGRVGKVMICAPSNAAIDEIVRRIRHKTKILRIGSLDMISDQVKDLTLDSQVDALLAASTANSIK------------------LXXXXXXXXXXXXXXXXXXXXXRREDQIKSLKTLLWEARENVRKNTKFLDDTRSNLRKKILGDAQIVCCTLSSSGHDILSRIDFDYLIIDEACQAVELSCLVPLQHCRQCILVGDPNQLPPTVISQMAGSYEQSLFVRLQKQCPESVLLLDTQYRMHPEISRFPNSYFYQGHLVDGPSMESVNKRPWH------------STRLLGPFRLFDVSGSEGTWKRQSGESRSKMNAAEARIAADLISMICHS------------------------APNIE----DGFQGQEREVIIFSCVRTGENKGIGFLNDTRRLNVALTRAKCSLFVLGKVSTLIQNPIWKAMVDDSKARDCFVPY 1549
44 0.000e+00UniRef50_A0A0C9UYI9 Unplaced genomic scaffold SPHSTscaffold_186, whole genome shotgun sequence n=1 Tax=Sphaerobolus stellatus SS14 TaxID=990650 RepID  ali  28  74..IENYKAKYLDLLTAERDAEVSLIRSRIKEWPLEKLQRAGYNLSDLSAFWPMNEFGRHVAAFLLGEMPKHRFECAVLLLLLDLSNTDISYERMVNAI------FSFAADPVEQEANPSDDQGRDIATHLRDEHPSRGAFFEDQRIQSWIRRHSVPGEPLVVEGDPPLDALNATQRRAVAFMLGER-LSLIQGPPGTGKTKTIVELLKAYFQVPQPLLVCTYTNVAVDNLVEGLKRGLKPLRVGYSAKMKKSIEKYTLDAQMDEHALKSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAYAS-------------------KMTGIITKMRTDLKRIYSQRWLLRMRMVQDIVHKSDVICTTCIASATSNLTCIDFPVIFLDEASMSTEPASLIPLMKGSRHVLIGDHRQLAPVITSSKAKGLNVSLFERLIKETSTPTVMLDRQYRMHPTLSRFPSSEFYNFALFDGTVGADGSIHPRLLPPTSTHLEVNPATGDRPSVIFLDHAGNEALKDR------SRVNLNEARLVCAVIEDLLMHNPKMRDIGVITPYAAQVSLLQRKLGADIEVKTVDGFEGREKDVIIFSTVRNNAAGQIGFLADRRRMNVGLTRAKRALFVIGSVGTLG..................... 727
45 0.000e+00UniRef50_A0A2D6U2D4 IGHMBP2 family helicase (Fragment) n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2D6U2D4_9EURY  ali  38  34......................................................................................................................................................................................................................................................................................................................................EKGMTHRDIKNNFKDIRRLEDEIVTSLLDSAEVICATTIGAGHRILGDRKFPIVLIDEATQASEPSALVPITRGCRLILVGDHKQLPPTVISEKAEGLNQSLFERL-NKCGIPAHMLTTQYRMHPVIREFPSARFYDNKLDDGCQSSDRPTP-----------AGLLWPDWDNPLAFIPVDGVEQQDEE----GSSRSNYAEAAKVLAIVQGLLEPGLTTRDIGVITPYNGQVRVLADLFYEGLEIKSVDGYQGREKEVIVFSTVRANDTGEVGFLSDRRRLNVALSRAKRGLIIIGNPTTLRHNKTWNSWLEWVEERNLF... 353
46 0.000e+00UniRef50_UPI0006D924DE probable helicase senataxin n=1 Tax=Latimeria chalumnae TaxID=7897 RepID=UPI0006D924DE  ali  22 1510.SYDDYFAAFYPLMILNSFEVLAQDWLENQKE-ASRMIRNDLTLQKNYCQYQMNCADFQASIRNSDLAKQHHPKEDDLVFLWLPDGQLIPYLGHVSRFNRTSVTIRTQGNVSLLQQHVKCEVIGSLVTTLRQFKALQLLYRSQL--ARPILSPRPSFFSTEALVHRANWNFNKDQERAINTAFRQPKICLIQGPPGTGKSKTIVGLLERILNKRNRVLLCAPSNAAIDDLMKKICGDINLVRLGAERVISADVQKFSLDYQVKHKINKAQVGSEQDIWRXXXXXXXXXXXXXXXXXXXXXPEQHRTLMEKKNELMKLREQLGRQVREVKVYRQYNKILIFIARGRNQEIQRNIILESHIICCTLSTSGSRRLGHDPFICVIVDEAGQACEPEILIPLIYCPKLVLVGDPMQLPPIIKSMKAQKYGQSMMWRLFKNLHVPVLKLTIQYRMHPDICLFPSRYIYNKALTTDIHTEEKRVS---------------SAWLFQPYLLFDVTDG-----SESRSSGSYFNQQEVKLVMALIKMMAKRDGMCRDIGVITPYSAQKRKLVQQLERSVEVDTVDGFQGREKDCIIVSCVRANMQGSIGFLANRQRLNVTITRARFSLFILGHLKTLMDNKDWNELIQDAQRRGAII.. 2276
47 0.000e+00UniRef50_A0A2K1KEF4 Uncharacterized protein n=3 Tax=Physcomitrella patens subsp. patens TaxID=3218 RepID=A0A2K1KEF4_PHYPA  ali  22  67.DLDEYLEVFESLLLEECRAQILRGDEE-----------EGARQCHMVVIQCERVNEFHFVKLAIDAGECQEYYENDLVLLSKEKLPSTYALANVESREGQRIRMYLDKELSGPKTAWWILKLCNMSTISREYTSLRSVGTLPFVKTILSASLVESDDPPPSLLDHLNHTHNVSQLQAIQLLNWRDDKGRVYCPTSETFTVILWSLSRGHLEQARHKLSLAFSHRNGDVSIQHKLELTSTKRMDHWIKASPWLRDLIMPMDGDDGFFPTSTNQFRPESIAAKRKHRKHEIVLRLLNTGLRDENGQAYTPNVVRVGLNAHHSVSAVTMDTLVNQRLSGVQKSAGMERDRCRISILDEAAIVCSTLSFSGAGVFLRMNFDVVIIDEAAQAVEPSTLVPLVHGCRQVLVGDPLQLPATVLSTKAHGYGMSMFKRLQKA-GYPVKMLKTQYRMHPLIRAFPSKEFYEGALEDGDDVERVTSRPWHEHRC------------FGPYTFFDIDG----EESQPPGSGSWVNKDEVEFVLVLYRHLVALYPELKTVAVISPYKLQVKLLRQRFTEVVDINTVDGFQGREKDIAIFSCVRATEGKSIGFVSDFRRMNVGLTRARASMLVVGCAKALKIDKHWRNLVTSSIERHRLY.. 790
48 0.000e+00UniRef50_A0A067CPM2 Uncharacterized protein n=2 Tax=Saprolegnia TaxID=4769 RepID=A0A067CPM2_SAPPC  ali  24  457.SLDEYMGNMKRAILEEALTGIQ------------DVNQHGAGTDKVRFLSLSEYTKGLLAAFSLPE--HLVLTNNDLVELCRMKDKRPSLRGVVYSTNNKEVTIILSEKHEIEAGAYLIKILSNLTTCSREYQAVLSLPTLPLMLRNLIVAAEVPTSSRPIMLAALQEKYNKSQLRAIQSAVE-RPLTLIQGPPGTGKTRTIVGLIGALL-SGSGMQATTQTNARVCVGASLGLQLSEKDRAAMAVRL-----------LVTAPSNAAVDVIIQRLQADGVFNVKTKTYEVPTMVRIGSMPGLKQTPTSQR-HKKQYKQTSAATIYLDQLVEQQHGQRRDQNWNHMQVRQEILQKAQIVFCTLSGAGSISMCDFRFDAVIVDEAAQATEASSLIPLKFATRWILVGDHKQLPATVLSPRRMGYETSMFQRLVAS--NDVHFLTKQYRMHPHIAQFPSAMFYDGQLQHGGVPRARPY---------------HATPAYGPYVFYDILQGEQSKAE---GSTSYRNLPEVAFIVSLVKGLVQSHPDYGKIGVISPYKSQIHELSTAFLKLVEVNTVDGFQGREKEIIIVSCVRTVRGRENAFWGDTRRMNVALTRAISSCWVVGNSALLSQNTAWCTLIEDCKARLCYVDL 1084
49 0.000e+00UniRef50_O64476 P-loop containing nucleoside triphosphate hydrolases superfamily protein n=9 Tax=Mesangiospermae TaxID=1437183 RepID=O64476_ARATH  ali  24  263.SMEEYVRVFEPLLFEECRAQLYSTWVELAEAN---------TYVKVRIKSIRRERGWYDVILNSLNGCKWAFKEGDVAVLSTPLPESDEDHGRVAGTVRRHIPVDTRDPKLKPQDIWHLTVLGSLATTQREYVALHAFSRLNPQMQNAILNPSPEQFPSTSFVDHLHRSFNAPQLAAIHWAAEPWPFTLVQGPPGTGMLNVIHLVQYQQLCAKPRMLVCAPSNAATDELLSRVLDRGFIMRVYRPDVARVGVDSQSRAAQVERRSDAISRDEILRHMRNLRLQETQISQNIAGLKRELLISRDQKRDALLQHLAAVVEARDKVLVEISRLLIVEGKFRANLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTFDMVVIDEAAQASEVGVLPPLALGARCVLVGDPQQLPATVIS-KAAGYSRSLFERFQ-LAGCPTLLLTVQYRMHPQIRDFPSRYFYQGRLKDSESISSAPDEIYYKDPV------------LRPYLFFNISHGR---ESHRGGSVSYENVDEARFCVGVYKTLKSLGAGKVSVGVITPYKLQLKCLKHEFGKEIYINTVDAFQGQERDVIIMSCVRASGHG-VGFVSDIRRMNVALTRARRALWVMGNASALMKSEDWAALISDARGRNCFMEM 1046
50 0.000e+00UniRef50_A0A1W4ZWP1 probable helicase senataxin n=4 Tax=Osteoglossiformes TaxID=41712 RepID=A0A1W4ZWP1_9TELE  ali  24 1498.SYDEYFGTFYPLLLINTFEELVNEWMKNS--------DTGRIQQHLQVIGIEYSNRLCSASFTQDAKYQQYPKEDDLVILWLPQNKSACHFGCVSRSNKNNITIQTYGNVSSVNNQFKCELVGSLVSAIREFKALCFLKNNPMVRALLVPHVTFFRPGPDRILNLSLPDYNPEQIKAISCGLRTPKICLIHGPPGTGKSRTIVGLLQRLFSPKLRVLLCTPSNAAIDSLMKKICGDINLVRLGLEKTISKHLKPFSLDNQTRSRTRKA----------QHGHDVDIQRKEQLDQCIEVLSQKVAMVEKGTEMFQKLTDEKYKLLKER----EQLGRRLRETRSRRQETQAKVLQDAHIICCTLSTSGSRRLGHKPFSCVIVDEAGQATETETLIPLLYCPALILVGDPEQLPPTVVSQTAKEYDQSLMARLRKCLHNPVIFLNRQYRMHPDICEFPSKYIYNRELMTDDETAQKRCA---------------VNWPFQPYRLFDVTDG-----REVKDGDSFYNQKEVRLVRFLLKLIAEKQV--GKVGVITPYNAQKHRILDSISAEVEVDTVDGFQGREMDCVIVSCVRASSEGSIGFLGNRQRLNVTITRAKSSLFILGHLRTLKEQKDWGALIDDACKRGTII.. 2196
51 0.000e+00UniRef50_A0A1Y1X3C7 p-loop containing nucleoside triphosphate hydrolase protein n=3 Tax=Neocallimastigaceae TaxID=29007 RepID=A0A1Y1X3C7_9FUNG  ali  25  99....QYRKVFEKLLLVECWSQYVQALEELNLKND----SFPVYIDNVEMKEFSKDRRDTSIEILLTGSSKHKFLVNDVLILYQGDNLEDSILVRVLEFQSNKINNTFSKEHEMANTSWRCIKLFTLITLRREFLVLEQIIKSPLRKSIFNPTLEKDLRPDYIQKIRNDYELNESQAEAVDLVMQNNGFSLIQGPPGTGKTKTVLVLINEILKKSPKILVCTPSNAACDEIARRLKVKLPILRYG-ISDISEDCKDLSLDVLATDNLIDDLTNEEREELTELAKNLVYYQRKMATIMDDLNKEYEVGKIDQDSVNFLTNEMKLAENRKMFYLKEYIQCIKSNISKLIIHSKYRVFEQVNVVLTTLSISTQSALTDDIYSTVIIDEAGQASELTTLIPMQHHKHAVLIGDPNQLPPTIISKVAQNYEQSLFKRFQNCRPDLVKMLNIQYRMHPGISQFPRQYFYENRLQDHESMFKKRSRPWH----------QDSMNRFPPFLFLDIKGQERFNRER---GISLVNEAEVGAIAQIIKSLCINYPEAYKLGIVTPYRGQVRKLRSHFLKYIEINTVDSFQGQEKDIIFFSCVRSSPSHGIGFLADVRRMNVAITRACSSLIILGDTETLLSNDSWASLIQYAREVKSI... 822
52 0.000e+00UniRef50_A0A2D7DGD0 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2D7DGD0_9FLAO  ali  29  30............................LEKQSLRVRKAEGLTWAPVTIENQSFTFGGR-IKLALKKGQDDAFRSGSPVHFYQANDDRAVRRGIVRKIRGGTAEVILDGDPLESATRWTMDERSDDRTYRLMAEALSHWINTEDSMRNGLLGQGLARLPLETKPIAH-PSLNPGQCVWVSVAEAANELAILHGPPGTGKTTTLLGFVQRAVERGERLLLSAPSNAAVDLLVKGCVRETTPVRIGHPVRLDADVVEYGLDAHVEKEPEFRQVKDMRKRAEKAWKRANTFHRNFG----------------------------VEQRAERKAARNEARSLDSEANAMEAYLSERIVRTGQVVCATLAGCADGNLKGQAFDWVIIDEASQAMLPAALIAMQRGPRLILAGDPLQLPPVVKSDAARGLEVSALEWMQGDHNASVHMLTDQYRMAPDIMKLASDSFYDGRLQDGRAVS--------------------PPAALNAVLFIDTAGCG-FDEDKEPVSGSTCNPDEAGFLIQRLLEVAAEYPLHA-IAVIAPYRAQVDVLNQHLRTRIECSTVDAFQGQERDVVFISLTRSNASGEIGFLKEYRRMNVAMTRAKHKLVVVGDGATVGQDAFFAGLFEAAEARGFY... 628
53 0.000e+00UniRef50_J3N0M6 Uncharacterized protein n=65 Tax=Mesangiospermae TaxID=1437183 RepID=J3N0M6_ORYBR  ali  24  455.SAEEYIRVFEPLLFEECRAQLYSSYEE-----SVESVSRDSHVMVRVKTVDRRERGWYDVVVLPMHEYKWTFKEGEVAVLSFPRPGSASLVGTVRRFDSNSETNVLRKLLP--RSTWYLTSLGSLATTQREYVALHAFRRLNVQMQNAILQPSPEHFPKYEEQPPAMPDFNGPQLSAIHWAAEPWPFTLVQGPPGTGMLNVIHLVQYQHLCPKPRMLVCAPSNAATDELLARVLDRGFIDGEMKVYRPDVAVDSQSRAAQVERRTDQLLMKGRDEVIGWXXXXXXXXXXXXXXXXXXXLAQRDRNRDFLLQKLAASVESRDKVLVEMSRLLILESRFRVNMEDARASLEASFANEAEIVFTTVSSSGRKLFSRLSFDMVVIDEAAQASEVAVLPPLSLGARCVLVGDPQQLPATVIS-KAAGYSRSLFERFQQA-GCPTILLSVQYRMHPQIREFPSRYFYQGRLTDSESVVKLPDEAYYRDTLMA------------PYIFYDISHGR---ESHRGGSSSFQNVHEAQFVLRLYEHLQKNGGKKASVGIITPYKLQLKCLQREFEKDIYINTVDAFQGQERDVIIMSCVRASNHG-VGFVADIRRMNVALTRARRSLWVVGNANALMQSEDWASLISDAKARKCFMDL 1256
54 0.000e+00UniRef50_A0A287E3L1 Uncharacterized protein n=1 Tax=Hordeum vulgare subsp. vulgare TaxID=112509 RepID=A0A287E3L1_HORVV  ali  30  275..IEDFVRHMSDLLRIERDAELEFTQEELNSKPVEYLVTHGQTICNLSVISSSTGLGGHLVLFREHKLPPTTLSPGDMVCVSRGEGATSCMQGFLYNLGEDSITVALESRHGDPGKSVRIDRIADALTYERNLEALMLLQRNGLL---------KSNASIDVVATLFGDGKDVMKME--------QNCLIDWGESSLPDPR------LSERYAFENVLVTAPSNAAVDNMVEKLSSGLNIVRVGNPARISPSVTSKSLAEIVNGRLSQFXXXXXXXXXXXXXXXXXXXXXDS----------------------------------LAAGIRQLLKQLGRDLEMKEKETIMEVLSDAQVVLSTNTGAADPLIRKIGFDLVIIDEAGQGIEPSCWIPILQGKRCILAGDHCQLAPAILSRKALGLGKSMMERASLLHGLLTTRLTVQHRMHDSIASWASKEMYQGLLQSSHSVASHLLADSPVV--------KDTWITRCPLLLLDTRNADCVEHLDPAGTGSFYNDGEADIVTQHVLNLVHCGVSPSEIAIQSPYIAQVQLLREKIEEGVEVSTVDSFQGREADAVVLSMVRSNPLGAVGFMGDSRLMNVAITRARRHVTVVCDTSTICHSTFLARLLRHIRRYGQV... 907
55 0.000e+00UniRef50_F6QL80 Senataxin n=3 Tax=Monodelphis domestica TaxID=13616 RepID=F6QL80_MONDO  ali  23 1733.NSEDYLNVFFPLLILNTFETVAQEW-------IDNPKKGNTYELHLRSFSAGDINGQFVVCLQECDMKQLHPKENDLVFLSEMKDQQVYHCGYVSQFRRSSVRHNFEGCLSIQNESIDCIVISSLVTTQRKLKALSLLGRNTLNPSTSDFCPRDSLNTAPERILTYLKDYNEDQKKAIEVAYAMAKICLIHGPPGTGKSKTIVGLLYRILTKRNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLKFSLDSQVNHR--------MKKDLPSHXXXXXXXXXXXXXXXXXXXXXRALDRCEKGQKRSNLDEEIARISKERQQLASKLK----EVRGRPQETQSSIILESHIICCTLSTSGGLLLESVPFSCVIVDEAGQSCEIETLTPIHRCNKLILVGDPKQLPPTVISVKAQGYDQSMMARLYKHLEEPVLQLTVQYRMHPDICLFPSSYIYNRTLKT---------------NRLTEESRCTSDWPFQPYLVFDVGDG-----SERRENDSYVNVQEIKLVMELIKLIKDRDITMRNIGIITHYKAQKMMIQQELDKEFEVDTVDAFQGRQKDCVIVTCVRANSQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNHLIQDAQKRGAIIR. 2445
56 0.000e+00UniRef50_A0A1I7BKI6 Superfamily I DNA and/or RNA helicase n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1I7BKI6_9FLAO  ali  29  1MNREEKAEHLITLIKQEQKAQQDK-WNFSENVSLKSLKAQGLVLHPLKIKRRKYGFADYIIEFELPFETDTNFKSGVALEFFAHHEEQQSCNAQLVFLNNRSGEIRLPDFPEWEERNLGIKLVPDDKSFKFMLKAIKKGEDKHTAQLFDIVHGIKASKNIAVEEANEIKGLNISQAIAAKAVVDNEDVCILHGPPGTGKTTTLVAAVLELLKKGEKVAVTAPSNAAVDHFTRCLHQNIDVLRMGNAAKIDEELFVHT----------------------------TEGVAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGKSEREQRKLLYQEVKSIRQEIKQLEAFSVEKAVEKAQVITGTPVGLQDELLKELRFDTLVIDEAGQCLEPMAWVAIEKADKLVLAGDPFQLPPTVISDAAAGLTLSILEQSFQ-HKIPTYLLNTQYRMQEKIASFSSEYFYKGELLTDEPLKANS---------------------ENALQFYDTAGYEAP-EKQGEDGYSLSNLEEIRIVEKLIDDLK---LKRKDIAFISPYAAQVSLAKKLLDG-IKCSTIDAFQGQEKPIIFISLVRSNTEGNIGFLKDYRRMNVALTRAQKQLFVIGDSATFGNDDFYSKFLNYVESHEAY... 602
57 0.000e+00UniRef50_UPI00022F6915 probable helicase senataxin isoform X2 n=5 Tax=Rodentia TaxID=9989 RepID=UPI00022F6915  ali  24 1708....EYFNVFLPLIILNAFETVAQ---EWFNSPNKEN------FYHLHLRKDYKKYWEFMIYLEESELKQLHPKENDLVFLVPEQDRNGYYCGYVHKFRRTSVMRSQDNLPVRLNEFMKCIVISSLVTTQRKLKAMSLLSSRNQLARAVLNPNPMDFCTKDERIITYLKDFNEDQKKAIETAYAMAKICLIHGPPGTGKSKTIVGLLYRLLTKQNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINTEVLKFSLDSQVSHR--------MKKDLPSHXXXXXXXXXXXXXXXXXXXXXRALCRGGREMQRLELDGCIVKVSKERQELASKIK----EVQGRPQKTQNTIILESHVICCTLSTSGGLLLEGVPFSCVIVDEAGQSCEVETLSPLIHCNKLILVGDPKQLPPTVISMKAQGYDQSMMARFCKLLEEPILQLTIQYRMHPDICLFPSNYVYNKNLKT---------------NRMTETIRCSSEWPFQPYLVFDVGDG-----SERRDNDSYINVQEIKLVMEIIKLIKRKDISSRNIGIITHYKAQKTMIQKDLEKEFEVDTVDAFQGRQKDCIIVTCVRASAQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWYELIQDAQKRGAII.. 2414
58 0.000e+00UniRef50_UPI0004BDD67B probable helicase senataxin isoform X2 n=3 Tax=Laurasiatheria TaxID=314145 RepID=UPI0004BDD67B  ali  24  464......................................KEKFCQLHLRKFADYKKYWEFVVYLEECELKQLHPKENDLVFLCMQDPHEYHC-GYVHKFRRTSVMRNQDNLPVNLNELVKCIVISSLVTTQRKLKAMSLLSGRNQLARAVLNPNPMDFCTKDDRIIAYLRDFNEDQKKAIETAYAMAKICLIHGPPGTGKSKTIVGLLYRLLTENHRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLKFSLDSQVNHR--------MKKDLPSHVQDMHRRKEYLDHQLDELSRQRALCRGGREVQXXXXXXXXXXXXXXXXXXXXXIK----EVQGRPQKTQNNIILESHVICCTLSTSGGLLLEGVPFSCVIVDEAGQSCEVETLTPLIHCNKLILVGDPKQLPPTVISMKAQGYDQSMMARFYKLLEEPILQLTVQYRMHPDICLFPSNYVYNKSLKT---------------NRLTETSRCSSDWPFQPYLVFDVGDG-----SERRDNDSYVNVQEIKLVMEIIKLIKRRDVTFRNIGIITHYKAQKTMIQKDLDKEFEVDTVDAFQGRQKDCVIVTCVRANTQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMDNEHWNELIQDAQKRGAII.. 1143
59 0.000e+00UniRef50_A0A183L142 Uncharacterized protein n=3 Tax=Schistosomatidae TaxID=31245 RepID=A0A183L142_9TREM  ali  35  1..................................................................................................................................................................................................................................................................................................................................................................MAADVVCCTCVTAGDARLERLSFHSVLIDESTQATEPECLIPLMVGCRVVLVGDHCQLGPVITCKKAAGLTQSLFERFV-LLGIRPIRLQVQYRMHPALSAFPSNVFYEGSLQNGVTAEDR-CKKIDFPWP----------NPDRPMFFYCTSG----QEEISGNGVSYLNRTEAATVEKIVTKMLKIGVHPNTIGVITPYEGQRAYLAHKLYQEIEIASVDAFQGREKDYIILSCVRANENQGIGFLNDPRRLNVALTRARYGLIVVGNPKALCKQPLWNQLLHFYRDQHLLVE. 292
60 0.000e+00UniRef50_A0A0B1P547 Putative dna helicase n=1 Tax=Uncinula necator TaxID=52586 RepID=A0A0B1P547_UNCNE  ali  35  1.................................................................................................................................................................................................................MVKRQKRVLVCGPSNISVDNIVERLPSKIPIVRLGHPARLLPSVLSTSLDVLLQSSNAAAIVKDIQKEMDS----------------------------------KQTSIRKTKSGKERKQIYADLKELRKEYKNREKNVVTSLLGNCKVVLATLHGAGAFNMRSEVFDAVIIDEASQALEAQCWVPLLSAQKVILAGDHLQLPPTVKSLNSRTLERTLFSRLLELHGKIKCMLTTQYRMNEKIMRFPSDELYESKLIAAEAVKNCLLKDLPYE-------VQETEDTIEPLIFFDTQGGDFPERNEEEIGESKSNEMEAALAKFHVQKLVDAGVKTEDIAVITPYNAQLTLLNQSMKPGIEMGSVDGFQGREKEAVIISLVRSNSKREVGFLGDKRRINVAMTRPKRLLTVIGDSETLRNDKFFQRWIDFLEEN...... 440
61 0.000e+00UniRef50_A0A0F6I8C0 UvrD/REP helicase N-terminal domain protein n=156 Tax=Leptospira TaxID=171 RepID=A0A0F6I8C0_LEPIR  ali  31  37..............................SRPIPDRVRQGITLYPIVYEEQREGNWILTFRFSNQEEYPIKFQTGAPVQLGKN---EDRAKAILVSLHKEKIKISIEEVPEWEEGKCFLDLLPDETSYKEMFNALDAVRLATKVNRELLLGYGKPDLISTRDSDRISTSLNESQKNAVIHSVLSEDVMIIHGPPGTGKTTTLTEIVSQLVAEEKKILVSAPTNSACDLLVESITRGILVLRLGHPARVNEIAIHSTLDYKLFHHPDGKLLNEYRKDVIEISKQAKKFKRNFGE----------------------------KEREERKKLFTEVKELKKTIRSMEIGLIDSLVSSHPVIVSTPVASARGILENRTFDFCVLDESSQALEPAFWISILKSDRVILAGDHKQLPPTLFSEKNY-LETTLFEKAAENLESRVFLLDTQYRMKDEISAFPSKEFYSGLLKSGRSEKERK------------SNFPKTFPFSNAFQWIDTSG---TDSEEVILDDSISNPFEADLQVRLCFLLKENDWPEDEITILSPYRAQVRLISEKLRDKINVSTIDSFQGRENRCILLGFVRSNLEGRSGFLKESRRINVGMTRARDLLLCIGDSSTLSQDPFLSKLIRFAEEKEVF... 628
62 0.000e+00UniRef50_UPI0009731C13 probable helicase senataxin n=1 Tax=Esox lucius TaxID=8010 RepID=UPI0009731C13  ali  24  978.SYDEYYNTFYPVLLTNAFEELASEW-------LKNKESGKVMSHNLKIVANDKCNSFWSVSCTASITYQLYPKEEDLVILWQPQNTSSYFFGYVQRFNQTNLTIRILGNVSLVNQQMRCDVVGSLVSTMREFKAICRL--RNGSMLRPLLSPQAPFFQSGPEVIPSLPGYNSDQVRAVRTALKNPKICLIHGPPGTGKSKTIVGLLQQAKSRQMRVLVCAPSNAAIDSLMKKICGYINLVRLGNDRTISESMKPFSLDNQVKSR------------IEKYQAGHHKDVHRHGLQLDE-EIDRISNLLPKXXXXXXXXXXXXXXXXXXXXXRQALSFELRKTRSAKQVTQTQVLIDAHVICCTLSTSGSSLLEHEPFGCVIVDEAGQATETETLIPMLYCNALVLVGDPNQLPPTVISQKAKNYGQSLMARLVNNIPSPVIFLSNQYRMHPDICRFPSKHVYHNALKTDNETAERR---------------VNLSWPFQPYQVFDVTDGQEVKERD-----SFSNPKEIQLVRFLLELIAEK--QQVRVGVITPYNAQKDRINRELGPRVEVDTVDGFQGREMDCIIVSCVRSHEQGNIGFLGNRQRLNVTITRAKCSLFILGHLRTLRENNEWGALIKDAATRDVII.. 1695
63 0.000e+00UniRef50_A0A0H2S4C0 p-loop containing nucleoside triphosphate hydrolase protein n=2 Tax=Hymenochaetales TaxID=139380 RepID=A0A0H2S4C0_9HOMO  ali  29  83.SIEEYEGRFLPLIEAEEREEEKLIFDRLTYWPLERLKREGYCMTGLHAFWSGKNLGRPIAAFRFDSLPTHSFSKGTKVYISRTDPLKEPYKGSIVSLTPDEVGVAFEEDFEAESGLWRMDLGYSNASFERMKAAIRMLPFDPEEFRDVLLKTFSPETPVEQQAHHLQDKLTESFKGAFSEDMRRQDPLVLDGDPDLGKTKTIVETVKLLKKEFHPILVCTYTNVAVDNLVEGFVQGLKPLRIGFEGKVKSDLEEHLLEYQFDSHPLQKLFEKITEKXXXXXXXXXXXXXXXXXXXXXSSISXXXXXXXXXXXXXXXXXXXXXXXXXXXXRFIMEQRMYR-----------DILSKVDVICTTCIRSASYQLNAIDFPVVFLDEASMCTEPASLVPLMKGCRLALIGDHKQLPPIVLSNVAKGFDISLFERLTEEGVVPSIMLDTQYRMHPGISRFPSSEFYNLSLLDGTVNKAGQVTPNLLPPVSSHLPANMETGHRPSVIFIDHQGPEAVKSR------SRVNWTEGYIACSVIEDLLLNNPRGENIGVIAPYKSQISLLTRLLTKDIEVKTVDGFEGREKDVIIFSTVRNNESGYIGFLADRRRLNVGLTRAKRALFVLGSMSTLGNGKFWRNYVEFLTEQKLIVAL 840
64 0.000e+00UniRef50_UPI000D6A1024 probable helicase senataxin n=1 Tax=Python bivittatus TaxID=176946 RepID=UPI000D6A1024  ali  23 1674.NYDDYFNIFFPLMILNAFEEVACEWLENQKM-----KEQKPFYLNILNFNMDMNNADFTANISQHDLDQHHPKEDDLVFLIGSDKRSSYHVGFVTRFSHSSVHIQTQGNLSRIDKEVKCIVVSSLATTQRRFQALLMLKRSPLAMPILCPSSSYFSPRDSEKPVSYMKDFNEDQRRAIESAYAMPKVCLIHGPPGTGKSNMIVGLLHRILIKRNRVLVCAPSNAAIDHLMKKICGNINLVRLGQQKSINSKVRKFSLNDQIDH--------KINKAMLGKXXXXXXXXXXXXXXXXXXXXXRAMDRSEKXXXXXXXXXXXXXXXXXXXXXL-------KEARGRSQELKASIILESHIICCTLSTSGGELLKGDPVSCVIVDEAGQTCEIETLIPLIYCKKLVLVGDPKQLPPTIKSMKAQDYDQSLLGRLCRHLKCPVFQLKIQYRMHPEICLFPSKYIYEGVLITDRKTAEDRFS---------------LEWHFQPYLLFDV-----LDSREERENDSYFNPQEVKLLTELMKVIKKKDISCHQIGIVTPYNAQKRRIQKQLDKEFEVDTVDGFQGREKDCIIVTCVRANSQGSIGFLRSLQRLNVTITRAKYSLFILGKLKTLMENKDWNELIQDAQRRGNIV.. 2377
65 0.000e+00UniRef50_A0A2V3I017 Uncharacterized protein n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2V3I017_9EURY  ali  37  26................................................................................................................................................................................................................................................VRLGQPVKVRESLREATMDAQMEEHPLHRDLDHWLKSNEKLDRRVKGMK-----------------------------------GKEKGLAHRDLRRGWKEVRRIEAQMRDDILDRAQVLCCTCIGSGHQILDGRRFSRVLIDEATQATEPAALVPLVRGRQIVLIGDHRQLPPTVISQRAEGLNRSLFERITEM-GIEPLLLRTQYRMHPAISCFPNERFYGGLLEDGVAAEDR-----------ATPAGLLWPDWEQPIAFLPLKGG----EVTAPDGASKENPAEAVWIARLLEGLLDAGLQQEDIGIITPYAGQVRAIRDSVPEKVEVHTVDGYQGREKEVILFSCVRSNSDGNVGFLADSRRLNVALTRAKRGLIVVGDPGTLRYDEDWAAWLEHVRSRNL.... 387
66 0.000e+00UniRef50_F9WSH3 Uncharacterized protein n=1 Tax=Trypanosoma vivax (strain Y486) TaxID=1055687 RepID=F9WSH3_TRYVY  ali  29  177...KQYSNVFREMVLHDRRCAAARRSEEIRHVSCHMVGEKGSA---------------FFYALRPFPWKDIGLSTGDVVVLRNDKPMT--FQGTIAKTEKWCIIIVTPPARDASKHENTASFIENEHPVTKKLEALMRFSFASSRCEIARAVLGHPSGRRLSPSLQFFKGLNESQQAAVKAALSNA-FTLIQGPPGTGKTSTSVQIIRQLLLRKKRVLVCAPSNAAVDHLSESMYKKIDFIRVQPRYRENDSGRPYTLGSRVREIMEAMPLNRKKRDI-------------------------------------------VKRALESGRLSEEEKQLCQKLE---DRAVKKILAETRVVACTCIGAGSRWLRGFKADFVLIDEASQATEPETLVPLFRGEKQVLVGDHRQLGPVVLSNVAKGFARSLFERLAGA-GSEITQLNLQYRTHPFIYRFSSMAFYGGTVLDGVPAEKRDASGI-FPWP----------NPEKPMLFYDCSGV----EEVGDSGASFLNEAEARATISVVDAVLESGVRPDEVGIISPYRAQCEYMRERLYEKVEISTVDAYQGREKEIIILSCVRNNEERTVGFIGDERRLNVSLTRARRGLIAIGKAEALRGDKCWSKLLLYMGEHSLAVT. 778
67 0.000e+00UniRef50_A0A212CVW8 Uncharacterized protein (Fragment) n=13 Tax=Boreoeutheria TaxID=1437010 RepID=A0A212CVW8_CEREH  ali  24 1662....DYFSVFFPLVVLNTFETVAQEWINSPN-------KEKFHQLHLRKFGDYKKYWEFVVYLEECELKQLHPKENDLVFLVPERPNEEYYCGYVHKFRRTSVMRNQDNLPVNLNELVKCFVISSLVTTQRKLKAMSLLSGRNQLARAILNPNPMDFCTKDERIVAYLKDFNEDQKKAIETAYAMAKICLIHGPPGTGKSKTIVGILYRLLTKQNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLRFSLDSQVNHR--------MKKDLPSHXXXXXXXXXXXXXXXXXXXXXRALCRGGRESQRQELDGKIARVSKERQELASKIK----EVQGRPQKTQSIIILESHVICCTLSTSGGLLLEGVPFSCVIVDEAGQSCEVETLTPLIHCNKLVLVGDPKQLPPTVISVKAQGYDQSMMARFHKLLEEPVLQLTIQYRMHPDICLFPSSYVYDGTLKTNRGTETSRCS---------------SDWPFQPYLVFDVGDGL-----ERRDNDSYVNVQEIKLVMELIKLIKRRDINFRNIGIITHYKAQKTMIQKDLDKEFEVDTVDAFQGRQKDCVIVTCVRASTQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLVENRHWYHLIQDAQKRGAII.. 2368
68 0.000e+00UniRef50_A0A2E9YAL3 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E9YAL3_9FLAO  ali  28  15.............LVFEQREEEKRLASVIEGKSLRIRRAEGVTWSPISIEEQDFTFGGRVIKMNHNAGLAGAFRAGSPVSIYSPQNEGEVRIGIVRKATASAVDVIMDGNPSEMHERWTLDARSDDRTYQCMARALNHWINTDNEIECSDFPVLEDSMRKEELKSYGFGSLNGLQKKWLDAALKRPAMSLLHGPPGTGKTTALLAYVVEMVQGKLRLLLTAPSNAAVDLLVAGCKQGVSVVRIGHPMRLSDEVQPFGLDAQVEEDSEYRQVRDLRKRAKKAWQVADRFHRNFG----------------------------SEQRAERASARKEAKSLEREAIELERFIAERIVRKAQVVCATLAGAANPALEDERFDAVVSDEAGQAMLPGALIPMQLSSRYVLAGDPHQLPPVIKSRRASGLEESAFMR-SKFCADSITMLAEQYRMHPEIMAPSSHWFYEGQLRTAAELKSQSLPDI----------------LRSPWTFIDSAGCGFEEEKEEGSES-TMNSSEAEFVLKRTLEILSGCPSF-QVGVIAPYRAQVAELQRQFEERAEFATVDAFQGQERDAIVISLTRSNAEGEIGFLKEYRRTNVAMTRAKHHLLMVGDGATLGSDDFYRQLMERAETSGAY... 637
69 0.000e+00UniRef50_U3JFH1 Senataxin n=67 Tax=Aves TaxID=8782 RepID=U3JFH1_FICAL  ali  26 1754..YNEYFNTFFPLMMLNAFETLAQEWIENQKV-----REKSYCFY-LENFSADMNTAHFTAHLRESDLRQLHPKEDDLILLVVHKEKDVNHVGLVTRFSRCHLTVQTRGNLSFIHKQVKCVVVGSLVTTHRKFKGLLLLSRSPLAKPIINPFCPRDLPVASGSAASYMNEYNEDQKRAIETAYAMPKICLIHGPPGTGKSKTIVGLLSRVLRKPNRFLVCAPSNAAVDELMKKICGDIKLVRLGAEKSINSEVRGFSLDKQVEHR--------MKRKPGDCDQDIQKKKEALDQKLDMLSRERAMHRCEK-RESQMLNDEIGRLAKERQQLASQLK----EARGHSQKVQADIILESDIICCTLSTSGGSLLESDPFSCVIVDEAGQSCEVETLIPLIHCNKLVLVGDPKQLPPTVKSVKAQGYDQSLMARLQRHLEEPVVQLTVQYRMHPDICLFPSNYVYGRTLKTAKSVEENRCS---------------SEWPFQPYLIFDVADG-----REERDNDSYSNPREVKLVMELIRTIKEKDLGLRRIGIITPYSAQKKKIQEQLDSVFEVDTVDAFQGREKDCIIVSCVRANSKGSIGFLASLQRLNVTITRARFSLFILGRLQTLMQ.................... 2456
70 0.000e+00UniRef50_F4Q984 Uncharacterized protein n=1 Tax=Cavenderia fasciculata (strain SH3) TaxID=1054147 RepID=F4Q984_CAVFA  ali  31  79....EYYEKFKQLLVMESKEDKQSVERRLSQRSVDQLAKKGLALKNTTAILKGKLLSEIIVRFAVDYDPGLKIGSGESVIISKKDPLKDDVEGIYLETTGKSILVSIKNQSGFEKGPWRIDLGTNLITMERMMKALTMVSSDKALYQTKLADEYIPFQTKESPLKFKDWNLNPSQKDAIEKSICRRA-SLIQGPPGTGKSTTAIYLLRLLVHRKQKILATSFTNTGVDNLLEGLLKGVNVLRLGDANKVREE------------------------------------------LRCATLEYRMEEELNRWDSSAKRSNQGSKPGSSSYYMQSE------------REIKSRLISEADVICSTCIGSGHEMLMDEKFQIIVVDEATQATEPAILIPLLKSSQMYLFGDQNQLAPIILSHKAGGLNISMFDRLFKS-GLTPFLLNTQYRMHSSISDFPRHHFYNGLLNNGTNDSNLKI-PIGIKWPQIDF----------PVVFIDISNG-----REEIKHHSLYNNEEAVAVVQVAESLLENDLFRNNIGIITPYHAQVKHINQVFSNDPSVATVDSYQGREMDVIIFSTVRSNTKGNIGFLKDWRRLNVSITRAKRGLVVIGNFGTISSDEHWKAYVQWAKDKNIMV.. 721
71 0.000e+00UniRef50_Q7Z333 Probable helicase senataxin n=208 Tax=Eutheria TaxID=9347 RepID=SETX_HUMAN  ali  23 1739.NYGDYFNVFFPLMVLNTFETVAQEWL---NSPNREN------FYQLQVRKDYIKYWEFAVYLEECELKQLYPKENDLVFLAPEQDLHEYHSGYVHKFRRTSVMRNQENFPANLNELVNCIVISSLVTTQRKLKAMSLLGSRNQLARAVLNPNPMDFCTKDERIIAYLRDFNEDQKKAIETAYAMAKICLIHGPPGTGKSKTIVGLLYRLLTKQNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINSEVLKFSLDSQVNHR--------MKKELPSHVQAMHKRKEFLDYQLDELSRQRALCRGGREIQXXXXXXXXXXXXXXXXXXXXXIK----EVQGRPQKTQSIIILESHIICCTLSTSGGLLLEGVPFSCVIVDEAGQSCEIETLTPLIHCNKLILVGDPKQLPPTVISMKAQGYDQSMMARFCRLLEEPILQLTVQYRMHPDICLFPSNYVYNRNLKTNRQTEAIRCS---------------SDWPFQPYLVFDVGDG-----SERRDNDSYINVQEIKLVMEIIKLIKRKDVSFRNIGIITHYKAQKTMIQKDLDKEFEVDTVDAFQGRQKDCVIVTCVRANSQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNQLIQDAQKRGAII.. 2448
72 0.000e+00UniRef50_C1LG30 Regulator of nonsense transcripts 1 n=4 Tax=Digenea TaxID=256429 RepID=C1LG30_SCHJA  ali  32  3....................................................................................................................................................................................................................................................................................................................HIQAQNVKGHTELRKLQQLKDETGELSQDDDKRYRVLKRELERELLMAADVVCCTCVTAGDARLERLSFHSVLIDESTQATEPECLIPLMVGCRVVLVGDHCQLGPVITCKKAAGLTQSLFERFV-LLGIRPIRLQVQYRMHPALSAFPSNVFYEGSLQNGVTAEDR-CKKTDFPWP----------NPDRPMFFYCTSG----QEEISGNGVSYLNRTEAATVEKIVTKMLKIGVHPNTIGVITPYEGQRAYLAHKLYQEIEIASVDAFQGREKDYIILSCVRANENQGIGFLNDPRRLNVALTRARYGLIVVGNPKALCKQPLWNQLLHFYRDQHLLVE. 340
73 0.000e+00UniRef50_UPI000775AFA7 probable helicase senataxin n=2 Tax=Colubroidea TaxID=34989 RepID=UPI000775AFA7  ali  25 1633.NYDDYFKIFFPLMMLNAFEEVASDWLE--HRKLKEPKSFHLTLLN---FNMDLNKADFTANISHDVENQHHPKDDDLVLLTVSDKRFIRHVGFVTRFSHCHLSIQTQGNLSRIEKEVKCLVVSSLATTHRRFQAL--LMLNRSPLAMPILSPSAPYFSPREKSLPYMRDFNEGQRRAIESAYAMPKICLIHGPPGTGKSKVIVGLLHRILDKTNRILVCAPSNAAIDNLMKKICGDINLVRLGQQKSINSEVRKFSLDDQVDR--------KINKAMLGKXXXXXXXXXXXXXXXXXXXXXRAMDRSENGKKKQQLEDEICQLSKERQGLASQLK----EARGRSQELKASIILESHIICCTLSTSGGRRLGGDPVSCVIVDEAGQTCEIETLIPLIHGKKLVLVGDPEQLPPTIKSLKAQDYDQSLIDRLCKHLKEPVLQLTVQYRMHPEICLFPSKYIYEGVLTTDRKIAEDRFS---------------LAWPFQPYLLFDV-----LDSREECENDSFYNPQELKLLTELMKVIKKKDMGSRQIGIITPYNAQKRRIQRQLDKEFEIDTVDGFQGREKDCVIVTCVRANSQGSIGFLRSLKRLNVIITRAKYSLFILGKLKTLMENKDWNEMIQDAQRRGNII.. 2339
74 0.000e+00UniRef50_UPI000945AE54 probable helicase senataxin isoform X5 n=2 Tax=Rhinolophus sinicus TaxID=89399 RepID=UPI000945AE54  ali  24 1614.DYGDYLDVFFPLLILNTFETVAQ---EWGSSPNKDK------LHQLRLRKDYKKYWEFVVYLDESELKQLHPKENDLVFLVPEKGSQAYHCGYIHKFRRTSVMRSQDNLPVNLNEFVKCIVISSLVTTQRKLKAMCLLSGRNQLARAILNPNPMDFCTKDERITAYLKDFNEDQKKAIETAYAMAKICLIHGPPGTGKSKTIVGLLYRLLTKQNRVLVCAPSNAAVDELMKKICGDINLVRLGAEKSINNEVLKFSLDHQVDHR--------MKKELPSHVQEMHRRKEYLDHQLDELSRQRALCRGGREIQRQEFDEKIAEVSKERQELASKIK----EVQGRPQKTQNIIILESHVICCTLSTSGGLLLEGIPFSCVVVDEAGQSCEVETLTPLIHCNKLVLVGDPKQLPPTVISQRAQGYDQSMMARFYKLLEDPVIQLSIQYRMHPDICLFPSTYIYNKSLKT---------------NRMTETSRCSSNWLFQPYLVFDVEDG-----SERRDNDSYVNVQEIKLVMEIIKLIKEKKKDTRNIGIITHYKAQKMMIQKELDKEFEVDTVDAFQGRQKDCVIVTCVRANAQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNHLIQDAQRRGAIVR. 2326
75 0.000e+00UniRef50_A0A2E0B3I6 IGHMBP2 family helicase (Fragment) n=1 Tax=Blastopirellula sp. TaxID=2024826 RepID=A0A2E0B3I6_9PLAN  ali  40  5...............................................................................................................................................................................................................................................VVRLGHPARVASGLRELSLDLLVQKHDNQRIVRDMMREAEQLFRQASRYTRSKP------------------------------ARGQXXXXXXXXXXXXXXXXXXXXXAVQHILDQADVICAT-TSLDSDLIGKREFDLVVIDEACQCVEPAAWIPILRAERIVLAGDHCQLPPTIISTEAEGFAVSLLERLVRHYGHAIRRLTVQYRMHEQIMNFSSDQFYDHELTADSTVQKHLLEDLPNV--------TNALITATPITYIDTAGAG-WEEELEPDGESKRNPREADLVRKKVCELLDAGLAERDIAVIAPYAAQVRLLRERCGPELEIDTVDGFQGREKEAVIITLVRSNASGEIGFLADQRRMNVALTRARRKLIVIGDSATLGGHPFYASLLEYFEHSGAY... 376
76 0.000e+00UniRef50_F4R848 Uncharacterized protein n=1 Tax=Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) TaxID=747676 RepID=F4R848_MELLP  ali  30  1................................................................................................................................................................................................................................................................................................................................MHELSQQLDEARDQQAASKRYLDAATRKLRMQILQDADVICSTLSGSGHDYMSQLPFDTVVIDEACQCTEPASLIPLRYATQCILVGDPLQLPPTVLSQAAAGYDQSLFVRMQRFAPTAVHLLSIQYRMHPAISAFPSKAFYDSRLMDGPDMASRTTQRWHTE-----------DTFFPPYTFYHPIGAR----EERGRHHSFINRTEAGMTVAIYSRLTRTFPDAYRVGIITAYAGQVGEIRRQFRQSLDINTVDGFQGQEKDIIILSCVRGGDDNGIGFLKDTRRMNVALTRAKSSLFVIGNQSALVQDKNWKALIDDARERGTF... 330
77 0.000e+00UniRef50_A0A1R3HQL8 Uncharacterized protein n=1 Tax=Corchorus olitorius TaxID=93759 RepID=A0A1R3HQL8_9ROSI  ali  23  51.SIKSYFGSYVLPLLEETRAAMCSSLEIIGRAPYAELEASKYT-YDIHINCWRN-------RLSDGGKEPYRIQPGDILLLADAKPETVSTFALVTNISDFKIKDVNEDKIEDEDKSLYVVFLMNITTNRRIWSALHMYGNLSIIKEVLRPGSQVEESPDENFLTSLLSQLNESQKDAVLACLNKSHLELIWGPPGTGKTKTVSVLLVSLLRMKHRTLACAPTNAAIREVAARFHSLGDILLFGNKERVGSKIEEIFLDYRVERLTDC-LGPLVSKDVEELFTNSRDGDVLS-------------KNINEAPCMLTLCLLRSQCLSVLKTLRDSLSELKRANYNDSNSIVQFCFQAADLLFCTAASSYRYRVAMEPLQVLVIDEAAQLKECESAIPLQLPGHSILIGDECQLPATVQSNVSASFGRSLFERMS-LLGYSKHLLNVQYRMHPSISFFPNATFYDNRILDAPHVKHETYEKHYLPWPM-----------FGPYSFINVPGRDVV----DDVGHSRKNMIEVAVLHRLLRTLYKAGSKEKSIGIISPYAAQVVAIRNKLGSKVKVKSVDGFQGGEEDIIIISTVRSNTAGAIGFVSNPQRTNVALTRARHSLWILGNGSTLANGEVWEDLIHDAKERHCFFN. 750
78 0.000e+00UniRef50_UPI000D77E312 P-loop containing nucleoside triphosphate hydrolase protein n=1 Tax=Jaminaea rosea TaxID=1569628 RepID=UPI000D77E312  ali  31  32.............LFKERQAELEESRLLLSSVSPKVLEANGLALTRLGVLSTSVGIGKRLVELHRPTLPPNAFRSGDVVAIVDEAAAAEGGGGVVVRVMDTKIVVAISQRRSKGQTRCRLIKVANEVTWERMENNLRRLAIKVDVPSAIPLPSPPPAQLDAPPLPLYNPSLNEPQRLALSRALTTKHLHLIHGPPGTGKTTLLVELVLQLVLRGERVLVAGSSNLAVDNLGARLVAFAKCCRIGHPARILSSLQPHTLDHLATTSSNGELLSDVRSELAAAYSSLSPASSSSATTSGAAGNKSTSRRGTSSVNNKRLT------GSERRKVWDEVRELRKELKQRERGLFTDTLHDANVVLSTLHGAAGGKKKSSRFDTIVIDEACQAIEASTWGAVLKGARLILAGDDKQLGPVVKSESPRSLTQTLFTRLLRTYGSIKSLLTVQYRMNEVIMEFPNKEMYGGKLEAHDSCKDRWVGDWTVEKGEGIHVVEGEGLVGGRVVFYDTAGAEMYESSNDDNSSSKSNPHEVEIIRSHLSLLCKHKFPPSSITLLAPYSAQVSALSTAFPPGMEIGTIDALQGREQDVVIISLVRSSEEQRVGFLAEERRLNVAMTRARRQLVVVGDSETIRKGGYLERWMDWLEER...... 761
79 0.000e+00UniRef50_A0A251V0F5 Putative P-loop containing nucleoside triphosphate hydrolases superfamily protein n=2 Tax=Pentapetalae TaxID=1437201 RepID=A0A251  ali  25  473.SVEEYVKVFEPLLFEECRAQLYSTWEESTETASRDLHAM------VRIKSVRRERGWYDVILAPANECRWNFKEGDVAVLSTPRPEESEVSGRVAGTVRRHIPVRVDDDHLHPKGIWFLTVLGSLATTQREYIALHAFHRLNSQMQTAILQPSPELFPKYEEQAPAMPDFNTPQLSAIHWAATHTPFTLVQGPPGTGMLNVIHLVQYQHLCPKPRMLVCAPSNAATDELLTRVLDRGFIDGEMKVYRPDVSVERRTEQLLVKSRDEVYGWXXXXXXXXXXXXXXXXXXXXXLNVAADVLASRDQSRDVLLQNLAAVVENRDKVLVEMSRLFILEGRFRGNLEEARASLEASFANEAEVVFTTVSSSGRKLFSRLTFDMVVIDEAAQASEVGVLPPLALGARCVLVGDPQQLPATVIS-KAAGYSRSLFERFQQA-GCPTMLLSVQYRMHPQIREFPSRYFYQGRLTDSESIANLPDEAYYKDPM------------LKPYIFYDITHGR---ESHRGGSVSYQNIHEAQFCLRLYQHLQKSGIGKVSVGIITPYKLQLKCIQREFEKDLYINTVDAFQGQERDVIIMSCVRASNHG-VGFVADIRRMNVALTRAKRALWVMGNASTLVQSDDWAALIADAKARECYMDM 1270
80 0.000e+00UniRef50_A0A136MZ77 ATPase AAA n=1 Tax=Bacteroidetes bacterium OLB9 TaxID=1617420 RepID=A0A136MZ77_9BACT  ali  33  9.........................................................................................................EIENLDDFDSGHTGIELVYDDRPYKVMESAIKEVIIAKSDLVSDLKQVLFGNKVTTELKQSISSKLNESQVKAVLSSADAYPVSIIHGPPGTGKTTTVVELISLLSKTEKKILVCAASNNATDLLAERLDEKGKVLRIGNITRISDRMMHLTLDEQIRGHQDWAHIKKIKIQAQEADRMAARFRRSFGH----------------------------EEKVERREWKKEARSLRKYASDIEDRITDDIISEARVIVTTLIGVSNKVIESIHYNTCIIDEASQALEPECWNAILRSDRVILAGDHKQLPPTVKSSAAEGLGITMMDLLVDKI-DHVFMLNVQYRMNNSILQFSNERFYGGALISDDFVGTRTLR-----------------NDSKPLIFIDTAGAG-FEETLLPPNNSLANHGEFFVLREHLLRNLESFLGA-SIGIISPYSAQVKYIKEEIAGDIDVNSIDGFQGQEREIIYISLVRSNDDGEIGFLKDERRLNVAMTRAQKKLIVIGDSATIAVHPLYQDLIRHIEQYGHY... 520
81 0.000e+00UniRef50_A0A0F6YHM7 Superfamily I DNA/RNA helicase n=1 Tax=Sandaracinus amylolyticus TaxID=927083 RepID=A0A0F6YHM7_9DELT  ali  33  34...............................LTLAQRVERGLALRDLAVTDTDAPGGRTILWLAPRDGRDLRIGQGDPVLLWQDDPEGPVVRAIVSRRRSDALAVAIDEVPEWLTEGFRLDREAPEVTFDRIERAKHAKKGSDKSVATLLGARAPDFDAKSLELEAFDEALEDDQRVAVQRALAARDLSLVLGPPGTGKTRTLTELVRQAVARGERVLVTAASHTAVDNLAERLVDGENVVRIGHPARVSPAMEERTLDALLEKTDAWKLARRWTREAEDLRRRTLNRTQ-----------------------------RGTLRGEEKRAAWSEVRQLMRDAREYLKDAQRTILSRARVIAATAAGADAWLLEHEAFDRVVLDEATQAPDPIALVALLRAPKATLAGDPHQLPPTVIAREALGLGSTFFERIAATQSDAVTTLRVQHRMHEALMAFPNDATYGAVLITAEDVRTARLEELPGIEPDP--------SREGPFVLVDTAGRG-WEEVREADDPSTRNPGNAERIADEVRRLIARGVAPSDVGVITPYHAQVRLLRDALEPELEIATVDSFQGREKLAIVVDLVRSNDEAQLGFLEDVRRTNVAVTRARRFLLVLGDAATLARHPYYAALVHHAEHTGAWLS. 634
82 0.000e+00UniRef50_A0A0J8QWJ7 DNA-binding protein SMUBP-2 n=1 Tax=Coccidioides immitis RMSCC 3703 TaxID=454286 RepID=A0A0J8QWJ7_COCIT  ali  34  49..........................................................................................................................................................................................................................................................................................................................................................RKIQQEIIDEAHVICATLSGSGHEMFQSIEFETVIIDEAAQSIELSALIPLKYGCKCILVGDPKQLPPTVLSKEASRYEQSLFVRMQANHPQDVHLLDTQYRMHPEISRFPSAAFYDGRLQDGPAMAKLRIRPWHN------------TELLGPYRFFDVQGMHAS----APKGHSLVNMAELRVAMRLYDRLVQDFPTAGKIGIITPYKGQLRELKQHFANKVEFNTTDAFQGRECEVIIFSCVRASNHG-IGFLADIRRMNVGLTRAKSSLWVLGNSQSLARGEFWRGLINDARERQLYTD. 350
83 0.000e+00UniRef50_M3W739 Senataxin n=51 Tax=Eutheria TaxID=9347 RepID=M3W739_FELCA  ali  24 1734....DYFNVFFPLMILNTFETVAQ---EWISSPNKEK------FYQLHVRKDYKKYWEFVVHLEECELKQLHPKENDLVVLEKQNGEKEYHCGYVHKFRRTSVMRNQDNLPLSLNELVKCTVISSLVTTQRKLKAMSLLSGRNQLARAVLNPNPMDFCTKDERIIAYLKDFNEDQKKAIETAYAMAKICLIHGPPGTGKSKTIVGLLYRLLTKQNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLRFSLDSQVNHR--------MKKDLPSHXXXXXXXXXXXXXXXXXXXXXRALCRGGKETQXXXXXXXXXXXXXXXXXXXXXIK----EVQGRPQKTQSIIILESHVICCTLSTSGGLLLEGVPFSCVIVDEAGQSCEVETLTPLIHCNKLILVGDPKQLPPTVISMKAQGYDQSMMARFCKLLEDPVLQLTVQYRMHPDICLFPSNYVYNRSLKT---------------NRLTETNRCSSDWPFQPYLVFDVGDG-----SERRDNDSYINVQEIKLVMEIIKLIKRRDVTFRNIGIITHYKAQKTMIQKDLDKEFEVDTVDAFQGRQKDCVIVTCVRANAQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNHLIQDAQKRGAIV.. 2440
84 0.000e+00UniRef50_A0A199W4N5 Putative ATP-dependent helicase C29A10.10c n=22 Tax=Mesangiospermae TaxID=1437183 RepID=A0A199W4N5_ANACO  ali  24  475.SVEEYVRVFEPLLFEECRAQLYSTYEELLES-----VSRDAHIMVRVRTVERRERGWYDVIVLPVHECKWTFKEGDVAVISSPRPGSVVTSGRVAGTVRRHTPIDTRDPLGAILHFYVGDKVGDDHILKKLQPKSTWYLTVLGPEHFPKYEDQPPAMPDQNFVDHLHRTFNGPQLAAIQWAADPWPFTLVQGPPGTGKTHTVWGMLYQHLCPKPRMLVCAPSNAATDELLARVLDRGFIDGEMKVYRPDVAAQAVSVERRTEQLLLKGR-EDVIGWLHQLKVREQQISQQIAILQRDLLAARDHSRDVLLQSLAAAVETRDKVLVEMSRLLILESKFRPNLEEARANLEATFANEAEIVFTTVSSSGRKLFSRLTFDMVVIDEAAQASEVAVLPPLSLGARCVLVGDPQQLPATVIS-KAAGYSRSLFERFQQA-GCPTMLLSVQYRMHPQIRDFPSRYFYQGRLTDSESVAN------------SPEEAYYRDALLKPYVFYDVVHGR---ESHRGGSVSYQNIHEAQFTLRLYEHLQKNGGKKVSVGIITPYKLQLKCLQREFEKDIYINTVDAFQGQERDVIIMSCVRASNHG-VGFVADIRRMNVALTRARRALWVVGNANALMQSDDWAALIGDAKSRKCFVDM 1249
85 0.000e+00UniRef50_J9DAJ4 Uncharacterized protein n=1 Tax=Edhazardia aedis (strain USNM 41457) TaxID=1003232 RepID=J9DAJ4_EDHAE  ali  32  51....................................................................................................................................................................PPNLPFLNSSQQIAVKAALHNQ-LTLIQGPPGTGKTVTCAAVVYNLVKQFKKVLVVSNSNTAIDHLAVKIHHSALKVRIVSKRRENCELEFLSLHMQAKILLKEEK-------------KRGKTKRSTKNTAELSEDSNTENQYSVKDTFNANKDRKKSKTAHLESNSDD--------DALKYKMMRKILDNADVICCTCVTSGQKILKKYDIPYVLIDEAVQCTEPLSIIPLAYGRKLILVGDHKQLGPIILDKKAAGLKETLFERLIK-LGNLPFLLNMQYRMHPKLAEWPSNTFYEGSLKNGISESKRL---------------NRTVLPF-PTFFYVCYG----LEELSASGTSYLNQTEALVTEEIIKSLVKSGISEKQIGVITPYEGQRVFILNRLTKNLEIKNVDAYQGREKDYIIISLVRSNQKQGIGFLNDERRLNVTLTRAKYGCCIIGNPNTLYKNKMWANFINFYQDRDMIY.. 504
86 0.000e+00UniRef50_D3B846 DNA2/NAM7 helicase family protein n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3B846_POLPP  ali  23  63LDRHDYIDTFEPLLLEECRAQLERSIEEGGEKNDVENEPVFS-----RVRYISENSDFLDVGLVMTKENEMQFHENDLMMISDEDPSNVVDRAYTTEKKKKKVIPPSKIEVTDANRYLHLVEQFEMGGIKREYLALYTTAKTSFMKTLLLADPGVPMKIPPALKEKFESSYNPSQFGALTSALSGSNITLIQGPPGTGKTHVIVGLLSVLLHSTEVPKHVIEEKESLVHRELYEFEKLESWEISQPWLKNKNIRDYTLIDYSFEEKEERRKRDLWRKLRETGTTKNIARKKRILLCAPSNGAVDEIVTRLIRDGLLNHEGKSYRLEYMVRCRQQLMNSNSAIPSDTNSIRTLVLEDAEIIATTLSFSGSSILMKMNFDIVIIDEAAQAVETSTLVPMQKCKKIVLVGDPKQLPATIISPIAQKYDQSLFQRLQEKR--TPHMLTTQYRMHSSIRAFPSKHFYNDLLEDGPNIPSR-------------ATNYHANPFFGPLIFYDLS----FSVETKPGGGSVFNEDECRMALQLYQLLLKTYPDEGRIGIISPYRQQVLSLREYFKSGISIDTVDGFQGREREIIIFSCVRAPAEKGIGFLADVRRMNVALTRPRSSLLIIGNSKSLCINPDWYELIKHAQDNNNLIPI 780
87 0.000e+00UniRef50_I3N632 Senataxin n=35 Tax=Boreoeutheria TaxID=1437010 RepID=I3N632_ICTTR  ali  23 1781....EYFNVFLPLMILNTFETVAQ---EWISSPNKEN------FYQLHLRKDYKKNWEFVVYLEECELKQLHPKENDLVFLVPERDLQEYHCGYVHKFRRTSVVRNQDNLPANLNDLMKCIIISSLVTTQRKLKAMSLLSGRNQLARAILSPNPMDFCTTDERIIAYLRDFNEDQKKAIETAYAMAKICLIHGPPGTGKSKTIVGLLYRLLTKQNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLKFSLDSQVNHR--------MKKDLPSHVQEMHRRKEYLDHQLDELSRQRALCRGGREIQXXXXXXXXXXXXXXXXXXXXXIK----EVQGRPQKTQSIIILESHIICCTLSTSGGLLLEGVPFSCVIVDEAGQSCEVETLTPLIHCNKLILVGDPKQLPPTVISMKAQGYDQSMMARFYKLLEEPILQLTIQYRMHPDICLFPSNYVYNRSLKT---------------NRLTETNRCSSDWPFQPYLVFDVGDG-----SERRDNDSYVNVQEIKLVMEIIKLIKRRDVTFRNIGIITHYKAQKTMIQKDLDKEFEVDTVDAFQGRQKDCVIVTCVRANTQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNHLIQDAQKRGAII.. 2487
88 0.000e+00UniRef50_F4PP71 Putative splicing endonuclease n=1 Tax=Cavenderia fasciculata (strain SH3) TaxID=1054147 RepID=F4PP71_CAVFA  ali  26 1179.NLSEYIEIFEPLLLQEYKGQLIKSMEEMDN-----------VCYKLTVEDVARENDFHVCYFFDHNQSSDEFFIDDLVIISKPQKKEKKERKEMNNIKCSWIKVRFFFENLKIGSQWKMTKLTSLSTVNREYMALHTVGKIPLLSSYSLENASSRVTIPKKLESALKESLNDSQIEAIHASLTPSGFTLLQGPPGTGKTKTIIALLSVLLHTMTPILVTAPSNAAVDEIATRLPYQPFCIRIGNKQQINSTVSKISLDNLLSEELQKDDNKSLHEESEKTRSEXXXXXXXXXXXXXXXXXXXXKQPTDHITSELTKLHNKKSMLKSSKNNFVDLRRGYDNLENEKRSMLSNMLNRASIILSTLSGSGYESLSAKQFDVVIIDEAAQAVELSTLIPLKHVKKCILVGDPNQLPATVISRITTNYEQSLFQRLSQ-CGIPMQVLNVQYRMHPTISRFPSKHFYHGQIKDGHNV-------------IALNHNIYKDARFGPFIFYDITD---SVEDSNQSSHSLRNVHEAKLANLIISQLLSKDCEKLSIGVITPYKQQQIELSRRLNSMVEVNTVDGFQGREKDIIIFSCVRAHKGGSIGFLSDVRRMNVGLTRAKLSMIVIGHTNLLMLNSDWGELIKFSKQ....... 1874
89 0.000e+00UniRef50_A0A093PLD7 Putative helicase senataxin (Fragment) n=8 Tax=Neognathae TaxID=8825 RepID=A0A093PLD7_9PASS  ali  24 1761.DYNDYFNTFFPLMMLNAFETLAQEWVENQKA------REKSYCFTLENFSADMNTAHFTAHFREGDLRQLHPKEDDLILLSGMENHVMNHVGLVTRFSRCHLTVQTRGNLSFCHKQVKCVVVGSLVTTHRTFKGL--LLLSRSPLARPIINPCYNDFCPRDLPVASGSAVN--QKRAIETAYAMPKICLIHGPPGTGKSKTIVGLLSRVLMKPNRFLVCAPSNAAVDELMKKICGDIKLVRLGAEKAINNEVRAFSLDKQVEHR--------MKRKPGDSDQDVQKRKAALDQKLDMLSRQRAMHRCEKRESQMXXXXXXXXXXXXXXXX-----XXXXXVRGHSQKVQTDIILESDIICCTLSTSGGSLLEHDPFSCVIVDEAGQSCEVETLIPLIHCNKLVLVGDPKQLPPTVKSVKAQGYDQSLMARLQRLLEEPVVQLTVQYRMHPDICLFPSNYVYGKTLKTAKAIEENRCS---------------SDWPFQPYLIFDVADG-----REERDCDSYSNPREVKLVMELIRTIKEKDLGLRRIGIITPYSAQKKRIQGQLDSVFEVDTVDAFQGREKDCIIVSCVRANNSE--GFLASLQRLNVTITRARFSLFILGRLQTLMEDKNWNHLIQDAQKRGAIIR. 2459
90 0.000e+00UniRef50_A0A1L8F6C4 Uncharacterized protein n=3 Tax=Xenopus laevis TaxID=8355 RepID=A0A1L8F6C4_XENLA  ali  24 1657.SYEEYFNVYFPLMLLNTFESLAQDWSVKQQA-----INTHMCKLHLQTFCPDANRGEFLAWFRDTDLVQRHPKEDDLVFLCLPESGEEYHTGYVSRFNRSQKTVNQEKESAFRNQQVRCFVIGSLITTQRQFRALLQLQRNPLFRPIIMPNPPRDNVASETSSFPSLKEYNSDQKYAIERAYRLPRICLIHGPPGTGKSKTIVGLLYRILMKRNRVLVCAPSNAALDDLMKKICGDINLVRLGAEKTISNDVVKFSLDCQVNH----------RITRAQQDQGLHKQKEMLDKKLDELSRRRALEKCNKNTCAPLD-----EEXXXXXXXXXXXXXXXXXXXXXPQELQRTIILESHIICCTLSTSGGRQLGQEPFSCVIVDEASQSCEVETLIPLLHCSKLVLVGDPEQLPPTVISMKAEGYGQSLMSRMCRFLKSPVLQLTMQYRMHPDICLFPSHYFYKRMLKTDRATEEVRCS---------------SDWPFQPYMVFDVADGYERKERE-----SFCNPQEIKVAVALIKLIKSRKKDFRNIGVITPYRAQKEELKRAFANDIEVDTVDGFQGRQKDCIIVTCVRANSQGSIGFLASRQRLNVTITRAKFSLFILGSLRTLMENKDWNHLIQDAQRRGALI.. 2359
91 0.000e+00UniRef50_UPI000A289210 LOW QUALITY PROTEIN: probable helicase senataxin n=1 Tax=Phascolarctos cinereus TaxID=38626 RepID=UPI000A289210  ali  25 1802.DSQDYLNVFFPLLMLNTFETVAQEW-------IDNPKKENAYKLHLRSFSPGDINGQFVVCLQECDMKQLHPKENDLVFLSEMRDQRVYHCGYVSQFRRSSVRHNFEGCLSIQNESVDCIVISSLVTTQRKLKALSLLGRNSLIPLARAFCPRDSLNEAPERILAYLKEYNEDQKKAIEVAYAMAKICLIHGPPGTGKSKTIVGLLYRILTKRNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLKFSLDSQVNHR--------MKKDFPSHVQEMHERKEHLDVKLDKLSRQRALDRCEKGQKRSNLDEEIARISKERQQLASKIK----EVRGRPQEAQSSIILESHIICCTLSTSGGLLLEGVPFSCVIVDEAGQSCEIETLTPIHRCNKLVLVGDPKQLPPTVISLKAQGYDQSMMARLYKHLEEPVLQLTVQYRMHPDICLFPSSYIYNRTLKT---------------NRLTEESRCTSDWPFQPYLVFDVGDG-----SERRENDSYVNVQEIKLVMELIKLIKRKDITIRNIGIITHYKAQKMMIQQELDKEFEVDTVDAFQGRQKDCVIVTCVRANSQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENEHWNHLIQDAQKRGAIIR. 2514
92 0.000e+00UniRef50_D8R5Y4 Uncharacterized protein n=2 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8R5Y4_SELML  ali  23  164.SYKHYLEIFRPLCFEEFKAHLERSLETMDLSRSDV----------VTAFSLRQEGYFHLVEFDGHTVEK---RNNLLVKVYLPHS--------CERLSKLREMLVTE-------STWHLNKLTSVTTFIREQQAMAAMHLFPLLETILSASPPREISRTQSLPPQLRSKLNESQLSSI-AAVADQMISLIQGPPGTGKTRTILGIVSALLAHANEEAGKAEEHEMLDVLTDNHQYWPSIVRVGDTKRVHSQAMAVHIDRLVAKRMAENAGVHNAHSPQELRSKLDEVLGNMQALAAPAEVESQDGIPKLDKLAGLQEQQRLLLSELIKVENREHGFLMGSNRKKKQAMKLEVLREADVVLTTLSGCGGHIYSEMLFDAVIIDEAAQAVEPSTLIPLQLLKKCILIRDPKQLPATVLSVPASRLDCSMFESF------PVSMLTTQYRMHPEIRSFPSTHYYDGQLKDGSTV-------LHGNRSAPFHRESHTG-------FFDIRDGQ----ERPGSMQSLTNPDEAEFIFQLLRVLKERYVRPGRIGVITPYQEQRKVLQRSLHSGIDVNTVDSFQGREADIIVLSTVRASSQAGVGFLADVRRMNVALTRAKFSLWVVGNARTLERNPDWKAL............. 802
93 0.000e+00UniRef50_A0A2H3Z5T8 DNA-binding protein SMUBP-2 n=7 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2H3Z5T8_PHODC  ali  36  18.........................................................................................................................................................................................................................................LSSRVKLVRLGHPARLLPQVLESALDAQVLRGDNCTLANDIRKEMKVLNGKL----------------------------------LKAKDKNTKRDIRKELRTLAREERKRQQLAVTDVIKNADVVLTTLTGAFTRKLESSAFDLVIIDEAAQALEVACWIALLKGSRCVLAGDHLQLPPTIQSVEAKGFGKTLFERLASLYGEEVMMLTVQYRMHELIMNWSSKELYGSKIEAHSSVSQHMLYDLETVKKSS--------STESTLILIDTTGCDM--EEKKDEEDSTMNEGEAAVTIAHAKRLVESGVNASDIGIITPYAAQVTYLKMMRSKDVEISTVDGFQGREKEAIIISMVRSNSKKEVGFLSDHRRMNVAVTRSRRQCCLVCDAETVSNDRFLKRLVEYFGEHGEYLS. 397
94 0.000e+00UniRef50_A0A066VDS0 p-loop containing nucleoside triphosphate hydrolase protein n=1 Tax=Tilletiaria anomala UBC 951 TaxID=1037660 RepID=A0A066VDS0_9B  ali  30  81....EYRNRTTELLEAE-KASREQTLSLRKTWSFSKLVERGLAISDLQAYWLSSNYGKRVAVFRKQSFGWNKLRPGDCVVLTPQEAEEPVIEGTLIDKGRTRVRVAFDEKYAQVDVEWRMDQGSNDLFERRIERALEAIEHDVDFIESLAFHDSIPPPPTRRATGAFSQNLNTSQVKAIAAMLGNR-ISLIQGPPGTGKTRTIVHLLKSHFKVHQPILLTAHTNVAVDNLAEGVNRGLKVVRTGASARTRPKLREHSLEALAGQHPLMPELIDVRRHIARLQLRLGFSLDSEEGGDADSLGRTIGVPIEASGFTMAAQPERLTS-AQAADLRGKLARGYRHAYVLWRRITRSILLQADVICATAVSSCSNDLEQIDFPVVFFDEGSMATEPTSLIPLIKGCQLAIIGDHKQLPPVVASLDAKGLGISLFERLINEKAAPSVMLNEQYRMHPAIAEFPNETFYEGALLNA--LRTHGIAPLHSQSRTSTSAAGATTAALGPLSFVNHTG------TERKVDDSVQNRAEAKLTMQVVVDLLLRNPQGHQIGIVTPYLAQVLLLESLLRGEVDVHTVDGFEGREKAAIIFSTVRSNSDGYVGFLADARRLNVALTRAQRALFVLGDLRTLDSAKVLRAYAKYVRDKDVVVE. 824
95 0.000e+00UniRef50_C4R568 ATP-dependent RNA helicase of the SFI superfamily, required for nonsense mediated mRNA decay and for n=1 Tax=Komagataella phaffii (st  ali  26  233..............................................ISVSWSMSPHNYHLAKFSLSSYDSSNLKVGDEIILHYDKEEKWQGSGYVIKLPATELQPSSVKPPTEHNVGFRAEIVWKGISFQRMQAALTTFDLYDILLGHKEEQPEFTAKLPEAISVPNFTQLNPSQVNAVKSVLQ------------------------QRLSLIQGPPGTGKTVTSATIVYHLAKSKKKKVLVTASSNIAVD------------HLASKLEDIGLKVVRVTARSRENVESAIDHLSLSSLVSNTNNPVLKKLLKKK------------DELGSLSKKDMNIYISQTKKAEAEILAEAHVVCCTCSGAGDKRLANIKFPYVLIDESTQPSEPESLIPIVKGKQVILVGDHQQLGPVILHNGAAGLRQSLFERLIK-LGHIPIRLEVQYRMHPSLSEFPSNMFYDGSLQNGVSHEQRLIRRSSFPWPA----------PGIPLLFWSSYG----TEEISISGTSFLNRSEAMNCEKIISRLLSEGIKPHQIGVITPYQGQRDYIVQYLYQDVEVASVDAFQGREKDFIIFSCTRSNHTNTIGFLKDARRLNVAITRAKYGLFVLGNIKTLQKDPLWNRLLVHFRDKGALVE. 805
96 0.000e+00UniRef50_A0A1S3FLJ8 probable helicase senataxin n=4 Tax=Glires TaxID=314147 RepID=A0A1S3FLJ8_DIPOR  ali  23 1684....EYFDVFLPLMILNTFETMAQEWINSPNKDNCYQVQLKKFAADYKKSW------EFVVYLDESELKQLHPKENDLVFLRSVADHHMYYCGYVHKFRRTALMRSQDHLPASLNELMKCVVISSLVTTQRKLKAMSLLSGRNQLARAILNPNPMDFCTKDERIINYLKDFNEDQKKAIETAYAMAKICLIHGPPGTGKSKTIVGLLYRLLNKQNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLRFSLDSQVNHR--------MKKDLPSHXXXXXXXXXXXXXXXXXXXXXRALCRGGREMQRKELDEKITRVSKERQELASKIK----EVQGRPQKTQNNIILESHVICCTLSTSGGLLLEGQAFSCVIVDEAGQSCEVETLTPLIHCNKLILVGDPKQLPPTVISMKAQGYDQSMMARFYKLLEEPVVQLTVQYRMHPDICLFPSNYIYNKSLKTNRTEANRCSSDW----------------PFQPYLVFDVADG-----SERRDNDSYVNIQEIKLVMEIMKLIKDKRRDTRNIGIITHYKAQKTMIQKDLDKEFEVDTVDAFQGRQKDCIIVTCVRASTQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENEHWNQLIQDAQKRGAIV.. 2390
97 0.000e+00UniRef50_G7E2M2 Uncharacterized protein n=1 Tax=Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) TaxID=764103 RepID=G7E2M2_MIXOS :  ali  37  238...............................................................................................................................................SLSQILLGMQEISEPQQKSDVTILDDALNQSQQDAVKFALHAREVALIHGPPGTGKTSTLIEIIRQLVRLGQRVLVCGASNLAVDNIVERLQHSVPLTRLGHPARILEATQRSTLDYQTAHSANGALAQDVRDDIAKIFADLAKG--------------------------------KLQGKGRRAKL-DEIKLLRKELRVREAGVTSSVIGQARVVLCTCHGAGSKQIMRDTFDVAIIDEAAQALEGSCWIPILKAQKLVLAGDPLQLPPTIKTSDARNLETTLFDRLLAMYGAKKCLLSIQYRMNERIMRFASDALYEGKLVAALQVKDRLLCDL--------VETKGDDVLDHPVIFIDTTGNDMYEEETGVRTLSKYNENEAVQVVKHISEIVSAGLPPKCIAVISPYNAQVSLLRSLLLPDISVGSIDSWQGREAECIIISLVRSNDQREVGFLKESRRLNVAMTRAKRQLCVVGDAGTVRTSSYLERWMTWLED....... 725
98 0.000e+00UniRef50_UPI0007120DC1 hypothetical protein n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI0007120DC1  ali  28  219.SAKTYQSIFDPLISYE--------------ESSDKMDNDSKCLEDVAIRWENGINDSKIAVFHNDTDNRYRMNVGQMIKLHLPTKEELVYQGKVILIEDSEVHVEMSNLPLGQTSGFRVTFLWNGTSFQRMREAIMSEYLYHRLMGNPVTPHQFPFLPLSSFSVPGMPELNSSQIAAVQASLQN-ELTLIQGPPGTGKTCVDVSIVYHLVRRYQRVLVCAPSNIATDNLTLMIHKGLNVVRVVARSRVSSSVEKYCL------HNMAPYVGGTQGELFQLNKRAQEVGQLSP-------------------------------------------REASLYATLMNKAELAILKAAEVICCTCVMAGDPRIRRFPCPNVLIDEATQAREPECLIPIVNGKRLILVGDHEQLGPVILDQKAKGFGMSLFERLL-ALDILPYCLNVQYRMHPSLSEFCSNTFYNGELQNGIPIANRT-RNIDFPWPRS----------DKPMMFWAIMGSEDP----GSSGRSLQNRLEANAVEAVVARLLACGIEGSRIGVITPYDSQRTLLRQFIRKLVEIASVDEFQGREKDYIVFSCVRSNASGVIGFLKDYRRMNVALTRAKYGIVIVVSGATL---DNLSHYMVHIKS....... 816
99 0.000e+00UniRef50_A0A1E3NJR4 Uncharacterized protein n=1 Tax=Pichia membranifaciens NRRL Y-2026 TaxID=763406 RepID=A0A1E3NJR4_9ASCO  ali  30  10.......DRFLSALAVEKREDYETTHQLLSTTPPKVLARNGLAILNLVIENIRKSIGKLILELALDGAISGP--TGDIVRITNPSGNQASIEGVITSSSNAKICVALTWELQSSGKRVWIVKVSNESTYRRMESTLRKLSEFSLESISSTQEYAPPISNIDKVVTFKNKNLNDSQQNAIKFGLVS-PLTIVHGPPGTGKTSTLVEYIIQHLEPDKRILITAPSNIAADTIIERLSNYFQLVRIGHPARILASTRKHSLDFLASQ-VGGEELDDLTNDLSKLEKEVRKP-------------------------------RTSKHYVDRKELWREIKDLNKEFRFRSKKCVRDVLIGAKVVVATLHGSGSKGFGKGFFHTVIIDEVSQALEPACWIPIINPDKLVLAGDNKQLPPTITNKRADTLSQSLFDRVVRTYGGIIKFLDIQYRMCEKCMEFPSNEWYKGKLRAADSVKDCRVIDLIKKHRLDDLVEQ--------VIWFDTQGGSCPESVEESSGGSKYNIGECYAVQRHIAALISLGVKEEEIGVIAPYSAQVARLRSLISPGIEISTVDGFQGREKEIIILSLVRSNESADVGFLSDFRRLNVSITRCKKQLAIVGDMETLEQSKMLKDWTEWCSEK...... 728
100 0.000e+00UniRef50_A0A1Q9E2Y4 DNA-binding protein SMUBP-2 n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9E2Y4_SYMMI  ali  31  909..............................SCSQAELQSRGLAILKLRVTEQSTLYGRACLTLERGDLNSHKISHGDIVGIFDQGSRPPLASAVATRIRPETIQLAFDGDIPLDGRLLNLALVSSDVTLKRYKEALDMLKGGRARSSPVCFGDAKPRFYEAKSEDNYARNLNEPQQTAVIKALRAADVAVIHGPPGTGKTTTLVSYILEAVYRKQRLLVTAPSNVAVDNLLERLADCRSLVRLGHPARVQENIQQFTMDNVVYASDQAELCRDIKKEIDQILGKVRSCGNLSQSFTGSLTENWESQVPNLLASSELRTELRQRERRAVAEVPLNSQRFN--------IVEPFILDETDV-----KQEADAMPQDDWFDVVVIDEAAQALEVACWIPLLLGKKAVLAGDHQQLAACVKSTEAQGLDETLFGRLIDRFGDDVSLLSIQYRSNEKIMGWSSQSFYSSRLEAAPSVASQTLSL--QEVPSMNISAEILEMVTSPMLFVDTAGLSMYRESRSDIQQSRCNPGESRFVVHYAKMLVRAGLRPETFTVITPYNRQVEQLRADFAADVEINTVDSFQGQEADAVLISLVRSNTHGVVGFLSDYRRLNVAVTRARKHVLLVGDASTICNDDVLSSLYGYACDHGRV... 1566
101 0.000e+00UniRef50_G3X2T1 Senataxin n=2 Tax=Sarcophilus harrisii TaxID=9305 RepID=G3X2T1_SARHA  ali  25 1811.DSEDYLSVFFPLMILNTFETIAQEW-------IDNPKKENAYELHLRSFSPGDINGQFIVCLQESEMKQLHPKENDLVFLVEMKTQQVYHCGYVSQFRRSSVRHNFEGYLSIQNESVDCIVISSLVTTQRKLKALSLLGRNSLIPLTRVFCPRDSLNTAPEKILAYLKDYNEDQKKAIEVAYAMAKICLIHGPPGTGKSRTIVGLLYRILTKRNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLKFSLDSQVNHR--------MKKDFPNHIQEMHERKEYLDVKLDKLSRQRALDRCEKGQKRSNLDEEIARISKERQQLASKIK----EVRGRPQEAQSSIILESHVICCTLSTSGGLLLESIPFSCVIVDEAGQSCEIETLTPIHRCNKLILVGDPKQLPPTVISVKAQGYDQSMMARLYKHLEEPVLQLTVQYRMHPDICLFPSSYIYNRTLKT---------------NRLTEESRCTSDWPFQPYLVFDVGDG-----SERREHDSYVNIQEIKLVMEIIKLIKDRDITIRNIGIITHYKAQKMMIQQELDKEFEVDTVDAFQGRQKDCIIVTCVRANSQGSIGFLASLQRMNVTITRAKYSLFILGHLRTLMENQHWNHLIQDAQKRGAIVR. 2523
102 0.000e+00UniRef50_A0A2M8HH85 Uncharacterized protein n=1 Tax=Leptospira sp. TaxID=178 RepID=A0A2M8HH85_9LEPT  ali  31  18........HLLDLFKQEADYEKLNFISKVEGQNIQERIKSGITIYPLEIKDFVRESWKIILTIKSTTNTNNLFSEGSPISIFRAEDRK---QASLSKISETELTIIVDGDIPDEEGTVGIDLFYSEKTYREGERALNKLLEEDDKELFLGYKQIEPYFEKLPSSIMIASNFNPSQRTAIEKMITTEDCLVIQGPPGTGKTSVLAEGIKHLVGLGKKVLLSTPTNSALDLLLMKSIEKEQPVRLGQITKVSEDLLPFTLDSKIDXXXXXXXXXXXXXXXXXXXXXATKFHRNFN----------------------------SKLASERKELWRELNGIRETIKNSERHIEKEIIRLHNPILATNVSASNSILYKEKFDVCIIDEAIQSLEPLAWIPILKSEKIILAGDENQLPPTILS-ENKELMNTLFSKMVANFKDSIVFLNTQYRMEEEILNFSNKEFYENKIQSDQSVKERSKIFQPM--------------FESSIVFIDTAGTGYEESKSNESES-IQNEGEANFLVNLLQIMREQELGKHDIGIIAPYREQIKKIKDLVNDQIEINTVDSFQGREKDIILLSMTRSNEDGEIGFLKDYRRMNVSLTRARNLLVVIGDSTTLQNDAFYSRFITYCQENGDY... 633
103 0.000e+00UniRef50_A0A1Z9DGW8 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TMED114 TaxID=1986720 RepID=A0A1Z9DGW8_9FLAO  ali  30  17.............LVLEHRAEEARYGAILDGQPVSVRKAEGLTWSPVVIRTRFTLGGRPTVEVQADGGEPGAFRAGSAVQLTSDDTKKVSHRGIVRSARGLEAEVVLDDLPDQVMHRWVLDARFDERSFKEMARALSDVLNAGHDGKPSRLAALRERPEPVEPEPFEHPTLNASQNLAVGHALTAPEVTTLHGPPGTGKTTTLVQLVRALVRRGETVMCATPSNAAADLLVERLGGGLQVVRIGHPMRVDPSVANRALDRLVAADPDFKQXXXXXXXXXXXXXXXXXXXXXFGPDQRTARRAAFAEAR----------------------------QLRKEADRLEGFLAERALESAEVVCCTLVGAADRMLQGRRFGTVVLDEAGQALEPGAWIPIRLADRVVLAGDACQLPPTVKNPAAAGLGVSLLEKAIAR-DRNVHLLDTQYRMHADIMAHPNRVFYGGALMADAAVADRALEGL------------------APLTYVDTAGRGWDEERTGRSHASIRNPEEAQFTVDRLRELMKAHP-ESSVGVIAPYRAQVTLLEELLAADVSIQTVDGFQGQERDIMVIGLTRSNADGEVGFLSEHRRMNVAMTRARMHLLVIGDSATLGADGFYADFIQSCEQSGAY... 631
104 0.000e+00UniRef50_H3BFG1 Senataxin n=1 Tax=Latimeria chalumnae TaxID=7897 RepID=H3BFG1_LATCH  ali  23 1358.SYDDYFAAFYPLMILNSFEVLAQDWLENQKENYKALILK-------SSKASMTKFFKSIASIRNSDLKQHHPKEDDLVFLWLPDGQLIPYLGHVSRFNRTSVTIRTQGNVSLLQQHVKCEVIGSLVTTLRQFKALQLLYRSQL--ARPILSPRPSFFSTEALVHFINNEFNKDQERAINTAFRQPKICLIQGPPGTGKSKTIVGLLERILNKRNRVLLCAPSNAAIDDLMKKICGDINLVRLGAERVISADVQKFSLDYQVKHKINKA----------QVGSEQDIWRXXXXXXXXXXXXXXXXXXXXXPEQHRTLMEKK----NELMKLXXXXXXXXXXXXXXXXXXXXXIILESHIICCTLSTSGSRRLGHDPFICVIVDEAGQACEPEILIPLIYCPKLVLVGDPMQLPPIIKSMKAQKYGQSMMWRLFKNLHVPVLKLTIQYRMHPDICLFPSRYIYNKALTTDIHTEEKRVS---------------SAWLFQPYLLFDVTDG-----SESRSSGSYFNQQEVKLVMALIKMMAKRDGMCRDIGVITPYSAQKRKLVQQLERSVEVDTVDGFQGREKDCIIVSCVRANMQGSIGFLANRQRLNVTITRARFSLFILGHLKTLMDNKDWNELIQDAQRRGAII.. 2066
105 0.000e+00UniRef50_UPI0009BCF9BA probable helicase MAGATAMA 3 isoform X3 n=1 Tax=Amborella trichopoda TaxID=13333 RepID=UPI0009BCF9BA  ali  21  78.DVEEYIGIFEPLLFEEVKADIVKGLDE----------DEVMEWQMGAVASCEEANEFHAVTLLVKEEVRDKFSENDLLLLSKEKFREAYGFAMVEGRPRDTLKLRTYHGLKAQDSVLWVLKISSLSTITREYSALHSIGSLPFADLILSASEKSKTGDPEHQMDSLVDNHNQSQLEAIQAGLSRRTFVLIQGPPGTGKTQTILGLLSATLHSAPRVQSKGVFSPLQHRAQLTFEDKSTHWMKASPWLSGSNPRDLIMPVDGDDGFFPTTGNELKPEVVASNRKYRVHVLVCAPSNSALDEIVLRLLNTLRDENDNVYNPKIVRIGLKPHHSIQAVSMDYLVEQKMATMDRSSIASQR--------GGSATLERDRIRASILDEAA-IVEPATLVPLAHGCKQVLVGDPIQLPATVISTTAKGYDMSLFERFQKA-GYPVHMLKTQYRMHPEIRNFPSKEFYSQELDDGPDMEERTTRKWHDYFC------------FGPFSFFHIDGV----ESQPLGSGSRINVDEVEFILLLYHELVSRYKSSSQMAVISPYRHQVKLLRERFRETVDINTIDGFQGREKDVVIFSCVRSNVEKGIGFVADYRRMNVGITRARSSILVVGSASALIQDEHWRNLIISAKDRERL... 741
106 0.000e+00UniRef50_UPI000D186D5F probable helicase senataxin n=1 Tax=Desmodus rotundus TaxID=9430 RepID=UPI000D186D5F  ali  24 1894....DYFNVFLPLMVVNTFETVAQ---EWINSPNKER------FYELHLRKFYKKCWEFVVSLEDCELKQLHPKENDLVFLVPEQGPREHHCAYVHKFRRTSVIQTQDDLPVNLNEFVKCVVVSSLVTTQRKLKAMALLNGRNQLARAILNPNPMDFCTKDERITAYLRDFNEEQKKAIETAYAMAKICLIHGPPGTGKSKTIVGLLYRLLTKQNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLKFSLDNQVSHR--------MKKDLPSYVQEMHRRKEYLDHQLDELSRQRALCRGGREMQRRELDERIAHVSKERQELASKIK----EVQGRPQKTQSIIILESHIICCTLSTSGGLLLEGVPFSCVIVDEAGQACEVETLTPLIHCNKLILVGDPKQLPPTVISLKAQGYDQSMMARFCKLLEEPVLQLNVQYRMHPDICLFPSNYVYSRNLKTNRVTETIRCS---------------SEWPFQPYLVFDVGDGL-----ERRDNDSYVNVQEIKVVIELIKLLKRKDVTFRNVGIITHYKAQKMMIQKELDKEFEVDTVDAFQGRQKDCIIVTCVRANAQGSIGFLASLQRLTVAITRAKYSLFILGHLRTLMDNQHWNHLIQDAQRRGAII.. 2598
107 0.000e+00UniRef50_UPI0006449F6D hypothetical protein n=1 Tax=Acytostelium subglobosum LB1 TaxID=1410327 RepID=UPI0006449F6D  ali  24 1065....DYIQIFEPLLLEEFKSQLLKSIEEVDAVTTVKLED-------------VSCQGDFQIAVFQMDSEEDDFFENDLIQLSQDASSDKYAFGKIESKTRKDLTIKFCEKHMKKGSMWNIKKLSSLHTISREYIALHMIQHVPLGKFIISPGPSIATFIPLVLKERLSNDLNSSQLKAIEQSISNPGITLLQGPPGTGKTKTIMALLSAFLSLDFKILVCAPSNAAIDEIAMRILGSNVYIRIGHPSQINPKVESISLDFMLNKEILKSGNDKKQVDVDKPNGSSSSNGESSKSEAKL------------------------------------------PMAELQEKHRKGLLRQCNIVLSTLSGSGTEWLGRKEFDLVIIDEAAQAVELSTLIPLRFVNKCIMVGDPNQLPPTVISRLASQYESSLFQRLVK-CGVQQHVLSVQYRMHPAISRFPSKHFYMDALEDGRNVQS-------------YKEDYYRDPRFGPFVFYDITDSL----EESGPGFSLKNRLEAKLVSVFISNLYEQFPSAKSIGVITPYKQQTREIQSRVSPNVQVNTVDAFQGCENDIIIFSCVRAHAGKTIGFLSDIRRMNVGLTRARHSLIIMGHSSLLKCNSTWGALIDHAKNKNGYYSI 1694
108 0.000e+00UniRef50_A0A059F667 Uncharacterized protein n=1 Tax=Anncaliia algerae PRA339 TaxID=1288291 RepID=A0A059F667_9MICR  ali  31  132.DTKEYQETFSVLLEEEACEE-RKLKESFKEDNLECFVDGG------------------FVKFYEKPDSEIKINKGDEVIFEKEDYVFNGYVVVVVKLKRDSQTICNSLFNRKKLTDVTLKFVWKEVNYSRMNYALENIKKYCSKNLLKTILHGVKENHREMEVNF---DLNSSQKLAVQAAL-SRTLTLIQGPPGTGKTRTSACIVKSLVEQGHKVMVVAPSNIAVDQLSLEISKLNV-----KILRVLSRNREGT---------------------ESLVDEICLHSKIKNFLKNESQNGGEVKNVNYDDLD----------------------------DDTFYNIGKGIIQSADVIACTCITAGSPIFKGMRFSAVLIDEAVQATEPMSLIPLLYCNKLILVGDHKQLGPLTISKKAKKLDQSLFERLVKV-GIVPYLLTTQYRMHPLLIEFPNKTFYNNLIDSGVTISSR-------------------ISFMNPSFFY----CSFTKEELSSSGTSFLNKGEAIAAKDMIKYLNKNGVQNRQIGIITFYEGQRCFLSEFI-KEVEITNVDGFQGREKDFIILSLVRSNESQGIGFISDKRRVNVALTRAKYGLIIIGNPLTIRKNALWNDMLNIYDKKNILYE. 686
109 0.000e+00UniRef50_A0A2G9H7N2 tRNA-splicing endonuclease positive effector (SEN1) n=3 Tax=Pentapetalae TaxID=1437201 RepID=A0A2G9H7N2_9LAMI  ali  26  6...............................................................................................................SEVQKYFYVLKICSLSTIVREYVAMRSISSLPFKDLILKAADVDITNESRPLAEFIEGNHNKSQLEAIHAGLSRKSFVLIQGPPGTGKTQTILGLLSAILHATPVHSNKGTLVGVKRGPELPIQEKYNHWEKASPWLTCSNPRDRIMPLNGDDGFFPTSGNEMKPEVVNSSRKYRVREIVLRILNTGIRDENDHAYNPKIVRIGLKPHHSVQAVSMDYLVEQKLAGMDSQAGDKQKQIRASILDEAVIVFSTLSFSGSALFSKLNFDVVIIDEAAQAVEPATLVPLANGCKQVLVGDPVQLPATVISPVAEGYGMSLFKRFQMA-GYPVQMLKTQYRMNPEIRSFPSREFYNEALEDGPDVEEQTKRSWHKFRC------------FGPFCFFDI---HEGKESQPSGSGSWVNVDEVEFVLAMYSKLVSRYPESSRLAIISPYRHQVKLFREKFRKVVDINTVDGFQGREKDVAIFSCVRASKDNGIGFVADFRRMNVGITRARSSVLVVGSASTLKRDDHWKNLVESAEQRNVLI.. 571
110 0.000e+00UniRef50_A0A0J9ULH2 Uncharacterized protein n=1 Tax=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) TaxID=4  ali  25 1164.........................................................................................................SFVTAKDELTSQPFGMKIASRASVDSYLEATFTMPVVQSRERGVSEGDILLVSESEQPLIDQTARHCLARATAVLGAHDNDGFTLIQG------------------------------NAAVDELVLRLKKNINVLRLGRSDAINAAVRDVTLDELVKARMEGDQTKDAKADRDQLHENAGKVKEELGKLRPQLEAAKLMDDNKLSREFDELKRRQMSYGKQIDADKSSGNSVAREMEMRRRQVQQEILNNAQVLCATLSGSGHEMLEDVEFETVIIDEAAQCVELSALIPLKYGCKCILVGDPKQLPPTVLSQSAAGYDQSLFVRMQQNHPRSVHLLDMQYRMHPEISLFPSREFYEGQLADGQNMHELRQQPWHKSA------------LLGPYRFFDVQGVQERGHK----GQSLVNTKELDVAIQMYDRFSNEYRETGKIGIITPYKAQLYELRNRFRSRIEFNTTDAFQGRECEIIIFSCVRASSTGGIGFMTDIRRMNVGLTRAKSSLWILGDSRALVQGEFWRKLIEDAQARDRYTN. 1693
111 0.000e+00UniRef50_A0A1E5RX54 Helicase SEN1 n=1 Tax=Hanseniaspora opuntiae TaxID=211096 RepID=A0A1E5RX54_9ASCO  ali  26  1.........MHPLLLLETWQQVXTAKKKSKGRIHAVNI-------DVKDIGSXGEFGVFHTTVSDYSWESSGINNSDLCAIGMDRSGYIGXLAKVFXVKATKIKLSFESRILVPWSTVTLVGLTSLATSEREYTTLCGLKDYNLLNHLMVPKISNISKTGEVSKIRQQYGANQSQAEAIACVTTSSGISLIQGPPGTGKSKTIVSMMKYFLTSKKQILLCAPSNAAIDELVLRLSEETNLIRLGRKEAVSSKVHHVTLEVIIDKKLSYSQLTDESKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKAKSQVQKIMEKYEQEKERLTALLIKQADIVCTTLSGSAQXQLENLGFPTVVIDEACQCTELSXLVPLRYGKQIIMVGDPNQLPPTVISKVASNYDESLFSRLAKE--NSPYLLNIQYRMHPEISNFPSKKFYESKLENGPDMHVINEQPWFK------------DAXFKPYVFFSVVDGK----EAKSPAMSLYNEVEAQFVVNLVDTLLKRYXFKNQIGIVSPYKEQVQLMRKLFIEKVTVQTVDSFQGQEKTIMIFSCVRSSAKRSIGFLKDYRRLNVALTRGKSNMWIVGNDKTLKKNRLWGSLIKDANERESVVT. 692
112 0.000e+00UniRef50_UPI000522A70F probable helicase senataxin n=2 Tax=Neognathae TaxID=8825 RepID=UPI000522A70F  ali  25 1062..YNDYFNTFFPLMMLNAFETLAQDWIE------HQRVKEKSYYFYLQNFCADLNTADFTAHFQESDLRQLHPKEDDLIFLSEMENHMVNHVGLVTRFSSCHLSVQTRGNLSFINKQVKCVVVGSLVTVHRTFKGLLLLSRSPLNPSYNDFCPRDLPMASERCAASYMNEYNEDQKRAIETAYAMPKICLIHGPPGTGKSKTIVGLLCRVLRKPNRFLVCAPSNAAVDELMKKICGDIKLVRLGAEKAINSEVRGFSLDKQVEHR--------MKRKPADCDQDIQKRKAALDQKLDMLSRERARHRCGK-RESQMLDDEIGKLSKERQQLASRVK----EVRGHSQKVQADIILESDIICCTLSTSGGGLLESDPFSCVIVDEAGQSCEVETLIPLIHCNKLVLVGDPRQLPPTVKSVKAQGYDQSLMARLHRHLEEPVVQLTVQYRMHPDICHFPSNYIYGRTLKTDRATEESRCS---------------SEWPFQPYLIFDVADGC-----EERDNDSFSNPQEVKLVMEVIRTIKKKDLGFRRLGIITPYSAQKKKIQEQMDRVFEVDTVDAFQGREKDCIIVTCVRANNKGSIGFLASLQRLNVTITRARFSLFILGRLETLMENGDWNELIQDAHKRGAII.. 1769
113 0.000e+00UniRef50_G4TR01 Related to regulator of nonsense transcripts 1 n=2 Tax=Serendipita TaxID=358905 RepID=G4TR01_SERID  ali  29  86..VSAYQKHFTPLLEAEQHEESSRIQERLGQWPLELLVAEGYALVELSIKNGEKVHDGYTFSFVPPPGEFLGPNPYSPLNFYHQQGFDAIPSGIVVHSSPEEIRVRFSTKDLKSNQLWRLDLAACDIAYLRMAAAMECLRDTPTEIEPGASQDKPPLIDDPSILDWANRHLNASQTQAIALMFKER-LSLVQGPPGTGKTRTIIEILKSHFKVEHPLLVCTYTNVAVDNLVEGIADGMNPLRVGNEG-----------GAQMERHPRWPEVVKIMNEIAQIRQIRDRLRREMGSAPSDQQKESISRLGNKIHLLRESKAKLESAMRYM------------------------IFKSADVICTTCITAGSSAFRMMDFPVVFLDEASMSTEPASLIPLMHGKHLALIGDHKQLPPVITSELAKGLGKSLFERLIEEGSVPSVMLDTQYRMHPSISAFPSDEFYGKALRDGISPAGGVPATLAPPHSMHLARRKSKLTGEIPVLFIHHDNHEISRDR------SRANLEEMKIVAAVLEDLLNPGLRGRDIGIISPYVAQVRMLNKMLKEDVEIKTVDGFEGREKEIIIFSTVRNNSWGHIGFLADRRRMNVALTRAKRALFVVGSISTLSKGRHGGNFLD........... 784
114 0.000e+00UniRef50_A0A2I0A5D1 Putative helicase MAGATAMA 3 n=234 Tax=Tracheophyta TaxID=58023 RepID=A0A2I0A5D1_9ASPA  ali  25  451.SVEEYLRVFEPLLFEECRAQLYSTWEELAE--IATRDAHVMVHVKMV---ERRERGWYDAIVIPVHECKWTFKEGDVAVLSTPRPGLAEASGRVAGTVRRHIPTDTRDPPGKPKSIWYLTVLGSLATTQREYVALHAFRRLNLQMQTAILKPSPEHFPKYEEQIPALPEFNSPQLAAIQWAAEPWPFTLVQGPPGTGKTHTVWGMLYQHLCPKPRMLVCAPSNAATDELLSRVLDRGFIDGEMKVYRPDVAVDSQTRAAQVERRTEQLLMKEIHGWIHQLRAREAQFSQQISLLQRELLADRDHNRDLLLQSLAAAVEGRDKVLVELSRLCILESRFRPNLEDARASLEASFANEAEIVFTTVSSSGRKLFSRLTFDMVVIDEAAQASEVAVLPPLSLGARCVLVGDPQQLPATVIS-KAAGYSRSLFERFQQA-GCPTMLLSVQYRMHPQIREFPSRYFYQARLTDSESVASLPDEIYYKDPLM------------QPYIFYDIMHGR---ESHRGSSVSYQNIMEAQFALRLYEHLQKNGARKVTVGIITPYKLQLKCLQREFEKDIYINTVDAFQGQERDVIIMSCVRASNHG-VGFVADIRRMNVALTRARRALWVVGNANALMQSDDWAALINDAKARKCFMDI 1253
115 0.000e+00UniRef50_T1J301 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1J301_STRMM  ali  30 1444.....................ITENSKQYQDVSIKQLERRGICILKLRISSRFTGFGRSIFSFEPKSLPAHKITNGDIVGVYYQKGSKPLASGVVIKNDKNFINVAFDQSFDDDGVQYQLLKLTNEVSYRRIKHALKDLRKYNSSTANHLIDPSDPLNVINDNVIFFNENLDSSQKEAVKFALNQKEIAIVHGPPGTGKTTTVIEIILQSNKLGQKILACAPSNVAVDNLVERLADYNNMIRIGHPARFISKVQPFALDAVLSNSSYGQIIKDVRQEIDLL---------------------------------------RKSTGNDRKRAIREAGFLYKELRTRETKATKELLERTSVVLATLTSAYLKHLLMEHFDLVVIDECSQLHVGYLYYGLQNAYWLAITCNYHRLSSQ-KSKAAKGLALSLMERQISIHGNKVRMLTTQYRMHELIMQWSSKNLYEDKLTAHSSVRTHLLKDLPEV--------NENEDTSTPILFIDTAGCNIF-ELDLVDEASKGNEGEADIAAAHVRNLISQGVKSTDIAVVTPYNLQTELLRLRLSSEVEIRSVDGFQGREKEAIVMTLVRSNEKGDVGFLAEIRRLNVAVTRARRHLAIICDSETVSRHPKLKTLVEFLSEHAEI... 2051
116 0.000e+00UniRef50_F6ZZC8 Senataxin n=2 Tax=Xenopus tropicalis TaxID=8364 RepID=F6ZZC8_XENTR  ali  24 1622.SYEEYFNVFFPLMLLNTFESLAQEWSVKQKA-----IHTDLCKLHLQNFCPDGNRGEFQVWFRDADLMQRHPKEDDLVFLCMPESTRVYHTGYVSRFNRSHLCIHTQGNLSFRNQQVRCAVIGSLITTQRQFRALLQLQRNPLFRPIILPNPADFIPRSESSSFPSLKEYNSDQRYAIEKAYSMPRICLIHGPPGTGKSKTIVGLLYRILMKRNRVLVCAPSNAALDDLMKKICGDINLVRLGAEKTISSDVVKFSLDCQVNHRITRAQQDQELHKRKELLDRRLDELSRRRALCS--------DGFVLYMQCAPLDEEIARLSKERQLLADSLKLVRRR----PQELQRTIILESHVICCTLSTSGGRQLGQEPFSCVIVDEAGQSCEVENLIPLLHCSKLVLVGDPEQLPPTVISMKAEGYGQSLMSRMCSFLKSPVLHLTVQYRMHPDICLFPSHYFYKRMLKTDRATEEVRCS---------------SDWPFQPYMVFDVADGFEQKERE-----SFCNPQEIKVAVALIK-LIKSRKKERNIGVITPYRAQKEELRRAFGNDIEVDTVDGFQGRQKDCIIVTCVRANSQGGIGFLASRQRLNVTITRAKFSLFILGSLRTLMENKDWNHLIQDAQRRGALI.. 2331
117 0.000e+00UniRef50_A0A0A0KM05 Uncharacterized protein n=26 Tax=Magnoliophyta TaxID=3398 RepID=A0A0A0KM05_CUCSA  ali  24  57.DVDDYTSTFEPLLLEEIKAQIIQRNEDEEASDWKFR----------AIMECSEVNGFHFPEMVYLRDEDLKLSPNDLLLLSKEKFQENYAFALVESRQQSKLRLRMSHITSSSKDGIYIYKICSLSTIIREYIALWSISSLPFKEMILAATKDQAWKISKPLQDYMQENLNESQQAAVQAGLSRKPFVLIQGPPGTGKTQTILGLLSAILHATPRMHSTIGLIETRHGSELPVREKYDHWNQASPWLNGINPRDDLMPVNGDDGFFPTSGNELKPEVVKSNRKYRVRRVQNTGVRDENDHPYTPKIVRIGLKPHPSIKAMKELVEQKKNNMSMGKEKSGASGTDLDSIRSAILDESVIVFSTLSFSGSSLFSNRGFDVVIIDEAAQAVELATLVPLANGCKQVLVGDPEQLPATVISTTAKGYDKSLFKRFQTA-GYPVTMLKIQYRMHPEIRSFPSREFYAESLEDAQDVKLRTTRAWHAYRC------------YGPFCFFD---LHEGKESQPPGSGSWVNIDEADFVLHLYHKLVISYPSNSQVAIISPYSQQVKLLQEKFSGIVDITSVDGCQGREKDIAIFSCVRASENRSIGFLSDCRRMNVGITRARASILVVGSASTLKRDEHWNNLVESAQKRDCL... 757
118 0.000e+00UniRef50_A0A1E5RWL3 Putative ATP-dependent helicase n=2 Tax=Hanseniaspora TaxID=29832 RepID=A0A1E5RWL3_9ASCO  ali  26 1126....EYQKIMGPLLLLETWQQIIKTKTL----------DSPSNVITLDITNRVTVGRFFLVTVPSKLWENGGFTESDLCGIGTNKSGSASALAKIDEVKNTRIKVSLKSKIGEPGSTVLLTRLTSLTTSEREFTTLYGLQDYNLLKNLMIPNISKXINADEVSKIRKQYGANQSQAEAIACVTTSSGVSLIQGPPGTGKSKTIVSMMKFFFDEKNDILLCAPSNAAIDELMVRLSEGTKLVRIGRKDXVNSKVEHLVLSEQIEGKL--KRPELISIDHNKYQQEIQKRNEIKNKLEVIKNDPKSNENSDMQKTLDMLRVQLTQMRKERDSIRETNNIFRRKSEFEKKNLTQRILNEADIVCTTLSGSAQKQLENLGFPTVVIDEACQCTELSTLVPLRYGKQIIMVGDPNQLPPTVISNVAAKYDESLFSRLIKX--NSPYLLDVQYRMHPEISKFPSKQFYNSRLKDGPNMDLINQKPWFKDPI------------FKPYNFFSIXDGR----ESKSAAMSLSNIVEAEFVVKLVDTFLNKYSSANQIGVVSPYKEQVQLIRRLFERKVAVETVDSFQGQEKTIMIFSCVRSSDTSSIGFLKDYRRLNVALTRGKSNMWIVGNDNMLIKDKLWGSLIRNAEERGSVM.. 1822
119 0.000e+00UniRef50_W6MGS4 Uncharacterized protein n=1 Tax=Kuraishia capsulata CBS 1993 TaxID=1382522 RepID=W6MGS4_9ASCO  ali  28  11.........FQRVLQIEKRDDYEATSQLIASSPLKKLEAKGLAILNLCISNNVGLNGKIGIELEKPRFSRGDFKLGDIVQLSKSKDNEQHISGIVTKTNDTRIMVSINNQLYNAESKVSLVKLSNSVTYNRMDQSLKRLEAIESKTRLMRILLGDDDYQPPTDLQFVNQGLNESQKAAVNFSLVS-PITIVHGPPGTGKTSTIVEMVRQLAKRNHRILICGPSNVSVDTILERLQDNSKILRLGHPSRLLKSILDHSLDIIVENNDTSAIIKDIIREINTTTHKV----------------------------------KKMKSYRERREAYSEIKLLKKDLRIRSKSAISDVIKNCEIVICTLHGSSSRELNGELFDTLIIDEVSQSLEPQCWIPLMTHERLIIAGDDKQLSPMVNSKVSKVLTHTLFDRLVKLHGGKLKFLNVQYRMNDLILQFPNSELYDGQIVSAESVKDQTCLDLKDV--------KENDDTTAVYIWYDTQGG-LYQEYGEEDEYSKFNENECTLVLNHVESLIKSGVQESAIGIIAPYSAQISKLKGILYPGLEISTVDGFQGREKEIIVLSLVRSNDNNEVGFLADFKRLNVSITRCKKQLCVVGDMECLSKNKFLKDWVEWCEDNAEI... 690
120 0.000e+00UniRef50_A0A1Y1IE20 DNA helicase n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1IE20_KLENI  ali  30  262..VDEFVKKASELLEIERAAEVEATKRALDEMPVEEEDRDNSLRKIVVVRSYTGLGGQHLAQLRSKKLPPSAISPGDLVYLRPEPGWGEEMRGTVQSLGQDTISIALEKRHGDPGRVLRVDRLADGVTYERNLAALKALQKVEAPGGIPQPTSQTPNPTTPTEAEPETPPLDESQQGAVRKALDREAVTVIQGPPGTGKTVVVCDIIAKAVARGERVLATAPTNAAVDNMVEKLTMGLNVVRVGNPQRMTPAVTSRALQVQVDAELADWRRD----------------------------------MARRRADVREDMRACAQDEEMVAGLKTMLRKMGRTLKTTERQTVKLILSQAQVVLCTNSGAADSLVQNEPFDMVVVDEAGQATEPSCWIPLLQGKRAILAGDTCQLAPTVLSREAMGLAVSLMERAMSLYQGRLHMLQVQYRMNAAIADWSSVELYNGQVRSAPMVANKVLADKPGVASTPTTLAPLLLLPRGSLL----RGCEESL--DGSGSGSLFNEGEATIVVSHVLELLAAGVPGPAIAVQSPYLAQVELLQARLAQHVEVASIDSFQGREADAVIISMVRSNPSGIVGFLGDHRRMNVGVTRARMHVAVVCDSSTVGRNPFLLRLLQHIKRRGEV... 953
121 0.000e+00UniRef50_T1J117 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1J117_STRMM  ali  30  180............MLELEIHTVRQRTTKQYQDVSVKQLEQRGICILKLRISCRFTDFGRSVFSFAPNSLSAHQITNDDIVGVNYYQKSKPLASGVVIKNDKNFVNVAFDQSFDQVDVQYQLLKLTNEVSYRRIKDALEDLRKYNGSTANHLINPSDPLNVINDDVVFFNENLDSLQKEAVKFALKQKEIAVVHGPPGTGKTTTLIEIILQSNKLEQKILACAPSNVAVDNLVELLADYNDMIRIGHPARFISKVQPFALDTAVLSNSSYGRIIQDKS-----------------------------------------------SGNDRQQAVHEAGFLYEELKTWEAKATKELLERTSIVLATLTSAHLKHVLMEHFDLVVIDECSQGMEAECWIPLLRAPKCILAGDHLELPPTIVSKKAAGLALSLMERQISIHGNKIRMLTTQYRMHELIMQWSSKNLYEDKLSAHSSVCTHLLKDLPDV--------NENEDTSTPILFFDTATGLASKGNESEADT------EADIAAAHVRNLISYGVKATDIGVVTSYNLQVELLRLRLSSEVEIRSVDGFQGREKEAIVITM-----KGDVGFLDEIRRLNVAITRARRHLAIICDSDSVSQHPTLKELL............ 780
122 0.000e+00UniRef50_G8Y134 Piso0_005032 protein n=12 Tax=Saccharomycetales TaxID=4892 RepID=G8Y134_PICSO  ali  29  8...EQFVSGFKQLVDIEQKADALLTNEYLNKYSPKKLQKYGLAATNLVVKNARNGLGGNTVKADDQELDSGDLKVGDIVRVEKMKSRNSYLDAVITKITSSVINVAVSENNSEESQKVWLVKLSNSVTYKRMISTLNKLGEVDIASIPNQVIQYLLGFRKLKDKDFFNQSLNASQKEAINFSLFESPFSIIHGPPGTGKTYTLIEIIKQLLKQNERVLVCGPSNVSVDTILERLASEFDSKSSIKEKKSKSQRKTGS------RDPSQLIRIGHPARLLDSCLKHSLEVLSKSDSGSGSDSRAILKDIENDINETLRKVKKCRNYGERRALWNDLKGYRKELRKRESKLVSELVVGAKVILATLHGSGGYDLTSIYFDTIIIDEVSQSLEPQCWIPLISHKRLIIAGDNLQLPPTVKSSKAQGLEVTLFDRIVRECNGDAYLLDTQYRMNDAIMAFPSRELYEGKLKADSSVKNILLRDMPNVQP--------TDETSAPCIWYDTQGGDYPEQMDESENGSKYNEMELLAVKKHIDLLIAAGVAPRDIGVISPYAAQVARLRKALAAAELEATIDAFQGREKEAIIISLVRSNDDRAVGFLSEKRRLNVAMTRPKRHLCVVGDMDLMSRCPFLHHWAAHVDS....... 726
123 0.000e+00UniRef50_M0TL67 Uncharacterized protein n=1 Tax=Musa acuminata subsp. malaccensis TaxID=214687 RepID=M0TL67_MUSAM  ali  24  349.SVEEYVRVLEPLLFEECRAQLYSTYEELQ-----ETITRDAHIMVRVKNVERRERGWYDAIVLPVHDCKWNFKEGDVAVLAYEDDIEHEVNGRVVGTVRRHIPIDTRDPLLQPKSTWYLSVLGSLATTQREYIALHAFRRLNLQMQAAILKPSPEHFPKYEEQTPAMPDFNGPQLAAIQWAADPWPFTLVQGPPGTGKTHTVWGMLNVILCPKPRMLVCAPSNAATDELVARVLDRGFIDGEMKVYRPDVA------RVGVDSQTRAAQAVSVERRTEQLLLKSPAASRSQGSNRDKVL-------VELSRLAILESKFRAGSNFNLEDARASL--------------EASFANEAEIVFTTVSSSGRKIFSRLTFDMVVIDEAAQASEVAVLPPLSLGARCVLVGDPQQLPATVIS-KAAGYSRSLFERFQQA-GCPTLLLSVQYRMHPQIRDFPSRYFYQGRLTDSESIANLADEVYYKDP------------LLRPYVFYDVMHGR---ESHRGGSVSYQNVHEAQFSLRLYEHLRK-FVKASSVGIITPYKLQLKCLQREFEKDIYINTIDAFQGQERDVIIMSCVRASNHG-VGFVADIRRMNVALTRARRALWVVGNANALIQSEDWAALIADAKSRECFVDM 1063
124 0.000e+00UniRef50_UPI000643E309 probable helicase senataxin isoform X2 n=5 Tax=Laurasiatheria TaxID=314145 RepID=UPI000643E309  ali  24 1656.DYREYFSVFFPLMVLNTFETVAQ---EWMSSPNKEK------YYQLHVRKFYKKSWEFVAYLKECELKQLHPKENDLVFLVPEKDPYDYYCGYVHKFRRTSVMRNQDTLPVGLNELVRCTVISSLVTTQRKLKAMSLLSGRNQLARAVLNPNPMDFCTKDERIVAYLRDFNEDQKKAIETAYAMAKICLIHGPPGTGKSKTIVGLLYRLLTKQNRVLVCAPSNAAVDELMKKICGDINLVRLGPEKSINNEVLKFSLDSQVSHR--------MKKDLPSHVQEMHRRKDYLDLQLDELSRQRALCRVGREMQXXXXXXXXXXXXXXXXXXXXXIK----EVQGRPQKTQSIIILESHVICCTLSTSGGLLLEGVPFSCVIVDEAGQSCEVETLTPLIHCNKLILVGDPKQLPPTVISMKAQGYDQSMMARFCKLLGEPIVQLTTQYRMHPDICLFPSNYVYNRSLKTNRVTETNRCS---------------SDWPFQPYLVFDVGDG-----SERRDNDSYVNIQEIKLVMEIIKLIKEKDVTFRNIGIITHYKAQKTMIQKDLDKEFEVDTVDAFQGRQKDCVIVTCVRANTQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNHLIQDAQKRGAII.. 2364
125 0.000e+00UniRef50_A2DPW5 Regulator of nonsense transcripts 1, putative n=1 Tax=Trichomonas vaginalis TaxID=5722 RepID=A2DPW5_TRIVA  ali  28  225.DIRDYATTYNTLVKLEMDYDKQ--------------VTESMIYRNVKINFKREGYNRFTGTFSFPSETSRPINIGDTFLVYEAKGSLERTLGV------GEIELLFIRQPPPEDAIFTVQLVWLDTSFVRMIGAIAKMPQSPQEVIMGHLPDTIPTLPGEPNRSPVIPTLNLSQVNAVSYALKS-PFCMIQGPPGTGKTTTIAALVTRFLQKAGPVLVCAPSNAAVERVTEAIASTHASVRVISTSRTDIEAIDYALHNMVYSLDCAESRR---------------------------------------------LNDMLIERSNRDFSEDEEKKFKDLRKS----LENRVIDAADVITCTCITSADPRLATKVFPTVIIDEATQAVEPEILIPIMHGSKQVLVGDHMQLGPVVTNPKCAGLGNSIVQRLVQ-LGLRPQRLLTQYRMHPVLSEFPSNTFYDGELMNGIPAEKRTPQQPVFNWP----------KPSFPLMFYN---NVNNEEEISNSGTSYINAFEATIVSQIVTQLCKAGVDPQQIGIISPYSGQKFYLQNSFYQRLAIASVDSFQGGEKDYIIMSCVRCNPHGSIGFLKDYRRLNVALTRAKYGLIIVGCARVLSKSILWYNLLRHCQEQHVLVE. 822
126 0.000e+00UniRef50_A0A060Z3L8 Uncharacterized protein (Fragment) n=5 Tax=Euteleostomi TaxID=117571 RepID=A0A060Z3L8_ONCMY  ali  35  1......................................................................................................................................................................................................................NMVLCCAGSNVAVDNLVERLAKKAKVLRLGHPARLLESIQKHSLDAVLAHSDNTNIIADIRKDIDKAFM----------------------------------GMKKMNDKRDRIHLKREVGELRKELRTREATAIAEVLKRADVVLATNTGANDKNLPVDHFDWVVIDECAQALESSCWIALLRGRKCILAGDYKQLPPTIKSHTAKGLSVSLMERLILKYGDSVVMLTVQYRMNSNIMTWASEQMYQGQLVAHSSVEKHLLKDLPGVA--------SVEETSTPLLLIDTAGCGLS-EMEVADEQSKGNQGEVDIVELHIKALTEAGVKPKDIAVIAPYNLQVDLLRQRLHPDLEIKSVDGFQGREKEAVVLTLVRSNRKSEIGFLAEDRRINVAVTRARRHLALVCDTQTVQTHGFLKTLIDHMTQHG..... 401
127 0.000e+00UniRef50_A0A075FMQ4 Regulator of nonsense transcripts 1 (UPF1, RENT1) (Fragment) n=1 Tax=uncultured marine group II/III euryarchaeote AD1000_24_F05 T  ali  35  47........................................................................................................................................................................NELNKSQGEAFEKAMTSR-LSLIQGPPGTGKTHTAVRILQWAKQGTGPILATADSNVAVDNLLEGLLDGVKAVRIGQPVKVRSHLRSATLRARIEEHPLQEEVRELIGLQESLQRRLPTFK-----------------------------------GKEKGLAHRDLKMGWKAIRALETSMNDDVLDGAEVICSTCIGVGHQILGQRKFSNILIDEATQAIEPATWVPIMRCRRLVLVGDHRQLPPTVISRRAEGLRRSLFERMIDV-GMIPTMLKTQYRMHPVIAEYSSARYYDNQLENGVSADDR-IAPAGFLWPDW----------NAPVAFVPIDGA----EELAVDGKSRINRDEAGWVVKIVDQLLSAGLEPSDIGVVSPYSGQVQLLTDLFDGKLEIRSIDGYQGREKEVIVLSTVRANHDGEVGFLSDHRRLNVAITRPRRGLIVVGNADTLRHDGDWEGWLDWVRDRKL.... 491
128 0.000e+00UniRef50_F9D2N2 DNA helicase n=76 Tax=Prevotellaceae TaxID=171552 RepID=F9D2N2_PREDD  ali  28  20................EYQTEKEAFRQQTEARGIGRQVKRGDAWCPITGNTFYNSLNQLSLEIFRDQDIEHNFEFGKQIMLFKQDTDKPSCGGTVSYVDGDRMVIILPEDVTSATMPLGVQLSFDETSYRAMFSALDRVIKAKGNRMAYLRDLFYSHIPAQRFAPMSFPWLNVTQERAVNEVLRAKDVEVVHGPPGTGKTTTLVEAINETLMRESQVLVCAQSNMAVDWISEKLDRGINVLRIGNPTRVNDKMLGFTYERRFEAHPDYPQLWAIRKAIREL---------------------------------------RKKRKGRDESYHQKMERLKSRATELEIRINAELFGEARVIASTLVGADSRLLEGQKFSTLFIDEAAQALEAACWIPIRRVSRVVLAGDHCQLPPTVKSIAAAGLGKTLMERIVEQKPECVTLLQVQYRMREEIMHFSSEWFYGGRVETAPQAKHRGILDLENPPPQLSPAGEVEQVPHK-----NIGDASDFSEQFVGESYGRVNRGEAFLTLDALQDFVKIGRQKIDVGVISPYRAQVQYLRQLIKRRISVNTVDGFQGQERDIILVSMVRANDQGQIGFLCDLRRMNVAITRARMKLIILGNAPTLTRHPFYKRLYTYAK........ 670
129 0.000e+00UniRef50_G1N2Q1 Senataxin n=3 Tax=Neognathae TaxID=8825 RepID=G1N2Q1_MELGA  ali  24 1726..YNDYFNTFFPLMMLNAFETLAQEWVENQKM-----KDKTYCFY-LQNFCADLNTAEFIGYFEENDLKQLHPKEDDLIFLRELEDHLVNHVGLVRRFSRCHLSVQTRGNLSFINNQVKCVVVGSLVPTQRSFKGLLLLSRSPLAKPIINPFCPRDLPVASENATFSMSEYNEDQKRAIETAYAMAKICLIHGPPGTGKSKTIVGLLSRVLMKQSRFLVCAPSNAAVDELMKKICGDIKLVRLGAERSINSEVRAFSLDKQVEHR--------MKRKPTDRDQDIQKKKAALDEKLDMLSRQRAMHRCYRFLKSQMLDDEIGRLSKERQQLASQLK----EVRGHSQKVQTDIILESDIICCTLSTSGGGLLESDPFSCVIVDEAGQSCEVETLIPLIHCNKLVLVGDPRQLPPTIKSIKAQGYGQSLMARLQRHLEDPVVQLTVQYRMHPDICLFPSSYVYGRTLKTDKATEENRCS---------------SEWPFQPYLVFDVGDG-----REERDKDSFSNPQEVKLVLEIIRTIKEKDLGLRRIGIITPYSAQKKKIQEELDRVFEVDTVDAFQGREKDCIIVTCVRANSKGSIGFLASLQRLNVTITRARFSLFILGRLKTLMENKDWNELIQDAQRRGAII.. 2431
130 0.000e+00UniRef50_A0A176VHR1 Uncharacterized protein n=2 Tax=Marchantia polymorpha TaxID=3197 RepID=A0A176VHR1_MARPO  ali  25 1337.SSEQYMEIFRPLLMDEFKAQLQRSYEELNLSDST-------TTGVVRLMSLERVDDFNLGRFAGSDAAPRSCAENDLILLSRQPQQTCHLLAKVESRERMKIYINMSDPLLVDRSKWHLTKVMNMSPQLRECQALSSVPCLPLLPILLTPDTSIPAQEPEALQEKITAEYNESQIRAIAFAINTHQLTLVQGPPGTGKTRQDAAIAKQMMKPKQRVLVCAQSNAAVDEIVARILKRPSIVRIGAVKSVHPNSLPVFIDTLVNQRLGAEKDDDEDAAEEKAQAKLMESRAKIQVLEALLSQAKGFEENEKTGQKNLLYKQRREISAELATAEKEGRKSWEESQNKRKAIRKQIIRQADVVVTTLSGCGGDIYQECFFDAVVIDEAGQALEPATLIPFQLNARCVMVGDPKQLPATVLSQNVSKYERSMFERLQRA-GYPVTMLSTQYRMHPEIREFPSAHFYNNLITDGPGLKGSRKAIFHR------------ESYLGPYVFFDVVDGKEG-GRGNSASQSISNEAEVEVVLQLYLTLKKRYLWEGRVGVITPYKQQLRLLQEQFTRDVEFNTVDGFQGREVDIIILSTVRASPNGGIGFVADVRRMNVALTRARFSCWVVGNAATLQANASWDALLRNAKKRALFFPI 2153
131 0.000e+00UniRef50_V5B6D8 Regulator of nonsense transcripts 1 n=13 Tax=Trypanosoma TaxID=5690 RepID=V5B6D8_TRYCR  ali  29  226.NAVEYVTVFSTLIEM---------------DSIAAKERKELLFEDISCKLQKEFGGKHLFLLKQLPPSDVGLRCGDHASIW-VKGSSRLLNGVVVEIGKSQLRRALNEILAASTVSFRLEY--DSTSDQRKCHALNLMMTDWASLSAYLYFEEAAKRFSEVDIDLRLSNLNSSQDTAVRTALRN-PLTLIQGPPGTGKTSTSVAIVLEVNRRIRQILVCAPSNVAVDQLAERIAAGLKTVRLHAHYRVPSSVKHLGLDSQVEEFIASSSGN-----------------------------RRLRQLLELKLAGEVLDEQEQKI-----------------YNDSARDIEEALLGGADVICCTCIGAADRRLGKMRFQYVLIDEATQGTEPETLVPLVRGKQVFLVGDHCQLRPLVFSLPAAGLRRSLFERLLMT-GHRAVRLDVQYRMHPALSLFPSDQFYEGTLQNGLTEEQRDASRV-FPWP----------DPTRPIFFYNTTG----SEELSANGSSYLNRAEAALTERIITKLIRDGVKPDDIGVITPYGGQCRYVMNYLYERVEVSSVDAFQGREKEFIILSCVRSNHRQGIGFVVDWRRLNVSITRAKRGLIIMGNVQLLSRYPAWHALLAHLMELSLVVD. 836
132 0.000e+00UniRef50_A0A1U7RVB2 probable helicase senataxin n=6 Tax=Alligator TaxID=8495 RepID=A0A1U7RVB2_ALLSI  ali  25 1892..YNDYFDTFFPLMMLNAFETLAQEWQESQKA-----KEKNAYHLHLKKFSADLNQAEFTVYIQERDLKQLHPKEDDLIFLEKQNPLAERHVGHVTRFSRTHIVCHLFVQSSYINQQVKCEVVSSLVTTQRKFRGLLLLGRSPLAKAIVHPFCPRDLSTASERTTSYYKEYNEDQKKAIETAYAMPRICLIHGPPGTGKSKTIVGLLFRILNKRNRVLVCAPSNAAVDELMKKICGDINLVRLGPQKSISIDVLRFSLDSQVSYRMNRGHSGR--------DQDIHKRKEALDRQLDMLSRQRAMDRCEKREKSQQLDDEIGRLSKERQELASQLKK----VRGRPQEVQGSIILESHIICCTLSTSGGFLLESDPFSCVIVDEAGQACEVETLIPLIHCSKLVLVGDPKQLPPTVISMKAQGYDQSLMARLHKHLEEPVVQLTVQYRMHPDICLFPSNYVYGKTLKTDRATEESRCS---------------SDWPFQPYLVFDVADGH-----EKRDKDSFTNPQEVKLVVELIKTIKEKRKDTGSIGIITPYNAQKKIIQQELDREFEVDTVDGFQGRQKDCIIVTCVRANSHGSIGFLASLQRLNVTITRAKLSLFILGRLKTLMENKDWNELIQDAQRRGAII.. 2601
133 0.000e+00UniRef50_E1C4T7 Senataxin n=16 Tax=Neognathae TaxID=8825 RepID=E1C4T7_CHICK  ali  24 1849..YNDYFNTFFPLMMLNAFETLAQEWVENQKM------KDKTYYLHLQNFCADLNTAEFIGYFEETDLKQLHPKEDDLIFLREVEDHLVNHVGLVRRFSRCHLSVQTRGNLSFVNNEVKCMVVGSLVPTQRSFKGLLLLSRSPLAKPIINPFCPRDLPVSSESATFCMNEYNEDQKRAIETAYAMAKICLIHGPPGTGKSKTIVGLLSRVLRKQNRFLVCAPSNAAIDELMKKICGDIKLVRLGAERSINSEVRAFSLDKQVEHR--------MKRKPTDRDQDIQKKKAALDEKLDMLSRQRAMHRCEK-RESQMLDDEIGRLSKERQQLASQLK----EVRGHSQKVQTDIILESDIICCTLSTSGGGLLESDPFSCVIVDEAGQSCEVETLIPLIHCNKLVLVGDPRQLPPTIKSIKAQGYGQSLMARLQRHLEEPVVQLTVQYRMHPDICLFPSSYIYDKTLKTDKATEENRCS---------------SEWPFQPYLVFDVGDGH-----EERDKDSFSNPQEVKLVLEIIRTIKEKDLGLRRIGIITPYSAQKKKIQEELDRVFEVDTVDAFQGREKDCIIVTCVRANSKGSIGFLASLQRLNVTITRARFSLFILGRLKTLMENKDWNKLIQDAQRRGAII.. 2555
134 0.000e+00UniRef50_A0A2P6NY49 Helicase sen1 n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6NY49_9MYCE  ali  25  891.TAEEYRSVFKPLLLEELRSIIQQEREAPQSTRYHA----------IMIEKTHTLNDFIILDCKCDTMTAQSLNPDDLVVLCREKPQGPHMLVRVEPLDKKEKHVRLRCYVTGRKTIWHFKKICQLTTSNREWLALAGISRLSLLPNVLDPAKPIDDESGRIVDLGILDGFNSSQMEAIHAGCTKKGFVLLQGPPGTGKTKTICGLISVLLRSQNHILVCAPSNAAVDEIALRLLRHPNIIRLGSVDTMHPDVRSISLDQKREERDQGGQIYKQKREFDNSREKXXXXXXXXXXXKMRIEGGNAEEIAVKLQRLRELNQSRRVLNDKFAPLDAQHKEEAKLYDNVSRESFKLILNSATIILSTLSGAGSDKMSDFGFDTVVVDEAAQTVEVSTLIPLKYGCKCVLVGDPAQLPATVISRSAKEYEQSLFQRMQMA-GVHVNVLTTQYRMHPELRLFPSREFYLDRLIDGNNVKN----------------YPNHIQALPPYSFFN------LTSSESSQGKSFINKEEAQFISQLFEYLDKDGRFDGKIGVITPYKQQVQELKRAFRPDVEFGTVDGFQGREKDVVLFSCVRASDSQGIGFLSDVRRMNVAITRPKMGLYIVGNIRSLRVNPFWNDLIEDALGRGRLYD. 1578
135 0.000e+00UniRef50_A0A2M9ZJ39 RNA helicase n=14 Tax=Leptospira TaxID=171 RepID=A0A2M9ZJ39_9LEPT  ali  31  12.............LRKERESEIQRFKNEAGSGDLSSKVRTGLCVYPLVYHDQILGPGGWRVTFTQPMAVPEAFRSGAPVRLFKDADEESSVL---ISVKEEAYVLSLEEVPEWEEGKLGLELLPDETTDRRAEKGTRAKFFADLFLDETKLHLTSPKFKQEKDISA---DLNKSQSDCVSAILQTEDVFFVHGPPGTGKTKTLAEAIRILASRGKKILATAPTNAAADVLGEALKTGVPVLRLGHPARMTEAILESCLDAKLHNHPDAKWLERDKREVLDLFKKAKKYKRNFG----------------------------KQEAEERRSLQHAARELRRTVREREKTLVDFLLDTHSVIVCTHTGASSALLNAFHFDYVFLDEASQATEPSSWIPILRAERAIFAGDPKQLPPTVLSEDAL-LQITLMERFLPAFEKRSLMLDTQYRMKDPIQFFSNIRFYQSRLKSG----------LQESEKNSLPSTKTEFPFGSSFVFIDSSGTDTAEESRDG---SLGNPWEAEFTISLLPALLESGLSADKIGIVTPYRFQKFLLEKLLEERIEVGTVDSFQGREKDFLLFSLVRSNVEGKIGFLAEERRWNVGMTRAKQLLILIGDGSTLGETEFFRELLVSLEKAGEL... 621
136 0.000e+00UniRef50_A0A103YB10 Helicase Sen1, N-terminal n=1 Tax=Cynara cardunculus var. scolymus TaxID=59895 RepID=A0A103YB10_CYNCS  ali  23 1102.SPDDYVAVFRPLVLEELKAQLHNSFAEMSSSD-------EMSCGSLSVMSVERVDDFHVVRCVHDDEGSKSCVENDLILLTRQSSHDVHMVGKVERCKRRSSIIMIKFYLQNGCSRLRAKKLLMERSNLRNDHDLSLIQGPPLLSLSGRNAGRTEVGVLKPSNTSLMNKVRISQSAAIARAWQDAAMAKQLKDDDSKSSSVTASHIR------GRVLICAQSNAAVDELVSRIMYKPYLVRVGNAKTVHPSSLPFFIDTLVDHRLTEERMTVLRSKLEKLVDRIRFLEAKRANLSNGNDDVKEMSDAEIGAKLRTLYSDKKAVYIDLAAAQAREKKVHEKRKALKLKLRKSILREAEIVITTLSGCGGDLYESSLFDAVVIDEAAQALEPATLIPLQKGSKSIMVGDPKQLPATVLSDVASKYQCSMFERLQKA-GHPVTMLTKQYRMHPEICRFPSLHFYDXKLLNGDGMSSK-------------ETPFHKTEGLGPYLFFDIVDGQELHGK---NSGSLYNECEADAAVELLRFFRKSYPLEGRIGIITPYRSQLSLLRSRFSSEMELNTVDGFQGREVDVLVVSTVRASNSRSIGFVADVRRMNVALTRAKHSLWILGNMRTLQTNKNWGALVNDAKERNLVLS. 1833
137 0.000e+00UniRef50_D4DKP0 Endonuclease III homolog n=3 Tax=Eurotiomycetidae TaxID=451871 RepID=D4DKP0_TRIVH  ali  33  438.DMSKFAQIQQRLLLAEHEDEIASSPLSSSSATRRALQNAGHALTGMVLTNCRTGMGGREVEFGLNTALSHGITVGDIVRVEDDEKGQRGLEGVVTRVGERSIWAAFGDRGKGKQDEDGVDELWMNQTMAKLEKMPESEHSQLIRVLFGHTTPSPLDFESVGTLEFMDASLNDSQKEAIRFALASREIALIHGPPGTGKTHTLIELIRQLVQRKKRVLVCGPSNISVDNIVERLLHKVPLVRIGHPARLLSSVLDHSLEVLSQTSEAAAIVKDVRKEIDS----------------------------------KQASIRKTRNGRERRAIYGDLKELRKEFRERESKCVDNIVSGSQVVLGTLHGAGGHQLKNQKFDVVLIDEASQAREAQCWIPLLPASRVVLAGDHLQLPPTIQTNSARNLEITLFDRLLSLHGTIKRVLTTQYRMHQKIMDFPSDELYESKLIAADAVRERLLKDLPYE-------VEDTDDTREPLVFYDTQGGDFPEKSPDSNGESKCNDMEAAVVARHVENLVSAGVRPEDIAVITPYNAQVALLSQLLKEKLELGSVDGFQGREKEAVVVSLVRSNSDHEVGFLGEKRRLN......................................... 1090
138 0.000e+00UniRef50_A0A2G9I298 tRNA-splicing endonuclease positive effector (SEN1) n=11 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2G9I298_9LAMI  ali  24 1278.SPDGYVEIFRPLVX-------XXXXXXXXXXXXXXXXXXXXCCGSLSVMSVERIDDFHVVRFVYDEKESSSLLENDLILLTRQPLGNSHAVGKVERREKDNIRLHLQGCLLNERTKWYVSRIMSITPQLREFQALSSIKEIPLLPVILNPVNHPLSKLSRPLQQIFKSSYNDSQLKAISLAVSDFELTLIQGPPA--RAWQDAALARQLNCTRGRILICAQSNAAVDELVARIRYKPYLVRVGNAKTVHPNSLPFFIDTLVETRVTEEKSNTIRTNLEKLVDRIRYFEAKRASLQEGNSDSRNVSDAEIKEKLRQLYEKKKAIYREXXXXXXXXXXXXXXXXXXXXXFRMSILKEAEIVVTTLSGCGGDLYESTLFDAVVIDEAAQALEPATLIPLQRGTKCIMVGDPKQLPATVLSNVASKYQCSMFERLQRA-GHPVIMLTKQYRMHPEIRHFPSSHFYEGKLLDGDQMSSK-------------YASFHETWCLGPYVFFDIIDGQELRGK-DSVSLSLYNESEVDAAAEVLRFFKKSYPSEGRIGVLTPYKRQLSLLRSRFTAEMEFNTVDGFQGREVDILLLSTVRAANSSNIGFVADVRRMNVALTRAKLSLWIFGHARTLRTNQSWAALIEDAEQRNLIVS. 2031
139 0.000e+00UniRef50_A0A1F9EXA2 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_16_71_12 TaxID=1797848 RepID=A0A1F9EXA2_9DELT  ali  33  18............LLEHEEREVRARADALVQGKSAKEIEASGALLRRGRLGEVRPAFGRVRASIVDDPSRPFEVRPGAVVWLRDEEGRSPVADGVVVRRKRGQLEVVFEDSEQVGDVDDTIDLLEDEVTLRRMREAAERVEGRAARLIEILLGAAPPRPTRGGELT-TLDTLNEDQRQAARHGVFAEDVALIHGPPGTGKTRVLVEVIRQCVARGERVLALTASNAAVDHLAASLLEADAALRLGNPSRVSPALEQHTLVALTDAHERRQLARDLVEQAFTLLRQARKRSA-----RGRDAWHKERE------------------------ARVEAGKLFADARRLERQAAEDVLRTTRVLCGTLTGLAEHVLDEPDFDVLVVDEASQALTPALLLGVLRARRVVLAGDHMQLPPTVLSLGAAGLAETAFGREADEAGAASHLLTVQHRMHQALMQFPSTRSYGGALRAHPSVAQHTLADLGVTSEPVGAAERVLD-------VVDTAGTG-FEERVASGSETRENEGEARLVERVIRALLSSGLVPTQLGVITPYAGQVALLSSALAPLVDIDSVDGFQGREREVIVISAVRSNAGGEVGFLADARRLNVAITRARRKLVVVGDSATLSTDEHWRALFDHAIAAGAY... 642
140 0.000e+00UniRef50_A0A0G4FYN2 Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4FYN2_VITBC  ali  28 1324.DVYEYYDTYTSLI--EAEAEDIRSRKESQRQT------------NITVRWEVASNRRRTAIFLPQDESSMRPVVGDELAITYNGGEEWKQEGHVKMITPQWITVVLERGPVGQNGPWSVEFVSKAVNIGRMRGALNLLARDETSVSNYLFCPTIEPTLRGDLSVSGLAELNRSQAFAVKQALQL-PLCLIQGPPGTGKTLTSATIVYHMCKQGQ-VLVCAQSNVAVDNLAERLDRRLKVIRLYARGREQSSVKDLALHSQIRRISKAGW-------------------------------------GPVQAEIAMLERRKEERGALQNTDEYRLKKLR-------GKLEKELLTAADVICCTCIVAGDQRLECFRFKQVLIDEATQAMEPECLVPIVMGKKLVLVGDQRQLGPVVICEAKAGLSQSLFERLI-HLGNKPIRLEVQYRMHPCLSAFPSQFFYDGSLQNGVTIRERTFESLHFPWPNK----------EMPMFFYNCTGP------EEKSGTTFLNRTEGDHIRELVTCFLKCGLKPHQIAVITPYEGQRSHIAAVLDKGIEVACVDAFQGREKDFVILSCVRSNENQGIGFLNDPRRLNVAITRAKYGLVICGNADVL...................... 1916
141 0.000e+00UniRef50_A0A2C6KZN6 Rna helicase (Upf2 interacting domain) protein (Fragment) n=1 Tax=Cystoisospora suis TaxID=483139 RepID=A0A2C6KZN6_9APIC  ali  33  7....................................................................................................................................................................APNLAPLNPSQMLAIRYALQH-PLSLIQGPPGTGKTLTCSTLVYYFNKEEGQVLVTAPSNVAVDQLAERIHRGLKVVRLYSKSR----------------------------EFASLSATSTFCMENLALHKKILELKTASS------------DEMSKYLKLKEHTGELAPADERRLRLLISRAEMEILQTADVICTTCAGAGDNRLQGFRFRQVVIDEATQATEPECLIPIVLGKQVVLIGDHCQLGPVVLSKKAAGLSTSLFSRLL-SLGHRPLRLKIQYRMHPALSRFPSYFFYDGELQDGVTAKDRTYV---HPGGSEASQKFPWPSEERPMFFYH----STAAEEISGSGTSYINRVEASNIEKIVTFLLKCGLKASQIGVITPYDGQRAHISSLFQRDLEVASVDAFQGREKDFILLSCVRSNSNTGIGFLADPRRLNVALTRAKYGLIVCGNASVLAN.................... 466
142 0.000e+00UniRef50_A0A1L0BYM6 CIC11C00000003118 n=2 Tax=[Candida] intermedia TaxID=45354 RepID=A0A1L0BYM6_9ASCO  ali  30  1MSYKELADQFRTAIELEQKCDTLLTNSYLEKYSPKKLASFGVAIINLVLTNLRTGLGKTLIELSLDPALSKQLRVGDIVKLDREKPRESSLEGVVVKLTGKLLCVAVEENVSDENIRMWIVKLTNSATYKRMFQAMKKLEELKDSDKGEVLRIVPKSGRKKEKIKFFDSTLNDSQKIAIEFAMNGSPITIIHGPPGTGKTYTLIELIKQLFNRKERVLVCGASNISVDNILERLSPTFSGDDGEDDETSNKNQKR---TRRKKSSTTSTNPEKLIRIGHPARLLPSNLQHSLDILSKSSGSQEILRDIEKDISSTLGQIRKCKRYGERRALWSELKQLKKELYLRERKVVHDLLVNAQVILATLHGAGSNELSNPLFDTIIIDEVSQSLEPQCWIPLLGCKRLVIAGDNKQLPATVKSKDEADLEFTLFDRLIANHNDYRKLLDVQYRMNSEIMDFPSNKLYEGKLKADESVMNITLPDLDGIESTDATVPQ--------CLWYDTQGGDFPEQTADEPGGSKFNEMEVLVVVQHVQQLIQAGVQQEAVGIISPYSAQVSMLKKSLSGTIEISTVDGFQGREKEVIILSLVRSNEIREIGFLSEPRRLNVAMTRPKRQLCVVGDLELLETCGLWARFVN........... 716
143 0.000e+00UniRef50_F4K1G7 P-loop containing nucleoside triphosphate hydrolases superfamily protein n=74 Tax=Mesangiospermae TaxID=1437183 RepID=F4K1G7_ARATH :_  ali  29  264..IDEFTSQMSQLLQVERDTELEVTQEELSSKPIEFLVRHGDTICNLYAVSTSTGLGMHLVLFKNHRLPPTTLSPGDMVCIRVCDSRTACTQGFVHNLGEDSIGVALESRHGDPGKSVRIDRLADALTYERNCEALMLLQKNGLQKKNPSISVVATLFGDGEDITWLEQNFDSSQRRAIALGVNKRPVMIVQGPPGTGKTGMLKEVITLAVQQGERVLVTAPTNAAVDNMVEKLLHGLNIVRVGNPARISSAVASKSLGEIVNSKLASFXXXXXXXXXXXXXXXXXXXXXDV----------------------------------LAAGIRQLLKQLGKTLKKKEKETVKEILSNAQVVFATNIGAADPLIRRLEFDLVVIDEAGQSIEPSCWIPILQGKRCILSGDPCQLAPVVLSRKALGLGVSLLERAASLHGVLATKLTTQYRMNDVIAGWASKEMYGGWLKSAPSVASHLLIDSPFV--------KATWITQCPLVLLDTVGCEERL--DPAGTGSLYNEGEADIVVNHVISLIYAGVSPMAIAVQSPYVAQVQLLRERLADGVEVATIDSFQGREADAVIISMVRSNNLGAVGFLGDSRRMNVAITRARKHVAVVCDSSTICHNTFLARLLRHIRYFGRV... 938
144 0.000e+00UniRef50_A0A1J4K0U0 Regulator of nonsense transcripts 1 n=1 Tax=Tritrichomonas foetus TaxID=1144522 RepID=A0A1J4K0U0_9EUKA  ali  27  220...QQYSNVFMDLVTEECEYE--------------RKIKESMHIPNVTVNWEQVGPITWIARFKTPTSEARNLNVSDELNL---KAVNFDQNGKVVFVADGSIDLKFFNIPEDPNLSYTVKLVFDDTSYRRQKNSLKEFANNTSSLIRNIILGKIPNELPRESIKFGNSQLNQSQLNAIKTAIEL-PFTLIQGPPGTGKTTTIAALVYKFLELKKPILVCGPSNISVEHAT-----RYTALTGVNVVRVIS-----------------------------------------RKLDDITTCVDKFTVSKMIFEMDNKDSRTLKDLQAKMRNEPLTPRENELFEKLKTRLEKEIIQKADVVCCTCDTAGSRKFDGLSFPVVIIDESTQAVEPKILIPILHSKQVVLVGDHCQLGPNVMCREQAGFSRSIVQRLMQ-LGMKPVRLVTQYRMHPALAEFPSNYFYEGILENGVSAKDRTPSRTKFPFP----------QPGVPMFFFNSTGA----EESSDSGTSFINRQETFLVSQIISKLCKAGVSPKQIGVITPYAGQRCYIGQFLYRYIEVASVDSFQGGERDYIILSCVRSNERGYIGFLKDRRRMNVSLTRAKMGLMIIGSAQALSSNKMWFDLLRFFQDRSLLVE. 816
145 0.000e+00UniRef50_A0A2R6QYD9 Helicase like isoform 1 n=8 Tax=Pentapetalae TaxID=1437201 RepID=A0A2R6QYD9_ACTCH  ali  25  471.SVEEYVRVFEPLLFEECRAQLYSTWEELTETGSRD-----SHIMVRVKSVERRERGWYDVIVLPATEWKWTFKEGDVAILSTPDNEEPEVSGRVAGTVRRYIPIDTRDPPLQPRGIWFLTVLGSLATIQREYIGLHAFRRLNLQMQTAILQPSPEHFPKYEEQHPAMPEFNEPQLAAIQWAADPWPFTLVQGPPGTGKTHTVWGMLYQHLCPKPRMLVCAPSNAATDELLARVLDRGFIDGEMKVYRPDVSVERRTEQLLVKSRDEYGWMHQLRARDAQLSQQMACLQRELNVAAAAILVARDQNRDELLQNLAAVVENRDKVLVEMSRLLILEAKFRANLEDARANLEASFANEAEIVFTTVSSSGRKLFSRLTFDMVVIDEAAQASEVAVLPPLCLGARCVLVGDPQQLPATVIS-KAAGYSRSLFERFQQA-GCPTMLLSMQYRMHPQIRDFPSRYFYQGRLTDSESVTNLPDEIYYKDP------------LLKPYVFYDITHGR---ESQRGGSVSYQNIHEAQFCLRLYEHLQKTFKSKVSVGIITPYKLQLKCLKREFEKDIYINTVDAFQGQERDVIIMSCVRASSHG-VGFVADIRRMNVALTRARRALWVMGNGNTLVQSEDWAALIADAKQRNCYLTM 1273
146 0.000e+00UniRef50_A0A176WEV3 Uncharacterized protein n=1 Tax=Marchantia polymorpha subsp. ruderalis TaxID=1480154 RepID=A0A176WEV3_MARPO  ali  22  75.DLEEYLSVFEALLLEECRAQIIRGEEEG-----------GGTQCHMVLATWEKANEFYFMRLAVPADAVEEFMENDLLLLSREKPLTTYAFGAVEGREGAQ-TLRVRMHLDSETSEWYIMKLCNMSTILREYTALRSVGSLPFVDVILSAADASKWNIPQPLKEYLQGGHNSSQMQAIQAGLTRKPLVLIQGPPGTGKTQTILGLLSVILHSTPAKLPAKMLN----------------WMKASPWHGNINPRDLIMPEDGDDGYFSASHNAFRPEKVGAKQKLHAHEIVLRLLRTGLRDEKGMMYTPNIVRVGLNAHHSVQSVSMDTLVQHRLSSTERTAGMERDRIRIQILDEAAIVCSTLSFSGAGVFKRMNFDVVVIDEAAQA-----------------VGDPIQLPATVLSTNAHGYGMSLFKRFQQA-GYPVQMLNTQYRMHPQIREFPSKEFYHEALVDGDEVELQTTRPWHEHRC------------FGPFAFLDIAG----QESQPPGSGSWVNQDEADFVLVLYKCLVGMYPSLKDLAVISPYKQQVKLIRELFRKLIDINTVDGFQGREKDIAIFSCVRANPKGGIGFVSDYRRMNVGLTRARASMLVVGCSAALKQDKHWNNLITSAEERRRLL.. 746
147 0.000e+00UniRef50_A0A0L1KS62 DNA polymerase alpha-associated DNA helicase A n=1 Tax=Perkinsela sp. CCAP 1560/4 TaxID=1314962 RepID=A0A0L1KS62_9EUGL  ali  30  79..................................................................................RVRKRAKPLSGTVRSKGADSVTISFSQISLSVDENVEISPVENEITFKRLFHTLDTVEKDDLPNITSLGDLSPPTLSSEPAIP-----LNASQKRAVQAALDAAEFHLIHGPPGTGKTSTICEIVRCSLQSGKRILLCAPSNCAVDNALLKIIHSHCVLRFGDSERMDDQLSAFSLHQLVHNRDGYDLIKQVEKEIT---------------------------------------------RAEKKQHYREKTALLTEKKRRLSNLRRTCLAGANLVACTLNSAGHPQLDKEMFDLCIIDEASQALAVESCIAIAKARKVILVGDPMQLPPVTLSNQ-SELEISLMETLVAKHGKHFTHLDVQYRMHEAISRWSSGEFYDGKIRTDPSIESLLLSDMDG--------IQETYETAQPIMFCDTSDYG-FREYTDGGGRSKMNMGEVDIAVAHITRLLAAGVPAADIGVITPYSAQAAHISRGLAEKVEVNTVDAFQGREKLVVVLSLVRNNDTHDIGFLGERRRLNVAMTRARRHLLVIGDVHTASFSAFMQRLWDFVEENAAFVDL 629
148 0.000e+00UniRef50_UPI00051E3A7B LOW QUALITY PROTEIN: probable helicase senataxin n=9 Tax=Aves TaxID=8782 RepID=UPI00051E3A7B  ali  25 1882..YNDYFNTFFPLMMLNAFETLAQDWLESQRM------REKSYYFHLQNFCADLNRADFIAHIRESDLRQLHPKEDDLIFLSEMVNHLVKHVGLVTRFSRCHLSVQTQGNLSFINKQVKCVVVGSLVTTQRTFKGLLLLSRSPLAKPIINPSYCPRDLHVASESDAYMKDYNEDQKRAIETAYGLPKICLIHGPPGTGKSKTIVGLLSRVLRENNRFLVCAPSNAAVDELMKKICGDISLVRLGAEKSISSEVRGFSLDKQVEHR--------MKRKLPDRDQDIQKKKEALDQKLDMLSRQRAMHRCEKRAINQMLDDEIGRLSKERQQLASQLK----EVRGYSQRIQAEIILESDIICCTLSTSGGTLLESDPFSCVIVDEAGQSCEVETLIPLIHCNKLVLVGDPRQLPPTVKSQKAQGYDQSLMARLHRHLEAPVVQLTVQYRMHPDICLFPSNYVYGRTLKTDKATEENRCS---------------SEWPFQPYLIFDVGDGH-----EERDNDSFHNPQEVKLVMELIKTIKRKDLGLRHIGVITPYSAQKKKIQEELDRVFEVDTVDAFQGREKDCIIVTCVRANSKGSIGFLASLQRLNVTITRARFSLFILGRLKTLMENKDWNELIQDAQRRGAII.. 2589
149 0.000e+00UniRef50_A0A096P7D5 p-loop containing nucleoside triphosphate hydrolase n=2 Tax=Ostreococcus tauri TaxID=70448 RepID=A0A096P7D5_OSTTA  ali  31  141......RERFAKGLKCELEEEMALSEKRLNTWTLERLVSEGYAILGMRARYQRDALVRLTIPFADRELPYHRFTTGDMVQMSEGDEHDAGITGVVALRSMHFITVAVHEDDLETGSKWRVDLSANTVAHDRSLAALVALGVPDENGTLEQLANMPPQWAGKEQIKLVRDPLNPSQRVAVKSATSSS-LAVWQGPPGTGKTRTLIAYIGAAVHKGPVVLASAASNVAVDNILEGLAKEKFVVRLGAPAKVQPWLQELTLDAQIAQHPLGRQAAAMRDAIRGLSGPAYARQR-------------------------------------------------KQATQLELTAAKSILKSVDVVCSTCVGAGDDLLEDLTFPVTVLDEATQCTEPAALIALSKALSAVLVGDSRQLPPTVVSRDAAGLQISIFERM-ERLGVKVSLLDLQYRMHPLIAEFPSQAFYSGKVGSAPTPQDRPIVP-----------GVAWPKPNVPVVFLEINDAEC----RAPDGNSLYNVEEAKTAITVVKKILASGDGPGDIGVISPYAAQVRLLRNYLDKELEIRSVDGFQGREKEVIVLCTVRSNTGGGIGFVDDPRRLNVGITRARRGLIVLGNRRTLSTNEIWRKWFKWIDQYGC.... 811
150 0.000e+00UniRef50_R9AHK0 Regulator of nonsense transcripts 1-like protein n=1 Tax=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) TaxID=1299270 RepID=R9AH  ali  29  98..VNEYVGRFKGLVKLEQQASEHKFNNRMHEWPLDKLKQEGYVITDLSACHARRKWGKPSAIFQLNPLPSHRFRKGETVTLSELSELSEKWSGTVDSVSPTHIQLLFDRRPITADARYRIDMALADVLYKRSLEALESLCLDPVEQAKVSDSALKGTHLCDVILNTGNSSLNARQIQAVALMIGNRA-SLIQGPPGTGKTATISHLMKQHFHIPHPILIAAYTNVATDNIASILAAGMKITRLGHVSRVAPELHTHTLAAQVEAHPRYTHVKHARYRSEGLFRRAASTNSTANATSS----------------------------LMKEQLYEEARQQRRTAGRIVREMQQDIIRNADVVCATCIGGNARELSSVDFPIVFIDEASQATEPTTLIPLMKGCHMSIIGDHKQLAPIITSEEAQGLSVSLFERLIETSSVPSVMLDVQYRMHPDLSSIPNTIFYDSQLVDGCSVDASNGGSSGHLLPAYKPPRSAYLRDGAALAFVNH------EHTETRDGESTLNEGEAGVIMGLVTDLFKQNIRGCDIGIVSPYVAQTLELLHLLNRDIEVKTVDGFEGREKQVIILSLTRSNERGFIGFLDDPRRANVGLTRAKRCLMVAGNASTLRESALWRDLIGLCRSKGAYVEY 808
151 0.000e+00UniRef50_A0A2C5XBN9 Uncharacterized protein n=1 Tax=Ophiocordyceps australis TaxID=1399860 RepID=A0A2C5XBN9_9HYPO  ali  24 1142.DPKSYQATFFPLLAWEAWRSFVTSKEETTSGAFS-----------MKIVSRATVDSFVEATFAVPESRERGFGEGDILLVSQDNGEAKHCLGRVHRMTHKKITYQVSSRGNALTQELRGIKITNMTTIEREYAALESLQHYDLMEEILKAEASPILSYGEQKVTMGTWDLNKAQALAVLGANENDGFTLIQGPPGTGKTKTIVAMVGALL-----------SEQLKQAGALKLLGG-----------------DVTLDELADREQLHQEAGRIREELKMLRPRLEET-------------------------------RGGEERGAHNSLWRQFEELKRQQMQVGKQIEASRDSGNSVLCATLSGSGHEMLRKLDFERVIIDEAAQCVELSALIPLKYGCRCILVGDPKQLPPTVLSQSAAGYDQSLF-----------------YRMHPAISAFASREFYEGQLRDGPGMASLRRRPWHQS------------QLLAPYRFFHVAGA----ETRGRRGQSLVNTHELAAALQLYHCFASNYGEPGTIGIITPYKAQLAELKARFKDKIEFNTTDAFQGRECEIIILSCVRASPTGGIGFMTDIRRMNVGLTRAKSSLWILGDARALVQGEFWRKLLHDAQARRCY... 1719
152 0.000e+00UniRef50_A0A151MFN9 Putative helicase senataxin n=1 Tax=Alligator mississippiensis TaxID=8496 RepID=A0A151MFN9_ALLMI  ali  25  771..YNDYFDTFFPLMMLNAFETLAQEWQESQKA-----KEKNAYHLHLKKFSADLNQAEFTVYIRERDLKQLHPKEDDLIFLEKQNPLAERHVGHVTRFSRTSFRVQTRGNLSSINQQVKCEVVSSLVTTQRKFRGLLLLGRSPLAKAIVHPFCPRDLSTASERTTSYYKEYNEDQKKAIETAYAMPRICLIHGPPGTGKSKTIVGLLFRILNKRNRVLVCAPSNAAVDELMKKICGDINLVRLGPQKSISIDVLRFSLDSQV----SYRMNRGHSGRDQDIHKRKEALDRELDMLAR----QRAMDRCEKREKSQQLDDEIGRLSKERQELASQLKK----VRGRPQEVQGSIILESHIICCTLSTSGGFLLESDPFSCVIVDEAGQACEVETLIPLIHCSKLVLVGDPKQLPPTVISMKAQGYDQSLMARLHKHLEEPVVQLTVQYRMHPDICLFPSNYVYGKTLKTDRATEESRCS---------------SDWPFQPYLVFDVADGH-----EKRDKDSFTNPQEVKLVVELIKTIKEKDIGSRNIGIITPYNAQKKIIQQELDREFEVDTVDGFQGRQKDCIIVTCVRANSHGSIGFLASLQRLNVTITRAKLSLFILGRLKTLMENKDWNELIQDAQRRGAII.. 1480
153 0.000e+00UniRef50_G3TPH3 Uncharacterized protein n=4 Tax=Euteleostomi TaxID=117571 RepID=G3TPH3_LOXAF  ali  38  1........................................................................................................................................................................................................................VLCCAPSNIAVDNLVERLHCEQRVLRLGHPARLLESIQQHSLDAVLARSDSAQIVADIRKEIDQVFVK----------------------------------NKKTQDKREXXXXXXXXXXXXXXXXXXXXXXXXXSLTSAHVVLATNTGASSKLLPESYFDVVVIDECAQALEASCWIPLLKARKCILAGDHKQLPPTVISHKAAGLSLSLMERLAEQHGERVRLLTVQYRMHDAISQWASEALYGGQLTAHPSVAQHLLRDLPGVAP--------TEETAVPLLLIDTAGCGLF-ELDEEEEQSRGNPGEVRLVSLHVQALVDAGVPARDIAVITPYNLQVDLLRQSLYPELEMKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVAVTRARRHVAIVCDSRTVTNHAFLKTLVGYFTEHGEV... 399
154 0.000e+00UniRef50_M0RMX3 Uncharacterized protein n=1 Tax=Musa acuminata subsp. malaccensis TaxID=214687 RepID=M0RMX3_MUSAM  ali  25 1147.SSSHYVEIFRPLVLEEFKAQLHSSYIEN---SGDDMSCSSICLLSV-----ERVDDFHLIRDGTDTVASRVCAENDLVLLTKEPLQNAHVLGKVERRKSRSIVLVIRLYLPSERSKWFSSRIMSMTPQLREFQALSSLHDIPMLPIILNPVNHSAGHLASKKVQMFISSYNDSQIQAISTAIGSSELSLIQGPPGTGKTRTIVAIVSAWLALQKRILICAQSNAAVDELVSRISEKSYLVRVGNSRTVHPRSLPFFIDTLVEQRLTEEMNNQISGKNDKDVES-----------SSSLQNEMNTSNSINNKPSQKGDPLEISDAAIERKVSEESRSLR-------HKIRKSILKEAEI---------------NLFDIVIIDEAAQALEPATLIPLQLGTKCIMVGDPKQLPATVLSNVASKYECSMFERLQRA-GHPVIMLNEQYRMHPEICRFPSMHFYENKLLNGAEMEDRSA-------------LFHENFCLGPYMFFDIVDGHEHHGK-NSGSVSLYNEAEVEVAVEILKFLKKRYPSERRIGIVTPYRSQLSLLRSRFSSEIEFNTIDGFQGREVDILVLSTVRASGSGGIGFVADARRMNVALTRAKISLWIVGNARTLQRNVNWAALIENSKERNLF... 1847
155 0.000e+00UniRef50_A0A2P4L5D3 Putative helicase magatama 3 n=8 Tax=Pentapetalae TaxID=1437201 RepID=A0A2P4L5D3_QUESU  ali  24  125.DMDDYISTFEPLIFEEIKAQITQRTNEDEVSEWERRL----------VVECNEVDGFHLVTYAADNAKE-SISHNDLLLLSKEKFQTTYAFALVENCQNDRFRLRMYSPTSEVEKLFYSLKICSLSTIAREYLAMWSIGSLPFKDLILSATEKVLWKISKFLEEYIKDNHNETQQEAIQAGLARKAFVLIQGPPGTGKTKTILGLLSAILHATPRVLSKGEFLEMKRGPQLPIQEKYNHWVSASPWLIGGNPRDSIMPIDGDDGFFPTSGNDLKPEVVNSCRKYRVREIVLRVLNTGVRDENDHAYNPKIVRIGLKEHHSVRAVSMDYLVKQKQESMSADKDKHKDSIRAAILDEAVIVFCTLSFSGSTLFSNRGFDVVIIDEAAQAVEPATLIPLANGCKQVLVGDPVQLPATVISPIAEGYGTSLFKRLQRA-GYPVTMLKTQYRMHPEIRSFPSREFYAESLEDGPNIEVHTSRDWHSYRC------------FGPFCFFD---LHEGKESKLAGSESWVNVDEVEFVLLLYCKLVSKYPSSSQFAIISPYSQQVKLLKDHFKTTVDITTVDGCQGREKDVAIFSCVRASKDKSIGFLADYRRMNVGITRAKSSVLVVGSSSTLRRDEHWNNLVESAENRKCFI.. 820
156 0.000e+00UniRef50_A0A1L0AYG9 Uncharacterized protein n=1 Tax=Hanseniaspora guilliermondii TaxID=56406 RepID=A0A1L0AYG9_9ASCO  ali  26 1126....DYQKIMGPLLLLETWQQIIKTKTL----------DNPSNVITVDITNRVTVGRFFLVTVPSKLWENGGFTESDLCGIGTNKSGSASALAKIDEVKNTRIKISLKSKILSPGSTVLLTRLTSLTTSEREFTTLYGLQDYNLLKNLMVPNISKAINSDEVSKIRKEYNVNQSQAEAIACVTTSSGISLIQGPPGTGKSKTIVSMMKFFFDEKNNILLCAPSNAAIDELMVRLSEGTKLVRIGRKEAVNSKVQHLVLSEQIDGKL--KKPELISIDHNKYQQEIQKRNEIKNKLEVIKNDPKNNDNVDMQKTLDLLRVQLTQMRKERDSIRETNNIFRRKSEFEKKNLTQRILNEADIVCTTLSGSAQKQLEKLGFPTVVIDEACQCTELSTLVPLRYGKQIIMVGDPNQLPPTVISNVAAGYDESLFSRLIK--GNSPYLLDVQYRMHPEISKFPSKQFYKSRLKDGPNMDIINQKPWFKDPI------------FRPYNFFSVVDGR----ESKSAAMSLSNVVEAEFVVKLVETLLKRYSNENQIGVVSPYKEQVHLIRRLFDRKVAVETVDSFQGQEKTIMIFSCVRSSDTSSIGFLKDYRRLNVALTRGKSNMWIVGNDNMLINDKLWGSLIRDAEERGSVV.. 1822
157 0.000e+00UniRef50_A0A151T9G4 Putative helicase DDB-G0274399 n=2 Tax=Mesangiospermae TaxID=1437183 RepID=A0A151T9G4_CAJCA  ali  23  342.SVEEYVRVFEPLLFEECRAQLYSTWEEST-----ETVSRDTHIMVRVKANESRERGWYDVKVLPVHEFKWSFKEGDVAILSSPRPGESEITGRVVGTVRRHIPIDTRDPPLQSGSIWYLTVLGSLATTQREYVALHAFRRLNLQMQTAILQPSPEHFPKYEQHTPTMPEFNEPQLAAIQWAAEPWPFTLVQGPPGTGKTHTVWGMLNVIHLVHSEH---APT--------------------GSIDEVLQNMDQNLLRTLPKLVPKPRMLVCAPSNAATDELLARVLDRGFIDGEMKVYRPDVARVGILVEMSRLALLESRFRPGSGFNLEEARASL-----------EASFANEAEIVFTTVSSSGRKLFSRLSFDMVVIDEAAQASEVAVLPPLSLGARCVLVGDPQQLPATVIS-KAAGYSRSLFERFQQA-GCPTMLLSVQYRMHPQIRDFPSRYFYQGRLTDSESVAKLPDEPYYKDP------------LLRPYLFYDIRHGR---ESHRGGSVSYQNIHEAQFCLRLYEHVQKAGVGKITVGIITPYKLQLKCLQREFEKDIYINTVDAFQGQERDVIIMSCVRASSHG-VGFVADIRRMNVALTRARRALWVMGNANALVQSEDWAALINDAKSRNCYMDM 1022
158 0.000e+00UniRef50_A0CKK8 Uncharacterized protein n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0CKK8_PARTE  ali  32  11.SFEQFCELQQKWIKQEHEEEQKFIQLISQELTYTQIIQIGYGLGRLKLTKTKLTFGNRQVXXXXXXXXNFRLKQGDQVVLTSQKFKNPEAIGVIDRYRKNRIILEQNCKIPDDNSIYGICLQENQVTYKRHLQVIDDIQYEKHPIIQILFGDQDEKMKEKINQNMEFQGLNDQQKIAVQKAMNQPHISLIHGPPGTGKTRTVCEYIKQALVQRHKILACANSNIAVDNMIERIQNQLKVCRIGNPARMTDQVRYVCIDQLVKKTTSYAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYFEQQQL-----------------------------------AYEEAIQDCQVIFSTNVGSGQFQFKNIKFDVVVIDECAQSLEISCWIPILKGNKVVLAGDHCQLPPTVK-TKNTGLEMTLFERVENELHVN-ILLTVQYRMNKSIMQWSSQEFYDGHLVADQTVANRTVSDTI-------------------LLFVDTSCCDFYEQQQESQNKSKYNVGEAGLVQIISEELINLGVQKQDIGIITPYNAQVQLLKSKIN-DIEISTVDGFQGREKDCIIISMVRSNQMGEVGFLCESRRMNVAVTRAKKFVCLIGDSETVSNDAFLKRLIDYFVENGE.... 647
159 0.000e+00UniRef50_A0A2P4MEZ2 Dna-binding protein smubp-2 n=39 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2P4MEZ2_QUESU  ali  30  288..IDEFTRRMSELLRIERDSELEFTQEELSSKPIEFLVTHGQTLCNLNAVSTSTGLGMHLVLFRKHRLPPTTLSPGDMVCVRECDSRTSCLQGFVNNLGEDSISVALESRHGDPGKTVRIDRIADTLTYERNCEALMLLQKNGLQKRNPSIAVVATLFGDKEDVAWLEENFDDSQRRTIALGLNKRPLLIIQGPPGTGKTGLLKELIVLAVQQGERVFVTAPTNAAVDNMVEKLSNGLDIVRVGNPARISSTVASKSLGELVKS---------------KLSNFVMEIERKKSDLRKDLRHC-------------------LKDDSLAAGIRQLLKQLGKTVKKKEKETVKEVLSSAQVVLATNTGAADPLIRRLDFDLVVIDEAGQAIEPSCWIPVLQEKRCILAGDQCQLAPVILSRKALGLGVSLLERAATLHGVLATKLTTQYRMNDAIASWASKEMYGGSLKSSSTVFSHLLVDSPFVMPTWI--------TQCPLLLLDTVGCEEHL--DPAGTGSFYNEGEADIVVQHVYSLIYAGVSPAAIAVQSPYVAQVKLLRDRLDEGIEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITRARKHVAVVCDSSTICHNPFLARLLRHIRYFGLV... 961
160 0.000e+00UniRef50_UPI0009012699 probable helicase MAGATAMA 3 isoform X3 n=1 Tax=Ipomoea nil TaxID=35883 RepID=UPI0009012699  ali  24  499.SVEEYVRVFEPLLFEECRAQLSSTLEEVTESGSHVKVYVKNV--------ERRERGWYDVILLPESEYKWTFKEGDVAVLSTPRPEEPEINGRVAGTVRRHIPIDKRDPPLQPRGTWFLTVLGSLATTQREYVALHAFRRLNSQMQNAILQPSSEHFPKYEEQTPAMPDFNTPQLAAIQWAADPWPFTLVQGPPGTGKTHTVWGMLYQHLCPKPRMLVCAPSNAATDELLARVLDRGFIDGEMKVYR--PDVARVLGWXXXXXXXXXXXXXXXXXXXXXLNIAAAAGRAQGSVGVDDVLMARDQNRDSLLQNLAAVVENRDKVLVEMSRLVILEGRFRVNMEEARANLEASFANEAEIVFTTVSSSGRKLFSRLTFDMVVIDEAAQASEVGVLPPLSLGARCVLVGDPQQLPATVIS-KAAGYSRSLFERFQQA-GCPTMLLSVQYRMHPQIRDFPSKYFYQGRLTDSESVVNLADEGYYKDP------------LLRPYIFYDITHGR---ESHRGGSVSYQNTHEAQFCLRLYEHLQKLGVGKVSVGIITPYKLQLKCLQREFAKDIYINTVDAFQGQERDVIIMSCVRASNHG-VGFVADIRRMNVALTRARRALWVMGNANALIQSEDWAALIADAKTRKCYMDM 1261
161 0.000e+00UniRef50_A0A165NCV7 Uncharacterized protein n=1 Tax=Neolentinus lepideus HHB14362 ss-1 TaxID=1314782 RepID=A0A165NCV7_9HOMO  ali  23 1125.DYGHYRTVFEPLLLFECWAQLVQSKQEPNQDNVA---------CRIVSRGFIDDWLDLDISITDNVKKDWVLTDTDIVVIRQPETKKC-ILGKTQSYKQATIRCYLPTPVTDPNSDWRLSKVFSLRTLHREYAALVALPFYDFFDVILRPRLLSKPHLDAQEIRQAQYKVNEPQAIAILSSLKNEGFTLIQGPPGTGKTSTICGLVQAFLTRRKKALLCAPSNAAVDEIAHRLKDGVKVVRVGNDKNVNISVKDITLDYLVEQMLNSGDSSGIKADTSDKXXXXXXXXXXXXXXXXXXXRDNAVRTLALEEEIRALNSRRMKLTQQFDRMKDQHKSDYRTMDATRRKCRSEIILEADVICGTLSSVGHDILEQCDFDMVIIDEAAQAIELSSLIPLKYTKRCVMVGGHLQ---------ASKYNQSLFVRLQKENPESVHLL-----------RLPSRLFYQGQLQDGPDMATKTSQPWHSHGK------------FGTYKFFSTVRGR----EEGGGYRSLINKAECQLAVSLYGRLRKEFSMVDRVGVVSMYRAQIAEMRRTFIQKVDFNTVDGFQGQEKDVIILSCVRAGPGQSIGFLSDTRRMNVALTRAKSSLFVLGHAPTLRSDANWRAIIEDAKSRSRL... 1788
162 0.000e+00UniRef50_H1VGZ4 Helicase SEN1 n=1 Tax=Colletotrichum higginsianum (strain IMI 349063) TaxID=759273 RepID=H1VGZ4_COLHI  ali  30  13..................................................................................................................................................................................................PGTAIKPKLVGQAGQ-NAMPKKLLVCAPSNAAVDELVLRLKQGVKTMN-GSFHKINVL------------RLGDTTQSKAKEERDKMHNQAAKIRDDLAELRPRLDAARAAGDQALQRDFDQLKRSQINIGAKIDEDKASGNTVSREAEIRRRQIQQEILDGAQVLCATLSGSGHEMFKNLNFETVIIDEAAQCVELSALIPLKYGCKCILVGDPKQLPPTVLSQSAAGYDQSLFVRMQQNHPDHVHLLDRQYRMHPEISLFPSTEFYEGKLVDGEDMSALRRQPWHASA------------LLGPYRFFDVEGTQ----SKGSKGRSLVNHAELRVAMQLYERFKADFGRRGKIGIITPYKAQLQELKEAITDDIEFNTTDAFQGRECEIIIFSCVRADPTGGIGFVKDIRRMNVGLTRAKSSLWILGDSRALVQGEFWNKLITNAKQRSLY... 456
163 0.000e+00UniRef50_M2XWI7 Endonuclease n=1 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2XWI7_GALSU  ali  28  50.....YASHFIPLLDMEMEAEQEQVKERLK-WSRQRLERQGLALFELNAQLDGALYGQGVAKLSYKKLPYHRLTQGDWVLCVRGK---ESIRGTLLERHSKYLRIVVGEE-WMAGKDWTVYQISNTVAFERSKNAVEELITMAQQSDHEISQIIVKSFAKEIIEDGNIQKLDELCRSRIQTAWKNALLTLIQGPPGTGKTKTLAKILASLVQLGRPILASAYTHIATDNILELERYNIPAIRIGKPANIHRNLWKYSLDSLLER-----------------------------------DTRIIEKRENLKKAMERL--AQPKRGKAIGLAHRDYSKSLGQLKQTEMIATKEILDKYPIVLSTCVGAGEEILKNISFQVVAIDEATQSHEPGLLIPIIKGCQLILAGDHYQLPPTILNPEAAGLSVSLFERLVRS-GVEPYLLRTQYRMHPSIAAFPSQYFYHGLLHSAPCTQSISN---YFPWP----------NPQTPIAFIPVLGEEWVTEQ----GTSYCNPQESQVVIETISQIVENWMTAQNIGIITPYAGQMRDIMDRMDREVEVKTVDGFQGREKDIIIISTVRSNPSQSLGFLQDWRRLNVAITRSRSGLIVIGNANTLSRNDHWKRWLEWISHHGCIYT. 711
164 0.000e+00UniRef50_M1AKA5 Uncharacterized protein n=5 Tax=Embryophyta TaxID=3193 RepID=M1AKA5_SOLTU  ali  26  16.SVEEYVKVFEPLLFEECRAQLYSTWEEMADTGTHVR----VHIKNI----ERRERGWYDVILFPDCEWKWLFKEGDVAVLSTPDGDEPEISGRVAGTVRRHIPIDTRDPKLQPRGIWFLTVLGSLATTQREYVALHAFRRLNLQMQNAILQPSPEHFPKYEEQTPAMPDFNEPQLAAIQWAADPWPFTLVQGPPGTGKTHTVWGMLYQHLCPKPRMLVCAPSNAATDELLARVLDRGFIDGEMKVYRPDVAVDSQTRAAQVERRTEQLLMKSRDEVYGWXXXXXXXXXXXXXXXXXXXLMARDQNRDTLLQNLAAVVENRDKILVEMSRLLILESRFRGNMEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTFDMVVIDEAAQASEVGVLPPLSLGARCVLVGDPQQLPATVIS-KAAGYSRSLFERFQQA-GCPTMLLSVQYRMHPQIRDFPSRYFYQGRLSDSESVVNLPDEVYYKEP------------LLKPYIFYDITHGR---ESHRGGSVSYQNTHEAQFCLRLYEHLQKLGVGKVTVGIITPYKLQLKCLQREFGKDIYINTVDAFQGQERDVIIMSCVRASGHG-VGFVADIRRMNVALTRARRALWVMGNANALVQSEDWAALIADAKTRKCYMDM 811
165 0.000e+00UniRef50_F9Z3T0 Putative helicase n=8 Tax=Bacteroidales TaxID=171549 RepID=F9Z3T0_ODOSD  ali  28  17............MLQKEYEYEKELYRQQTREAGIPKRIQQGVCWFPVKLRYNSLNQLTVEVTRTETEETEHSFEYGCPVCFFRISADRQIFSAVISYVQDNKMVVVLPGPQVLPTGELGVQLYFDDTSYKTMFAALREVAEAKGNRTARLREVGKAPALRRETGPVRFPWLNASQEKAVNQVLCAKEVAVVHGPPGTGKTTTLVEAVYETLHRENQVMVSAQSNTAVDWIAEKLDRGIPVLRIGNPTRVNDKMLAFTYERRFEAHSDYPELWQIRKTIREMTGRLRKSGR-----------------------------------EDRERLHNQLTKLRVRATGLEIRIDTELFTEARVIACTLVGAASRVLERKRFSSLFIDEAAQAIEAACWIAISRADRVILAGDHCQLPPTIKCIEAAGLGRTLLEKVVLHKPETVSLLKIQYRMHEDIMRFPSRWFYHDELEAAPEVKYR-----------------GILDFDTPVSWIDTS-ELDLQEKAVAEGTGRLNTGEAELLVRELKNYMERGIREEHIGVISPYRAQVHYLRHLLKKEITVHTVDGFQGQERDVIMISLVRANEKGQIGFLRDLRRMNVAITRARMKLLILGEAVTLTRHPFYRELYEYI......... 623
166 0.000e+00UniRef50_UPI00098D7D3C probable helicase MAGATAMA 3 n=3 Tax=50 kb inversion clade TaxID=2231393 RepID=UPI00098D7D3C  ali  25  373.DVDDYITTYEPLIFEEAKSQIIKEKEE----DEVTEWKLG------VVKSWSEADDFHFIEFPCEIKEGESISQNDLLLLSKDKILTVYAFALVEHVRKFFETFNMRSHICETERQLYFMKMCSLSTIAREYVAIRTISCLPYKDLILNAVPEEGWKIPIPLKEYVESTFNQYQREAITAGLSSKAFVLIQGPPGTGKTQTILGILSTILHATPTR-VHSKTYELRQGPQMPVEEKQRHWVLASPWLSGINPRDSLMPKDGDDGFFPTTGNELKPEAVTSSRKYRVREIVLRVLNGGVHDENDRAYCPKIVRIGLKAHHSIKAVSLDELMKQKRKQSNGPAGSNDDSIRAAILDEATIVFSTLSFSGSHVFSKLNFDVVIIDEAAQAVEPATLVPLANCKKVFLVGDPAQLPATVISDNAKGYGTSLFERLMQA-GYPVKVLKTQYRMHPEIRSFPSKEFYEDSLEDGEDVKLRTKRAWHDYRC------------FGPFCFFDI---HEGKEARPSGSGSWINSEEVDFVLFLYQKLITLYPTGNQVAIISPYSQQVKLFQKRFEETVDICTVDGCQGREKDIAIFSCVRASKDKGIGFVEDIRRMNVGITRAKSAILVVGSASTLRRSEQWNKLVESAEKRNCL... 1067
167 0.000e+00UniRef50_B8BQC9 Uncharacterized protein (Fragment) n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B8BQC9_THAPS  ali  36  14.........................................................................................................................................................................RLDYSQKEAVVMALSGSPINLIHGPPGTGKTTTVAELIRCAVNNKGWVLVTAPSNVAVDNVLGRLQRKIKAVRLGHPARIQNGIQKYSLESLVQSSEGTEIVRDCRSELNAHLRTLASAKS---------------------------------RPSEKRIAYREMKSLRKEIRTREEKVVGEILTLANVVLATNVGAAGSVFRRMEFDLVIIDEAAQALEASCWISLLRGKRAILAGDHNQLPPTIKSEVQYNLGRTLFERLMNAYDSDKTMLEVQYRMHEDVSNWASNAMYDGKLVSHESVRHRKLASLPQVEEQLKATNKDIAEDNVTLLLVDTTGCDMHEMTTDAG--SRYNEGEADIVVSHVHSLISLGLRAEDIAVITPYNGQVELLRKRLLTDIEIRSVDGFQGGEREAVVLSLVRSSEKGGIGFLRDERRLNVAVTRAKRHCAVICDCETVSQSSFIKGLIEWMEAKGDY... 491
168 0.000e+00UniRef50_A0A1V4J670 Putative helicase senataxin n=1 Tax=Patagioenas fasciata monilis TaxID=372326 RepID=A0A1V4J670_PATFA  ali  25 1002..YSDYFNTFFPLMMLNAFETLAQEWIENQ------RVRERSYYFCLQNFCADLNRADFTAHFQESDLKQLHPKEDDLIFLSEVENLIMSHVGLVTRFSRASGCLSRQQEHPFLNQQVKCVVVGSLVTTHRMFKGLLLLNRSPL--AKPIINPSYNDFCPRDLLVASMNEYNEDQKRAIETAYAMPKICLIHGPPGTGKSKTIVGLLSRVLKKPNRFLVCAPSNAAVDELMKKICGDIRLVRLGAEKAINSEVRRFSLDKQVEHR--------MKRRPADCDWDIQKRKAALDQELDRLSRQRARDRCEKRESH-MLADEISRLAKERQQLASQIK----EVRGHSQKVQADIILEADIICCTLSTSGGGLLESDPFSCVIVDEAGQSCEVETLIPLIHCNKLVLVGDPRQLPPTVKSVKAQGYDQSLMARLHQHLEQPVVQLTVQYRMHPDICLFPSSYVYGRTLKTDKATEENRCS---------------SEWPFQPYLIFDVGDG-----REERDNDSFSNPQEVKLVMELIRTIKEKDLGLRRIGIITPYSAQKKKIQEQLD-RVEVDTVDAFQGREKDCIIVTCVRANSKGSIGFLASLQRLNVTITRARYSLFILGRLKTLMENKDWNELIQDAHRRGAII.. 1709
169 0.000e+00UniRef50_M5E441 Similar to S.cerevisiae protein SEN1 (Presumed helicase and subunit of the Nrd1 complex (Nrd1p-Nab3p-Sen1p)) n=1 Tax=Malassezia sympo  ali  24  920.NADAYMERFGTLLSLEAWAQFQQSCEQRKEVPS----------VDVHYVRQRRVDSFVQLELITTGTVPTGFSDTDVVCLELPE-RAFEAVAVVCRTDARVLDLELRCAHAKVQSGWRLRKLLTLTTLRREYAALGSVPDLLLAQDLLQARVAPRPEVSDADRAAHTYALNAPQAQAVVAAMRTNGFSLIQGPPGTGKTKTIRALVASHLVRQRPILLCAPSNAAIDELVARLKDGPRLVRLGREDAVHPSVQDVTLDALARGTETGRPIGDVQAEQRRVEAQVQAARQQLAAGITG------AQXXXXXXXXXXXXXXXXXXXXXXXXXXXXQRRSLQRTDAGLSLTRKQVLDDAEVVCATLASAGHESLYAYTFDTVVIDEAAQAVELSALIPLRYCRRCILVGDPKQLPPTVISTEARGYAQSLFVRLYEAASDRVHLLSIQYRMHPSISQFPSAAFYGRHLRDGPGMAEATAQPWHAAP------------LFGPFRFLDVRGTESM-----GRGHSLQNTAEARAAMQAYEALVAGQSLAGRVAFISMYKAQVELLRSLFADHADFRSVDGFQGQEKDIIFLSCVRSNSDGTMGFLGDQRRLNVALTRARSNLIVLGHASHLCHDPVWRRLITEARTLQCCIE. 1583
170 0.000e+00UniRef50_A0A2E8WWF8 Uncharacterized protein n=4 Tax=unclassified Crocinitomicaceae TaxID=1986672 RepID=A0A2E8WWF8_9FLAO  ali  30  12.........WTQALLVERDEERARLQXVLEHASLKQRRAEGLSWSPVAVTAASYAFGGAQWSLACGEGGPNAFRVGSAVLLSPGDNEASKALGVVRKMRGLDMEVVLEGDGPEGVSKWTVDARADERSYNAMAHALSHWVNAEADSDKAFRDLALPEPHADDALVGDPSGLNEGQRRAAQDIWRRPQVSLLHGPPGTGKTSTLVAAVKDLVAAGDKVLAAGPSNMAVDVLVERFHQGLNVVRVGHPMRVQPAVLETTLDARVQNLPEHARVVKTWRDAAQHQRDADRYVRNFDAAQREAXXXXXXXXXXXXXXXXXXXXXLA----------------------------EKVLREADVVCATLVGCDDRRLXGVKFDVVVVDEAAQALPPATLIPMRRATRLVLSGDPCQLPPTVKSQGARVLETTMMERLVKRHPDQTHLLQVQHRMHEAIMAFGNLRFYGGQLQAHPDVGGRTLEGL------------------KPWVVVDTAGCG-FDEVRSEEGGSVSNPDEASFVLDRAAEWLNLHP-GMSLGIVAPYAAQVETLREGWSERVTIHTVDGFQGQERDAILVSLTRSNDKGEVGFLSESRRIHVAQTRAKMACMLVGDSATLSTDAFLADLFECAQAHDAY... 630
171 0.000e+00UniRef50_H2CK94 AAA ATPase n=3 Tax=Spirochaetes TaxID=203691 RepID=H2CK94_9LEPT  ali  33  9...EELQAVLSALLDEE-KAERAEHADLMKGLSLAQKKAEGLAVYPLRFQEIIYRGGRWKLRFEHDPL-SHRITEGAPVKLFRDDEVTD---GIAVRISSAAIDVVVDDYPDWEEGKIRLEASFPDLTWREMRFALQQMLEAEDQKRDRLLGYTELSALTLESEPHRSNELNASQDEAVTGILNTPDFAVVHGPPGTGKTTTLVAAIAALYRREESVLVCAATNAAVDLLALKLDQGIPVLRIGHPARVYDAAQALTLEGRMESRSEAKLLAKYRAEAAQLFRQARRFRRSFG----------------------------AAERAERESLFAEYRALQKTIREMEKTALGDIIERTPVVCATLTGASHPSIREKRFTTVVIDEATQALEPACYIPLLKPERIIMAGDHQQLAPLIR-LPASPLSETLFAKMIERHKDRVFFLNEQYRMQPVILGFSNQRFYEGRLVTHDSVLNR---------PPMRMKPEAEVSLTGSLLFVDTAG-SDATEEQDADSESRFNRFEAMLLVRIVERMLRLGDDPESVALIAPYRAQVDLLRSLCSQAIEVDTVDSFQGAERDWIGVSFTRNNEEAEIGFLKDLRRTNVAMTRARRRLILVGDSTTLSMHPFYADLIAYAQSESSYFS. 634
172 0.000e+00UniRef50_F4P174 Uncharacterized protein n=3 Tax=Batrachochytrium TaxID=100474 RepID=F4P174_BATDJ  ali  25 1141....DYINCFEPLLFLECWQQFVQARDELHNSDS----------IVILIHSVQMVDDMHDITLQPSDMKLQQLSENTILLLTMPES-NITLLACIRSMKDNDVYVVCQTFHLKPKSKWDATLVFSLTTFMREYRTLIAINSIPLSKEILQPAQTKQLAPNKARVDEYQQNLNFPQANAIAAAIEKSGFVLIQGPPGTGKTKTILGLIGALQCTATVILCCAPSNAAIDEIARRLIDKPKIVRVGTTA-IHADIKSVTLDYLVEERLKTDIYQKADSKIHDAGTNRSDIFKEMAQLKSERDNLRAFEDQPIEISGKTPTPSTTKLREIGARMAALAKLLDNEAERAKRNIRAKILAEADVVLATLSGAGHNQFSEAKFHTVIVDEACQAVELSCLIPLCYGQKCIMVGDPNQLPPTILSQVAQDYDQSLFQRLMKSCKDSIHLLSIQYRMHPHISLFPSLNFYNSALKDAPGLNTICSAPWHSH------------RLFPPYLLLNAVSGQ----EQFGSRKSLFNHEEASLCVGLVKTICTNFPDIKRIGIITFYKLQARKLRDMFVKHVDINTVDGFQGQEKDIILLSCVRASTDRSVGFISDTRRMNVALTRAKHSLIIIGNSHSLKTDPVWKNLVNNAKQRSL.... 1844
173 0.000e+00UniRef50_A0A1E3QWK6 Uncharacterized protein n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QWK6_9ASCO  ali  31  15.........FLDALAHEKQADLTATHELLTSLAPKRLAGLGFAVLNLCVANLKTGMGKQLIELEPDMAYASSVKVGDIVRLDRLGNASAKVEGVILKMSARSITVAVEGDEDLMNERLWLVQITNSITYKRMEVILSKLRSMKCSLLYYIAPGASQHAESQANTVFFNAGLNESQRTAITFALCL-PLTIIHGPPGTGKTYTVIELIQQLVNQGEKVLVCGPSNVSVDTILERLNSTNRLIRIGHPGRLLPLNYQHSLDILVKSSDEGAILNDIRGDINKIVREI----------------------------------AKTKKFKLXXXXXXXXXXXXXXXXXXXXXFVDELIVSSDVVVSTLHGSGARELLSVYFDTLIIDEVSQALEPQCWIPLINHKKVVIAGDNKQLPPTVKTEDQKLLSRTIFDRLVGMYASDKKLLSIQYRMNEVIMEFSNQQLYHGKLTAGQSVKHHTLWDLKGEIPVEGIKDLVNEDPDDPFIWYDTQGGDFPERTDDDTGSSKYNEREAEVVLEHVAQLVTHGIPQTLIGVISPYNAQVAYLKSIVAEDVELSTIDGFQGREKEAVVISLVRSNDKHEVGFLKDERRLNVALTRARRQLCVVGDMECLSRNAFLKALVEYAEEHAEV... 717
174 0.000e+00UniRef50_A0A1D6I7I9 p-loop containing nucleoside triphosphate hydrolase superfamily protein n=2 Tax=Panicoideae TaxID=147369 RepID=A0A1D6I7I9_MAIZE :  ali  24  582.SPAQYVEIFQPLVLEEFKAQLQNAYVETP--------PDDMMCGCVSILAVERVDDFLIVRARPEHSQSIKFRENDLVLLTKNQGQQVHVLGKVERRKNKALIFVMKFFLSSERSKWFLNRVMSMTPQIREFSALSSLHDIPVLPAILNPVSCAASHHNSGKVKALESSYNDSQLQALSIAIGNFDLSLIQGPPGDPKISQSAAVIRAWQDVKGRALVCAQSNAAVDELVSRLSEKPYIVRVGNAKTVHSNSLPFFIDTLVEQRLSDQLNSSLRSKLEKIVDRIRYYESRQKLIESDKSEDDEVSDEALGGKLNFLYAQKRVVSAELATAHAREKKIADENKFLKHKVRKSILGEAEIIVTTLSGCGGDIYEHALFDVVIIDEAAQALEPATLIPLQRGTKCIMVGDPKQLPATVMSGLASKYECSMFERLQRA-GYPVIMLTKQYRMHPEISRFPSLHFYENKLLDGVEVADKSASF-------------HFHECLGPYMFFDIADGREHCGR-NAATQSLCNDFEADAALEILSFLNNRYPTSRKIGIITPYRSQLSILRSKFTSEMEINTVDGFQGREVDILLLSTVRASNSRSIGFVADVRRMNVALTRARLSLWIVGNARTLRINSHWNSLVCDAEERNLFVSI 1364
175 0.000e+00UniRef50_A0A0V1FDP0 Regulator of nonsense transcripts 1 n=1 Tax=Trichinella pseudospiralis TaxID=6337 RepID=A0A0V1FDP0_TRIPS  ali  26  17.NAEHYREALGQLIFKEADY--------------ARQLKADCIQHNVTVRWSISPRRRRVAYFEFNKDTDVKLLPGDELILSNFNENDWKASGRVIQVPENELMKARDAPPPEVTDGYTVSFGWRSIQSDRMFTACVSSAIYCKILGHDYEEPPLNISCPTDYLVPGLDELNHSQIMAVREVL-TRSISLIQDIPGTGKTVTSASIVYHLAKAGGPILVCAPSNVAVDHLAEKINRGLKVIRMCAKSRIDSPVNFLALHNQVRNLEGQ--------------------------------------------------EELRKLWQLKENIGKLSTEDEKRFRLLRGKCERDLLKDADVICCTCVAAGESKLKDIKFRTVLIDESAQATEPECLIPIVTGRQVILVGDHCQLGPVVMCKEAAGLNQSLFERLL-ILGNRPIRLQVQYRMHPLLSLLPSNLFYEGTLQNGVTEQERTLERVDFRWP----------NPTVPMFFWCTAN----QEEISSSGTSFLNRAEASYIEKVATKFLRSGIRADQIGIITPYEGQRAYINSQLYEEIEVANVDAFQGREKDFILLSCVRSNKHSEIGFLNDPRRLNVALTRARYGLIIVGNPKVLSRQPMWHSLLKFCKENHCLFD. 645
176 0.000e+00UniRef50_G3J924 DNA-binding protein SMUBP-2 n=2 Tax=Cordyceps militaris TaxID=73501 RepID=G3J924_CORMM  ali  32 1096.....FASTQVALLERELQSEVQETSTLITNHSPARLQRAGLAITNLVVASQRTGLGRTVLELGPDELPEHGLRTGDIVLVADQPAEKKGARGVVTKVQKTSVFAALDDGKDEVGGKAWMVKLADEVTYRRMNLVMEKLQKMSSSFIQVLFGLSSPSPVPKDKIEWFDPTLNDSQKDAIRFALASREIALIHGPPGTGKTHTLIELILQLIKLKKRVLVCGPSNISVDNIVERLPHKVPILRLGHPARLLPSVVNHSLDVLTQTSEAGAIVKDVRAEMD----------------------------------AKQASIKKTKSGKERRQIYGDLRELRKEYRERERKCVSNLVGGSKVVLATLHGAGGHQLRSEKFDVVIIDEASQALEAQCWVPLLSANKAVCAGDHLQLPPTIKSPEAKTLETTLFDRLLALHGSIKRMLTTQYRMHEKIMRFPSDELYESKLVAAEAVKSRLLKELEYK-------IDDNEDTGEPLIFIDTQGGDFPERSEEDD---VENPKKAKLV--------EAGLKAEDIAVVTPYNAQLAVLKEKF-PGIELGSVDGFQGREKEAVIVSLVRSNTEGEVGFLGEKRRLN......................................... 1701
177 0.000e+00UniRef50_A0A0B2S3D4 Putative helicase n=26 Tax=Pentapetalae TaxID=1437201 RepID=A0A0B2S3D4_GLYSO  ali  24  72.DVDDYIATYEPLVFEEAKSQ----IIKEKEEEEVTEWKLG------VVKSWSEADDFHFIEFPCEINEGESISQNDLLLLSKEKFLTVYAFALVEHVRKFFETFNMRSHICETERQLYFMKLCSLSTIAREYLAVRTISCLPYKDLILNATEAEGWKIPIPLKEYVESTFNQYQREAITADLSSKAFVLIQGAPGTGKTQTILGILSTILHATPTRM-HSKTYELRQGPQLPIEEKQRHWALASPWLNGINPRDSLMPKDGNDGFFPTTGNELKPEAITSNRKYRVRVLVCAPSNSALDIVRIGLKAHHSIKAVSLDELMKQKRSSANKSSTNKQSNNGPAGSNDDSLRAAILDEATIVFSTLSFSGSHVFSKLNFDVVIIDEAAQAVEPATLVPLANCKKVFLVGDPAQLPATVISDVAKGYGTSLFERL-KQAGYPVKMLKTQYRMHPEIRSFPSREFYEDSLEDGDEVKSRTIRAWHDYRC------------FGPFCFFDI---HEGKEARPPGSGSWINVEEVDFVLFLYQKLISLYPSGNQVAIISPYSQQVKLFQKRFEETVDICTVDGCQGREKDIAIFSCVRASKDKGIGFVEDIRRMNVGITRAKSAVLVVGSASTLRRSEQWNKLVESAEKRNCLL.. 768
178 0.000e+00UniRef50_H0Z3X1 Senataxin n=3 Tax=Estrildinae TaxID=40155 RepID=H0Z3X1_TAEGU  ali  25 1743..YNDYFNTFFPLMMLNAFETLAQEWVENQKV-----REKGYCFY-LENFSADMNTAHFTAHLRESDLRQLHPKEDDLILLKVHKEHTVNHVGLVTRFSRCHLTVQTRGNLSFIHKQVKCVVVGSLVTTHRKFKAL--LLLSRSPLARPIINPSYNDFCPRDLLVAYKNEYNEDQKRAIETAYAMPKICLIHGPPGTGKSKTIVGLLSRVLRKPNRFLVCAPSNAAVDELMKKICGDIKLVRLGAEKSINNEVRGFSLDKQVEHR--------MKRKPGDCDQDIQKKKEALDQKLDMLSRERAMHRCEKREVSQMLNDEIGRLAKERQQLASQLK----EVRVHSQKVQADIILESDIICCTLSTSGGSLLESDPFSCVIVDEAGQSCEVETLIPLIHCNKLVLVGDPKQLPPTVKSIKAQGYDQSLMARLQRHLEEPVVQLTVQYRMHPDICLFPSNYVYGRTLKTAKAIEENRCS---------------SEWPFQPYLIFDVADG-----REERDNDSYSNPREVKLVMELIRTIKEKDLGLRRIGIITPYSAQKRKIQEQLDSVFEVDTVDAFQGREKDCIIVSCVRANSEGSIRFLSSLQRLNVTITRARFSLFILGRLQTLMEDKNWNHLIQDAQKRGAIIR. 2451
179 0.000e+00UniRef50_A0A2G5BHW1 P-loop containing nucleoside triphosphate hydrolase protein n=1 Tax=Coemansia reversa (strain ATCC 12441 / NRRL 1564) TaxID=76366  ali  32  37...................................ELESLGYALVRLKISNDKKVTGKAMLTLQPPQLPRSTLRSGEMVELSQGGGSKPLVTGVIQSITDSRITVAMDNVPKIWRNRCSIKVRTTDINQQRMLDAITKLKRSRPDLHRVLFGEAPPRFDNIASLDFFDNSLNAEQRCAVNLAVSAREIALIHGPPGTGKTHTLVEVVRQLVAQGKRLLVCGPSNVSVDNLAERVGKFRYIVRIGHPARIRKAMLTNSLNSRAQALEGPAIAK-----------------------------------QRKDLKLMMSAARMCRNPEEQTELYARAKIMRKTILKHTDRTKRSAVSGAKVVFSTLCGAGGKIDGIGKFDVVIIDESTQSLEGECWIAASKAPKLILAGDHHQLPPTLKSNAAAGTASTMFERVRSMFGDTVYMLTTQYRMHFDIMKVPSEYLYESQLVAHSSVTAHVLSDMSMVRKNV--------DTATPLVLIDTAGADIAESFEVRVNKSKINAGEAQLAIEHVARLISSGLSAKNIAIISPYSGQVRLLKLLCKPAVEIGSVDGFQGCEKEAVILSLVRSNENGEIGFLSEYRRINVAVTRARRHLCMIADSSTIDSNRFLGTLVNQFKAAGKV... 659
180 0.000e+00UniRef50_I1CCG1 Uncharacterized protein n=1 Tax=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) TaxID=246409 RepID=I1CCG  ali  23 1030.TFQDYKNTFEPLLVTEIWSQIQRAKESLSQSDVLEQ---------CIVAGRRHTNDFVDIMFNPMSLVTNYVSVDDLVCISNHDPSSLTEEGEVTKPWRERAFLGVLNSIS-PKTSWSILRIMSLTTAMREYAALEALEHYELGPEILNPAPTTIAKPGALIIQQYCKSYNPQAEAIAAAIQKRKGFSLIQGPPGTGKTKTILALIVSLLEQRHKSLVCAPSNAAVDEITKRLKEKPNVVRIGVSDSVNASVKDRILDRLIEAEMDANVGSDIGSRLDGIHNDIRNIQIGMDEVDREITQSDIVQMSILRGKRKALAQKLAKARIALRDAHQDQRNYGQEMEISRIRARQKVFTNADVVCATLSGSGHDMMTAMSFETVIVDEASQSVEISSLIPLKFTQRCILVGDPNQLPPTVMSTLAT---------------------NIQYRMHPEISDLPSRLFYQSRLQDGSEMDKISSAVWH------------ALPEFPPYCFYDVRDGQ----EKMGRGKSIFNVAEADAAVSLVDLLLTKLPTASKIGVITPYKQQVGQLKARFQKRIDFNTVDGFQGQEKEIIIFSCVRAGSGRGIGFLADMRRMNVGLTRAKCSLYVLGHANSLSRSEYWGDLVQDAKKRSL.... 1679
181 0.000e+00UniRef50_A0A2G5BIP1 P-loop containing nucleoside triphosphate hydrolase protein (Fragment) n=3 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A2G5BIP1  ali  27  3.......................................................................................................................................................................................REHGFTLIQGPPGTGKTKTILGLTGALLSQNNKLLICAPSNAAVDEIVKRLKSKPRVVRVGQSDHISSTVRDTTLDFLMEQALNANTTQALQRTLRAQLDEINVEIRELDSQMQRTDPSSTAALREMREKFHSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQRVRMQILQSTDILCCTLSGSGHDMLTSLKFDTVIIDEAAQSIELSCLIPLKYCNRCVLVGDPLQLPPTVFSQSAHGYNKSLFVRVQQNAPESVSLLSIQYRMHPEISALPSRLFYNSRLKDGPEMAAKQCAPWHR------------NERYPPFVFLNIQSGR----EQKGALHSVFNMQEVEAAVQLVFGLCQDYPKKQRIGVITPYKQQLRKLVEAFRKHIECNTVDGFQGQEKDIIIFSCVRAGEAG-VGFLADRRRMNVGLTRARKSLFVLGNAKMLGGSPLWKSLIDDANTRGLL... 495
182 0.000e+00UniRef50_A0A0U9HJB6 P-loop containing nucleoside triphosphate hydrolases superfamily protein n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A0U9HJ  ali  22  64.SVAEYVAVYEPLLLEECRAQILRGQDEAGRAAAHRARIA----------HCEAVNQFTFIKLQVDEQVASDMAENNLVLLCRENPLTSHALATVEG-TEGKQALRLRLHLPEPGSLWWVLQLCNLSTITREYTALHSAAALPFLDVILSAKAPAPDSIPEALRGHLAGSHNESQLAAVQAGLSRSPVVLIQGPPGTGKTQTILGLLSVVLHASPLAQQAGAAAQLVAREPISEQQKQAAWRAAAPWMHGGNPRDAELPLDGDDGSGYKASGQVRRHRAKVLVAAPSNAALDEIVLRLLAAGLRDAAGDPYSPSILNAHHSVAAVTMDAIVTQRMASMARSTGMERDRIRTAILDEAAIVCSTLSFSGSGAFGRMPFDVVIIDEAAQAVEPSTLVALTHGCRLFLVGDPVQLPATVLSSTAYGYATSLFSRLQRA-GYPVVMLRTQYRMHPAIRRFPSAQFYAGQLVDGDSVAKQTARPWHAHAC------------FGPFAFLDVAG----EEEQAEGSGSYVNKAEVELALMLYRNLAARFPDFKQVAVISPYKHQVMLARERFKRSIDINTIDGFQGREKDVAIFSAVRADRKRGIGFVADFRRMNVGITRARASMLVVGCAAALKRDKHWAALIKHAAATGCF... 750
183 0.000e+00UniRef50_Q6FVZ1 Uncharacterized protein n=9 Tax=Opisthokonta TaxID=33154 RepID=Q6FVZ1_CANGA  ali  24  233.DAYEYQRSYGPLIKLEADYDKQ--------------LKESQALEHISVEWSLALNNRHLASFALSTFESSELKVGDEMILSYSQGEDWKGTGFIVRLPNSELRPSKTPPPTHLTTGFTAEFIWKATSYDRMQTALKNFAVDKKSISGYLYYKILGHQVVDLHFDVPMPK----------------ELSL----PGYTKLNASQSKAVEHVLQRPLSLIQGPPGTGKTVTSASIVYHLSKIRKDRILVCAPS-------NIAVDHLAAKLRDLGLKVVRVTAKSREDVESSVSSLALHNLVAKGAKGVLKKLLKLK------------EEAGELSARDTKRFISLVKKTEKSILEQADVVCCTCVGAGDRRL-DMKFRTVLIDESTQASEPECLIPIVKGKQVILVGDHQQLGPVILERKAAGLKQSLFERLI-SLGHIPIRLEVQYRMNPFLSEFPSNMFYEGSLQNGVTEEQRTLANSTFPWPINGI----------PMMFW----ANYGSEEMSANGTSYLNRTEAMNCERIITRLFRDGVKPEQIGVITPYEGQRAYLDKELYSNVEVASVDAFQGREKDFIILSCVRANEQQMIGFLRDPRRLNVGLTRAKYGLIILGNPRSLSRNTLWNHLLLHFRQKGCLVE. 835
184 0.000e+00UniRef50_D8SVW3 Uncharacterized protein n=7 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8SVW3_SELML  ali  24 1311.NAEQYMEVFRPLLIEEFRAQLHRARDEF---NADDTEKVGM----VHLMSLERVDNLHVARFKSEAGKSSACTENDLLLISKKPPGSVHLLGKVDRRDKDVFSAKLFLPPNNERSTWHITRLMNITPQVREFQAVSALSSSPLLESILSPHSGRPVPLPEKLWRKLKEDYNESQLSAIKASLGDSEISLIQGPPGTGKTRTIVAIVSALLHSRERVLVCAQSNAAVDELVGRLRERPKLVRTGNARLVHPDSVPVFIDTLIKEDADTSQEDSXXXXXXXXXXXXXXXXXXXXXKSEGVHDDSLMAKXXXXXXXXXXXXXXXXXXXXXFEISKERRR----------KLKNQNIRDADIVLTTLGGCGGDVYAELFFDAVVIDEAGQALEPASLIPLQFHGRCVLVGDPKQLPATVLSQAASSYERSMFERFQKN-GYPVTMLSTQYRMHPDIRKFPSSYFYNNQLVDGASVLG-----------DKRRSSFHKDRFFRPYTFFDVIDGQ-----ERAGGSSVGNVDEVDVAVKLYERFQAKYPQPGRIGVITPYKQQLNMLKRAFQEKIEFNTIDGFQGREVDILILSTVRSLEPKGIGFVADIRRMNVALTRPRFSLWIIGSARALRSNRAWAALLEDATSRGAVYPI 2034
185 0.000e+00UniRef50_UPI000C1D163D helicase sen1-like n=4 Tax=Pentapetalae TaxID=1437201 RepID=UPI000C1D163D  ali  26  460.SVEEYVRVFEPLLFEECRAQLFSTWEES--------IETFSGHVRVSIKSERRERGWFDVILLPPHEYKWTFKEGDVAVLSSPKPDSPEVNGRVAGTVRRHIPIDTREHPLQPGGIWYLTVLGSLATTQREYVALHAFRRLSLQMQNAILQPSPEQFPKYEEQPPAMPEFNGPQLGAIQWAADPWPFTLVQGPPGTGKTHTVWGMLYQHLCPKPRMLVCAPSNAATDELLSRVLDRGFIDGEMKVYRPDVAVDSQTRAAQVERRTEQLLMKSRDEWMHSLRVRETQLSQQISCLQRELLIARDQNRDTLLQNLAAVVENRDKILVEMSRLFILESRFRSNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTFDMVVIDEAAQASEVAVLPPLSLGARCVLVGDPQQLPATVIS-KAAGYSRSLFERFQQA-GCPTMLLSVQYRMHPQIRDFPSSYFYQGRLTDSESVANLPDEIYYKDP------------LLRPYIFYDITHGR---ESHRGGSVSFQNTQEAQFCLRIYEHLQKSGVGKVSVGIITPYKLQLKCLQREFKKDIYINTVDAFQGQERDVIIMSCVRASSHG-VGFVADIRRMNVALTRARRALWVMGNANALIQSDDWAALIADAKARKCYMDM 1257
186 0.000e+00UniRef50_C7G036 Uncharacterized protein n=1 Tax=Dictyostelium discoideum TaxID=44689 RepID=C7G036_DICDI  ali  27 1166.DLKHYIDIFQPLLIEEFRAQVIRNLDE------------GVNFQDVTVDNFIQENGFIDVDFELPP-KENDILLDDFVLVIQPDPNLFSAFGKVERKDRFIIKVRFYKASSSTGNIWNIQKVTSLSTISREYMALHMVGKIPLGTSIISPHLYINSNDPDKLFQKLRSSLNESQLSAIASTLKNGGFSLLQGPPGTGKTKTILSLLSVFSHSDPKILVCAPSNAAVDEIALRIKKKPVICRIGNQSHIHPSVQDISVESLIKNSAIANEDQKKENTRLKIIKIKEKQVEIDKQIKDLAERLKQQEDNKLRNEITKLNYTREKYNNDLKLAKDEERRFHEQYSNTKRNLYINIIGRSQIILSTLSGSGYDYLATKNFDLVIVDEAAQAVELSTLIPLRHVKKCILVGDPQQLPPTTISKVATKYEISLFQRLMN-CGMAPTVLKTQYRMHPMISKFPSKIFYRGELEDGKNVRE-----------YKQDYYNDSASRFGPLVFYD---LFDKHGEVRSSFFSLRNPTEVKLAKLIVDQLISNYPNTKDIGVITPYKSQSVDLFNAFKQNVEVSTIDGFQGKEKDFVIFSSVRAHSGHSIGFLSDIRRMNVGLTRAKYSMVILGNSSLLSNNDDWGNLVNDLRQNNCYFPI 1873
187 0.000e+00UniRef50_A0A2K6SNB1 Immunoglobulin mu binding protein 2 n=11 Tax=Eutheria TaxID=9347 RepID=A0A2K6SNB1_SAIBB  ali  30  6..VESFVAKQLELLELERDAEVEERRSWQENISLKELQSRGVCLLKLQVSSQRTGLGRLLVTLEPRRLPSNSFTSGDIVGLYDANEGSQLATGILTRVTQKSVTVAFDESHDFQLSSYRLLKLANDVTYKRLRKALTALKKYHSSLIEVLFGRSAPSPASEIPLTFFNTCLDASQKEAVSFALSQKELAIIHGPPGTGKTTTVVEIILQAVKQGLKVLCCAPSNVAVDNLVERLLCKQRILRLGHPARLLESIQQHSLDAVLARSDSAQIVADIRKDIDQVFVGTKKKKKPTFFSLSLRGCGRWEAALLPEGHFGMVV-------------------IDECAQALEASCWIPLLQAGKCILA----GDHKQLP----PTVI------------------SHRAALAG----------------LSLSLMERLADEYGERVVRLTVQYRMHQAIMRWASEAMYLRQLTAHPSVAGHLLRDLPGVA--------ATEETGVPLLLVDTAGCGLF-ELEEEDEQSKGNPGEVRLVSLHIQALVDAGVPARDIAVVSPYNLQVDLLRQSLYPELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEV... 603
188 0.000e+00UniRef50_S8F0E9 RNA helicase (UPF2 interacting domain) protein n=15 Tax=Sarcocystidae TaxID=5809 RepID=S8F0E9_TOXGM  ali  28  471....DYQRTFAPLVQAEAD--------------FDKQIKDGQKLVRVKLRWEQGLNRRRLAYFMYSRDEGCNVRVGDEVKISTVLPKSWSCTGSITRFSEDSEEVIVEKKPPNAKGAWTIEFVWKSTSFERMQAALRQLYLYHTLMGKQMEHQIIQTPMPLQISAPNLAPLNPSQMLAIRYALQH-PLSLIQGPPGTGKTLTCSTLVYQMVKLSEQVLVVAPSNVAVDQLAERINRGLKVIRMYSKSRESSSLTSFCVENLALHKKVLELKTGSSDEMAKYIQLKEQTGELAAADE-------------------------------------------RRLRLLISRAEMEILQTADVICTTCVGAGDNRLQGFRFRQVVIDEAAQATEPECLIPIVLGKQVVLIGDHCQLGPVVLSKKAAGLATSLFSRLL-ALGHRPLRLKVQYRMHPALSFFPSYFFYEGELQNGVTMTERTY-----FHQGPGDHRFPWPNEERPMFFYH----STASEEISGSGTSYVNRVEASNIEKIVTFLLKCGLKASQIGVITPYDGQRAHISSLFQRDLEVASVDAFQGREKDFILLSCVRSNSNTGIGFLADSRRLNVAMTRAKYGLIICGNATVLAN.................... 1131
189 0.000e+00UniRef50_R9ADU1 Helicase sen1 n=2 Tax=Wallemia TaxID=148959 RepID=R9ADU1_WALI9  ali  26 1096.NYTHYWDIMRPLLFEETSEQLKQARSAVQ-------VEETVTVY-VSAKTFVNDYAEVVLNVKCNAPSQYSLSENELVTLSKDDGIQPGAQAKVQSFKRRHQDLIVTVWLPLRRSKWKMQKFYSLSTLYREYGALKGLQYYGPVMNKILNPVIKDKLQLDSDKTMKMLEVNESQANAVLSALCTPAFSLIQGPPGTGKSKTILALVAQFLSMPPKILLCAPSNAAIDEVVNRLMKEVNVIRIGADSSMSVSAKERSLEELVDQRVNLDPTSASMDNGSMVGDYRDQLTQCKNSINEIRNTINQKQQNEEKEELRKLSDKRNEISTKLDKARDTQKSSAKARDASRRTHRRAVMMEADVVCSTLSGAGKGDLAELDFETVIIDEAAQAVEVSALIPFKYGKRPILIGDQHQLPPTVMSTEAKGYSRSLFVRLMETNKGCVHLLNEQYRMHPDISKLPSAVFYQGQLKDGLRMAEKTKAPWH------------DNALFGTYRFFD-----FAQGSERRVDNSYVNDGEADLVISLYERLKRQFGEEYRVAIIATYKQQVFNIKRKLRNKVDVNTVDGFQGQEKSVIILSTVRSSSGGPIGFLKDMRRMNVALTRAQSSLFIVGNADRLSYDETWKKIVGDAQGRNLL... 1809
190 0.000e+00UniRef50_A0A0S4KMH0 Uncharacterized protein n=1 Tax=Bodo saltans TaxID=75058 RepID=A0A0S4KMH0_BODSA  ali  30  97...................................................................................................KQHVSAALDDDEDETHSNITLRCVFKAVNFDRQRTALRTFVRDDKSVAAVLFHRLADIKLPDNLTVPGIPRLNTSQTEAVRAAL-TRPLTLIQGPPGTGKTSTSATLVYQMCTNDCQVLVCSPSNVAVDQLADRVEKGLNVIRLYAKSRISSTIDHLALHNQVRQFALSSPQHS---ELHKLFLLKEDQGDLSD-------------------------------------------KDRKRFLALVKEAETDLLENCDVVCCTCSGAGDQRLSKFSFRHVLIDESTQATEAEVLIPIVMGSQLILVGDHCQMGPVILNKPAAGYNRSLFERLIQ-LGQRPYRLEVQYRMHPALSEFSSNAFYEGTLQNGVTAEDRDASRL-FPWP----------NPNKPTFFYN----SIHPEEISASGTSFLNRTEAALAEKMATLLLRGGILPHSVGIITPYEGQRNFLVQYLYRHMEIASVDSFQGREKDFIILTCVRSNDQQGIGFLSDWRRLNVALTRARRGVMIIGNARVLSRHALWHDLLTHFQKNGSIVE. 618
191 0.000e+00UniRef50_A0A1D8N3N8 Uncharacterized protein n=1 Tax=Yarrowia lipolytica TaxID=4952 RepID=A0A1D8N3N8_YARLL  ali  26  40....EYVRIMEPLNLLECYASIRQVFAEFRDQ--EKARRFGGFRFKVQATKEGDDNEFTEICMTQQELEEHELFSSTLVVITVPGSGKAKCLGKISEIVWNKVWIRTRRADLREGSLWECCYLTNMATAERELLALLSIGDFALKNDILFGQCYSFPKGPDSEIQRLQDKLNRSQAQAVYGSLNTRGFSLIQGPPGTGKTSTIVSIIRELLESGSRPLFCAPSNAAVDELTKRLKKHYKILRIGRPENVHTEVAHLTLGGMISASSDQEATKKAECDLRPLEKEMDILYKSKDSLFNKLNLLFKSSGSTVQYSINSTKSKLTTVKKDIDGLRSQVMELRTKIWLLRNQIKT---NRAQRIA--------KILNRAMFSVA---PSGQCTEPSVLIPLQYCTKVILVGDPKQLPPTVLSTEAGNYDKSLFVRILKAHPDAMHILDTQYRMHPNISLFPRAFFYDNVLKDAPGMELKTARKWH------------STEHLPPYMFFNVEGKHKF-----GDNHSFCNTAEIQFANKLVSAVLKCVGAGEDIGIVSPYKQQVEKLRHHFEQRLEIQTVDSLQGREKDIIIMSCVRAHPTHTVGFLADVRRMNVAITRAKASLWIIGNADTLVSNEKWESLLRNANERNVYCE. 693
192 0.000e+00UniRef50_A0A232F8L5 Uncharacterized protein n=6 Tax=Hymenoptera TaxID=7399 RepID=A0A232F8L5_9HYME  ali  29  25......................QNFFKDLSPASLHHLERTGQALTKLSITNASKGPGRFQIDLERADGLEHGLCSGDLVICIRSKEKGQTIRAIVNEIGESTLSISTDYEDIQEEEIFTVVKTDSDFTYKSQTRALSFLEKKELHSSSCLSEDSIPKNTLDDQINFYNPNLAKDQKSAVEFALKRRYFAIIQGPPGTGKTTTLIEIIVQLQKFGKKVLICAPTNVAVDNLVIRLGQTEKPLRLGHPTRIAKEALKYSLDSYLERDDGFIILKDIKKSIKDLETNIGNSGTKYA--------------------------------------YKEVRELKKEYRKRLIRLTCDTLKKCSVILCTLNSASANYIPRDHFDVLIVDEASQAMEASTWIAIPNAPKLILAGDINQLPPVVMCQEATGLNISLMERAIKKLNDCYVRLTRQYRMNEKIMTWSSKKFYDDTLEADDLVKNHLLKHLPSV-------KQEDDLTTEAVVYIDTCGCECEEFNTGVENASKGNLGEAVIVDKVVTNLVKVGLSHKDIGVITPYALQVDFIRRSFAANVEVSTVDGFQGREKEVIILSLVRSNEDKELGFVTDFRRLNVAVTRARRSLIVIADSETMEKDDLIVSLLKHIEDNGLL... 642
193 0.000e+00UniRef50_A0A0L0D604 DNA-binding protein SMUBP-2 n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0D604_THETB  ali  33  5.............LEAEQGEEVAELSAAQARLSARALEARGVCLASLVAAESRTGMGGHTVVTLRPDLPPHSFTPGDVVTLVKSSKSKADRSGSESDRGDDALVVALDEAAEVLRGVVRLDKLANTVSFKRMFIALNRLSDPTRRRKPCWSPSREAAIASCGELPWVNATLNASQQEAVALALASQDVFLVHGPPGTGKTTTLVEIVHQILLRAPRILATAPSNVAVDNLALGLIAGVDVVRVGHPARLLPQVLNHCLDAKAAASDGAALVADIRAEMDANLRAVS----------------------------------KTRNRGEARKLYSENRALRKEAREREGRVVDYVVGRAQVVLATSQGADSRTLRSRHFDVVIIDEAAQALEASCWIPLLKGKRAILAGDHKQLPPTIKSSRKARLETTLFDRLMAMHGTAGHMLKVQYRMHAAVCEWASAAMYGGELEAHESVAAAVLADLPGVA--------ETETTLAPAVVVDSTGCDMW-EVADDDSGSKYNPGEAQAVAGMVDELLDAGLSPDTVGIITPYNAQVGHLRSVLADDVHIGTVDSFQGMEKEAIVLSLVRSNDNGELGFLAEQRRLNVAVTRARK----------LSKDPFIECLVNHLMDVGEY... 672
194 0.000e+00UniRef50_L2GT83 Uncharacterized protein n=1 Tax=Vavraia culicis (isolate floridensis) TaxID=948595 RepID=L2GT83_VAVCU  ali  28  166...QEYISIFTSLITAECEQEKH-NKERLTREKIFVR--------------FEHKNDRIFAHFSFCRDEMCRINIGDEVKIFV---HTSTLKGFICNYTEENIAEIVNTDVKYPDGEYRMEFPWRNVGYQRMKRALTSLKKKCQLIWKGKVKKRKSAHMHEIVVPDRMPPLNECQKIAIDAAL-NNHLTLVQGPPGTGKTITTAAIVYNLLKHKKKILVVAPSNIAVDNLTRRLKCGIDVLRIVSRNRLVSDLDDITLHKKVNREIERIADAKGRGDCVEGGEYDVEYDRNRGSDREYDRDKKRDGEYDRDKKRDREYDRDKKRDGDKNEDSEKLSKLMQRMNVKNKKTRYSFVKDARVITCTCVTAGQELFKRFKFPYVLIDEAVQATEPLTLVPLIYCRKLILVGDHKQLGPTILNKKAAGLRVSLFERLIR-LGVVPYLLTVQYRMHPVLCEWVSNTFYDGALVSA--------HYTHGAHARYGTGITAWFNLPMPTFFY----VSRGREELFISGTSYLNKAEAQQCLAIIRHLKMNGVRETEVGIITPYEGQRVLLSRLTAC--EVANVDAFQGREKAFIIISLVRSNSINDIGFVSDRRRMCVALTRAKHGLFIVGNPGTFCKNKMWKELIAYYQGKGVLVE. 820
195 0.000e+00UniRef50_A0A183W111 Uncharacterized protein n=1 Tax=Trichobilharzia regenti TaxID=157069 RepID=A0A183W111_TRIRE  ali  28  200....................................................................PELRIMHGDELIIHQFNSPNDLLVGVVIKVPDNSEEVGLEMKHPLDSATYRIEFKWKSTPFDRMKKAIVTVYIFYRLLGQELDDMVLKCNLPKRYSAPDLPELNHSQVFAVKTVLQ-RPLSLIQGPPGTGKTVTSASIVYHLSQIHQKVLVVAPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLCE------------------------KIDRTGLKVVRLCARSREALASPVSRLMLHIQAQNVKGHTELRKLQQLKDETGELSQDDDKRYQLLKNELERDILLAADVVCCTCVTAGDIRLERLSFHSVLIDESTQATEPECLIPLMVGCRVVLVGDHCQLGPVITCKKAAGLTQSLFERFV-LLGIRPIRLQVQYRMHPALSAFPSNVFYEGSLQNGVTAEDRCKR-IDFPWPNQ----------DRPMFFYCTSG----QEEISGNGVSYLNRTEAATVEKIVTKMLKIGVHPNTIGVITPYEGQRAYLAHKLYQEIEIASVDAFQGREKDYIILSCVRANENQGIGFLNDPRRLNVALTRARYGLIVVGNPKALCKVTF--SLLQ........... 758
196 0.000e+00UniRef50_A0A250XPW9 Uncharacterized protein n=1 Tax=Chlamydomonas eustigma TaxID=1157962 RepID=A0A250XPW9_9CHLO  ali  25  46.SVKEYKEVFEPLLLEECCAQILRGMEEGEVLSPHRA----------VVGAAEQRDDFLFVTLVVEAGCSEMYSNNDLVLISKDDPQQLHLIGFCESVKGSQRVKAMKAGLQSKGSTWYLLKLSNMSTITREWVALQHAHLCPFADILTTGKPRALHESRHLDIPPGMKDCNSSQMDALKAGLDGTPVVLIQGPPGTGKTRTILNLLSALKEEDHVRLWLKQSHWTQGKQDPREVIRPDADGGALPGRDCFGLLHTAAAVRVGKHSGPKAHVLVCAPSNSALDEIVIRTVKSG-LMDRAGNMYAPSIVRVGVNVHHSVKSRSLDAVVESRLGGD-KDGSNLSGPERDKMRIAVLDESTIVCSTLSFAGSSMFYRMKFDVVIIDEAAQAVEPSLLVPLVMGCKQVLVGDPVQLPATVISRRALDYDQSLFKRLQTA-GYPVKILNTQYRMHPKISRFPSKHFYGGQLLDGETVTTDTRQPYHNHPC------------FGPFAFYDVAG----KESSPTGSASIQNKAEAQMVLCIYRELLHRFPALRSVGVISPYKSQVKLLRDSFARLVDINTVDGFQGREKDIILFSCVRSLKKGSIGFVADERRINVGLTRARCSLIVIGNAKALQVNGNWAGLIYQAMTDKCMYR. 739
197 0.000e+00UniRef50_B0NUH7 Putative DNA helicase n=161 Tax=root TaxID=1 RepID=B0NUH7_BACSE  ali  30  36.............................ENMGVARKVKRGVCWYPASGRSYYNSLNQLVIEITHTEDIEHNFEFGRPVCFFRQSTDGKIFTATVSYADEARMVVIMPGMDIQSADNLGVQLYFDETSYRTMFEALEDVLRAKGNRLAELRDIGTVKTGFRELYPVRFPWLNSTQESAVNKVLCARDVAIVHGPPGTGKTTTLVEAIYETLHREPQVLVCAQSNMAVDWISEKLDRGVNVLRIGNPTRVNDKMLSFTYERRFENHPLYPELWSIRKELRLLGGKSRRGS-----------------------------------YDEREGIRNRMSRLRDRATTLEIQINSELFDSAHVIASTLVSSNHRLLNGRRFGTLFIDEAAQALEAACWIAIRKADRVVLAGDHCQLPPTIKCYEAAGLERTLMEKVVAGKPSAVSLLKVQYRMHEDIMRFSSDWFYGGELEAAPEIRHRGILDW-----------------DTPVTWLDTS-EMDFKEEFVGETFGRINKEEAGLLLKELEAYIQRRILEERIGLISPYKAQVQYLRGKIKGSITVNTVDGFQGQERDVIFISLVRANEEGQIGFLNDLRRMNVAITRARMKLVILGEAATLSHHAFYKKLLEYVRTIN..... 629
198 0.000e+00UniRef50_A0A2H3C6S0 P-loop containing nucleoside triphosphate hydrolase protein n=3 Tax=Armillaria TaxID=47424 RepID=A0A2H3C6S0_9AGAR  ali  30  197.TVHRYSEHFNGLLDAEIAAEEAVLHQRLSTWSTERLSEEGYCLTDMTAFWLEEKFGRRTATFTRGPLPENRFESGTQVLVSRIDPLTDEAKGSLISRTPLQLKVSFPDQVEFDNPEWRVDLGHSSLVHNRMREAINHLHFRDNQLIYSWAKRYMRPNPVVVEGDPVIDGLNATQVRAMAQMIAER-FSLVQGPPGTGKTKTIIELLKVHFETPQPILVCTYTNVAVDNLVEGFVAGVNPIRVAFGGKTRASLEPYTYEYKMQNHPLYSQAEKVSETXXXXXXXXXXXXXXXXXXXXXVNDGRTNLAQRLDGMLTAIAKR-----------EDRIQAKRAQWYALTQQMTKDVLGEADVICTTCLTAASRVLEATDFPVVFLDEASMSTEPASLVPLMKGSRHVLIGDHKQLPPVIVSQIAKQLDRSLFERLIVEGIVPSIMLDIQYRMHPAISAFPSLEFYGTSLLDG-TVDSGGNILSRLAPPNSQHLTKDGNGDRPSVVFLDHAG------EESSKDRSRVNWNEAHIVASVVEDLLLTNPEGDDIGIIAPYAAQISLLTRLFNKDIEIKTVDGFEGREKEIIIFSTVRNNAGGHIGFLADRGRLNVGLTRAKRGLFIVGSISTLRMGRAWRNFAQYLVKEGRV... 919
199 0.000e+00UniRef50_A0A1Y4CHP6 Uncharacterized protein n=4 Tax=Bacteroidales TaxID=171549 RepID=A0A1Y4CHP6_9BACT  ali  29  1MDSIAHLQRHRELLLEEYRHELAENEAEMGRMSLDLRLSKGLCWYPLELRSFYNSLNQYVLAVSRPAREDSRFEYGVPVKFFFIDKDGKSVFCTVSLVDGDTMLVAVPGESAVSRTGLGVQLSFDETTYRLMFAALDRVINDRLAGLREILLGAAPAVKRGSAVRGSFSWLNPSQEDAVNSILCSRDVAIVHGPPGTGKTTTLTEAVFETLFRENQVMVCAQSNAAVDWVCLKLIERIPVLRVGNPVRIDDKVMDCTFEKRFEDHPDYPLLWNVRRAARECSAALRSKNGNXXXXXXXXXXXXXXXXX------------------------------------XXXXITDNVFDSARVIACTLAGAASKVLFNRHYSTLFIDEAAQALEAASWIAINKADRVVFAGDHCQLPPTVKCLRAAGLGRTLMEVVAENKPECVSLLTMQYRMNETIMRFSSYFFYDNRLKAAPQISAR-----------------DTSSFGLPMLWIDTCDCG-FSEQHVSDGTGRVNRGEARFAVSVLKNYAQERIRSEHIGLISPYKAQVSCLRKSIRSSVSINTVDGFQGQERDVIIISLVRSNRNSNIGFLHELRRMNVAMTRARYKLVIIGDSRTMCAHPFYKALYNYIEKSGGLL.. 630
200 0.000e+00UniRef50_F0VCC0 Putative regulator of nonsense transcripts UPF1 n=2 Tax=Sarcocystidae TaxID=5809 RepID=F0VCC0_NEOCL  ali  28  387....DYQRTFAPLVQAEAD--------------FDKQMKDGQKLVRVKLRWEQGLNRRRLAYFMYARDEGCNVRVGDEVKISTMLPKEWSCTGSITRFSEDSEEVIVEKKPPNVKGAWTIEFVWKSTSFERMQAALRQLYLYHTLMGKQMEHQIIQTPMPLQISAPNLAPLNPSQMLAIRYALQH-PLSLIQGPPGTGKTLTSSTLVYQMVKLSEMVLVVAPSNVAVDQLAERINRTGLKV-----IRMYSKSRE-----------------------GAASSLTSFCMEHLALHKKVLE------------LKTAGSDEMAKYLQLKEQTGELAAADERRLRLLISRAEMEILQTADVICTTCVGAGDNRLQGFRFRQVVIDEAAQATEPECLIPIVLGKQVVLIGDHCQLGPVVLSKKAAGLATSLFSRLL-ALGHRPLRLKVQYRMHPALSFFPSYFFYEGELQNGVTMTERTY-----FHRGPGEHRFPWPSEERPMFFYH----STASEEISGSGTSYVNRVEASNIEKIVTFLLKCGLKASQIGVITPYDGQRAHISSLFQRDLEVASVDAFQGREKDFILLSCVRSNSNTGIGFLADSRRLNVAMTRAKYGLIICGNASVLAN.................... 1048
201 0.000e+00UniRef50_A0A1R0GY31 Helicase sen1 n=1 Tax=Smittium mucronatum TaxID=133383 RepID=A0A1R0GY31_9FUNG  ali  25 1245.SVEEYHRIFEPLLLSECWAQFQRSIEETADLSTVLA----------TVMSRASVDKFGDITLMLNSSDASQWAENDMIMFASEKSQQNTLHAKVQSISFRKVVVRTNMNSVFVNSKWDALKLMSLVPIHREYAALASIKYLPSHLLDNILNPRIPPSPKDVNKIIKTYNVNKPQAEAILSSIDRVGFTLIQGPPGTGKTKTILALLSMLLNHNGKILVCAPSNAAVDEIVQRLKEGVYIVRIGQGENINSSVRDLSLDQLVEDQLLKASMNSQKLLRKQLDSINDEREKARLIEVSAIKNDESKVLLEIQKKISVLTRAKNTLSRQLNEKRNQSFQYSKNLDSVRRSVKNQIISKAQIICSTLSGSGHEILASMAFETVIIDEAAQSIELSSIIPLKYPKRVILVGDPNQLPPTVLSLDAAGYEQSLFVRLQQNCPNIVNLLSIQYRMHPEISSFPSKLFYENLLKDGDDMIDKKSAIWHDSKY------------FTPFHFF-----GVYSKETVGRGYSLFNLGEIDFICSLVFKLVSNNPTVNRIGIITPYKQQLRELKKSFARNIDFNTVDGFQGQEKDIIIFSTVRSNENG-IGFLNDLRRMNVAITRARNSLFIVADPRAMSSNEKWEMLLENSKLRGIYTD. 1994
202 0.000e+00UniRef50_A0A2G9PUE2 Uncharacterized protein (Fragment) n=16 Tax=Bilateria TaxID=33213 RepID=A0A2G9PUE2_LITCT  ali  34  5...........................................................................GDIVGVYSSSPSEPLATGIVSGVTQKVINIAFDESHSDSDNTYRLLKLANDVTYKRIKKALITLNQYHTGPATRIIDSEPSSAGLAGPVEFLNPSLDDSQKEAVVFSLNQREVAIIHGPPGTGKTTTVVEIILQAVKQGLKVLCCAPSNVAVDNLVERLAYKERILRLGHPARLLESLQHHSLDAMLARSDNSQIVADIRKDIDLTFAKI----------------------------------RKLPRKEEKGSFRTEIKALRKELKEREEAAMIETLKAANVILSTTTGASLKLLPDNYFDLVVIDECAQALEASCWIALLQARKCILAGDHKQLPPTIISHKAKGLSLSLMERLIDKYGDRVRMLTVQYRMNDSIMQWASQALYGGKLTAHSSVVHHLLKDLPGV--------TLTEETSIPLLLIDTAHCGLF-EMEVEDEQSKGNPGEVRLVDSHIQALTSAGLKARDIAVISPYNLQVDLLRQCLYPGLEIKSVDGFQGREKEAVILSFVRSNAKGQ.................................................... 506
203 0.000e+00UniRef50_A0A2P6V3C5 Regulator of nonsense transcripts 1-like protein n=1 Tax=Micractinium conductrix TaxID=554055 RepID=A0A2P6V3C5_9CHLO  ali  24 1014.DAYQYQNIFGPLIKLEADYDKQ--MKENQ-----VRE-------NVTVHWGVGLNKKTVARFYPKDSADLRLVIGDELRLRHPGSPPWAGIGFVARLDDASEEVAIELRPTDVSTGFVVEYVWKGTSYERMQRAMKAFFIYHKILGHQIEEQALKVTIPKKLSAPGLPELNHSQADAVQRVLQ------------------------QPLSLIQGPPGTGKTVTSATIVYQLARMGQGQVLVVAPSNIAVD----------------HLAERIAQTGLRVVRLQARSREAVATTVEHLTLHYQVENLGVPEALELKKLRLLKEELGELAAHDERK-----YKAVKRSLEREILQAADVVCATCVGAGDSRLLNFRFRRLLIDEATQAVEPETMIPLVMGKQLVLVGDHCQLGPVIINKAAAGLCQSLFERLM-LLGVKPIRLAVQYRMHPALSEFPSNTFYEGALQNGITVAERTRPQVVFPWP-----------TDKPAMFY----VQLGSEEISVSGTSYLNRTEAAAVEKVVTFLLKSGVTPSQIGIITPYEGQRAHLRQTLYAEIECASVDAFQGREKDYIILSCVRSNEHQGIGFLADPRRLNVALTRAKYGLIVLGNPKVLSKQGIWNGLLYHFKEGGCLVE. 1622
204 0.000e+00UniRef50_A0A1M7ZH36 DNA helicase, putative n=16 Tax=Cytophagales TaxID=768507 RepID=A0A1M7ZH36_9BACT  ali  33  20..................QEDLAQYKKKFLNTSLVAKKKEGITWYPVQVKKSKIGMGRLLVEIEKDHHQASSFQSGKSVSFFSNQEGYQSAEGVINTVKKDMMVVTLDELPEWEGSKLGVDLLFDEASYREMEFALKQVIKGDTPFKEILLGDQAPKFNSQDRIEKAN--LNFSQNQACQKISEAQNVAIIHGPPGTGKTTTLIQAILEAVEDRKSILVSAPSNAAVDLLVEKLDQGVSTLRLGHPARVEEKILNQTLDAKTVQHDSY----------------------------RDXXXXXXXXXXXXXXXXXXXXXFGKEERRQRQLLFDEVGRIREAARHLEEYISYDIFQKTQVFACTLVGASHFQLKEMTFDVVFIDEAAQGLEAATWIPILKAKKIVFAGDHLQLPPTIKSYEASGLAETLMEKVISRKPEAAELLQVQYRMKSEIMGFSNSYFYKGKLEAAPNTEDH-------------------FFENEPVLWIDTAGAGYTDRQEE-DSLSTFNPEEAAFACRYLEDLIKRGVNEWTIGLIAPYSAQVRYLRSLIFESITIDTVDGFQGQERDLMLISLTRSNERGEIGFLADERRMNVALTRAKRKLVLVGDSSTLAINPFFDSILQYFEETGRY... 633
205 0.000e+00UniRef50_A0A0C3AZR8 Uncharacterized protein n=1 Tax=Serendipita vermifera MAFF 305830 TaxID=933852 RepID=A0A0C3AZR8_9HOMO  ali  22 1108LSYRHYLDVMHPLFIVECWNSLIKSKEE----SIEKVQ------LVIAGKMHADFWVEVDVVIDQSVPKGWMLFETDIVLMEHAAGRKTLAKVHSARQTRQGITIRYSAELGDMDSSWMVSRVFNLSTAHREYAALMGMHHYDWADAVYKPHIGTPAVPTESQIAMVAHKLNHPQAKAVLSSLETTGFSLIQGPPGTGKTSTICGLVGVFMSTPRKVLVCAPSNAAIDEVARRLKDGPNVVRLGADASINVSVKDISLDQLVEELLSKTNSKNSEVASEXXXXXXXXXXXXXXXXXXXXXMQSSKTSSSRXXXXXXXXXXXXXXXXXLTAAQDMGREASRAVDSARRKARMDVLNGADVVCCTLSGSGHDVIEQFEFDLVIIDEAAQAIELSSLIPLKFSSRCIMVG-----------AVAADSDISLFVRLQISNPSHVHLLSIQYRMHPEISRLPSALFYDGKLTDGPGMQEKTAQPWHSNDKLGIFK------------FFDVSG----QEVQADMGHSQYNMAEVNVAAALYAKVRRDYPSVNRIGIISMYRAQLAKLRTEFSSKIDFNTVDGFQGQEKDIIILSCVRAGPNTSIGFLSDARRMNVAITRSRSSLFILGNASTLRSNQLWEQIVGNAQSRNLLVP. 1790
206 0.000e+00UniRef50_A0A1J5WL37 ATP-dependent helicase IGHMBP2 n=1 Tax=Amphiamblys sp. WSBS2006 TaxID=1866961 RepID=A0A1J5WL37_9MICR  ali  34  12.............VQEERKEAVSHKNTLLSGMSRKELKETGECIMGLFVSSVKTSSGNFIVVLTSEDIPNTEIKQGDDVTLSGENKET--VLGIVIKKEDAQIKIKTKEPPP--KGYITLVRSVNEEPFRRMEKALRELGKRNNEPRWMFSEKENPANSHTEKIKFYSECLNREQKEAVSSAVFSQDVYTIHGPPGTGKTSVIVEILKQLTRPQKKILVACSSNNAVDNILERFVSGVSSVRVGAEERMSSSAAEYSCGHYIERSEQTGLIKDIREEIEALLKRL----------------------------------EKGTGYAERRSIGTQLKELRREIKERGRKITDGLLSSTTVVFSTLSSCSKRILKDIEFDVVVADEASQSTEPESWIGLLKARRGILVGDHKQLPLTVVSLAAKGLEETLFSRIVNT--VAGTMLVRQYRMNRKIMEIASRLVYGGRLEADTSVHGHLLCDMAHVAR--------TELTQEALVLVDVDGQEASEERQS----SMYNESEVDAVAAYVSRLLDAGLLPSECAVIAPYRGQVAKLGDRLAREVEIGTVDGFQGREKEAVVVSLVRSNSTGSIGFLSDLRRANVALTRARRHCCLVCSVETVTRTRFYREVVCWFSENGAHYD. 615
207 0.000e+00UniRef50_UPI000523333D probable helicase senataxin n=1 Tax=Nestor notabilis TaxID=176057 RepID=UPI000523333D  ali  25 1540..YNDYFNTFFPLMMLNAFETLAQEWTENQ------RVREKSYYFNLQNFSADLNTADFTAHLQESDLKQLHPKEDDLIFLVVQKKKDANEVGLVTRFSRCHLSVRTRGNLSFVNKQVKCMVVGSLVTTHRTFKGLLLLSRSPLAKPIINPFCPRDLPVASESAAWNVNEYNEDQKRAIQTAYAMPKICLIHGPPGTGKSKTIVGLLSRVLRKPNRFLVCAPSNAAVDELMKKICGDIKLVRLGAERAINSEVRGFSLDKQVEHR--------MKRKPADCDQDIQKKKAALDQKLDMLSRQRAMHRCEKKEVSQMLDDEIGRLSKERQQLASQLK----EVRGHSQKVQADIILESDIICCTLSTSGGSLLESVPFSCVIVDEAGQSCEVETLIPLIHCNKLVLVGDPRQLPPTVKSVKAQGYDQSLMARLHRHLEEPVVQLTVQYRMHPDICLFPSNYVYGRTLKTDKATEENRCS---------------SEWPFQPYLIFDVGDGH-----EERDNDSFSNPQEVKLVMELIRTIKEKDLGLRRIGIITPYSAQKKKIQEQLDRVFEVDTVDAFQGREKDCIIVTCVRANSKGSIGFLASLQRLNVTITRARFSLFILGRLKTLMENKDWNELIQDAQKRGAII.. 2242
208 0.000e+00UniRef50_A0A2A5DSS5 IGHMBP2 family helicase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5DSS5_9BACT  ali  29  27......................RSMQTQIHELGATNAERKGLVLNKMIYTNFKIFFGKYLYSFEKSNIPHSKITSGSWVQVLDSQSVE-IMRAIVYSNKKNEINLVSNDFIDDRDGLFKIELCVDNVTYKRLEQGLNDLVKLVGNKSKNLLIP-MLKFDQKIFNDYKCNDLNEAQIDAVKHALSGAPLTLIHGPPGTGKTKTISAIIYNLVQNEKKVLVCAGTNTAVDHIVKNLIKYENAIRVGHPSRVDNELSFALLEKKLDQTESGKHISKIKKELHDC----------------------------LRTKKKRIDKGRFLERSEFRSEKELIKSLRKEIKHLSHKCLEELVIDKAVFCSTTTMSRSDDFNKLSFDYIVIDEAAQIIEPMSYLPMLKGTNFIFAGDHNQLPATIKSSKCKGLGKSLFESLVESFPQAVHLLNTQYRMHSDILKFSSDYFYGGLLKTADNIKDR----------QNITIKSSFLSGLKKAIFIDTSGA-DFEEETLYQSGSYINPKESSVVGKIIEELFDQGTEGVNIGVIAPYRAQANYIKDSLKEGVEVNTVDSFQGREKDCILISLTRCNDKKQIGFLKEVRRMNVAMTRAKHQLIIIGDGVTIGEHNFFTQMIQYFQEIGGYHSI 634
209 0.000e+00UniRef50_A0A167CSC4 Putative DNA/RNA helicase SEN1 n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167CSC4_9ASCO  ali  25 1252.SVEDYQSTFTPLLMLECWEGIQKVKEEN----------VGRVPFKIQVGKRVKCDDFYDVSVSMKEFQIIKLGESDLIVLSYHTNLEVKAL-----MPQHNVPHCYARIQQINLHQDYADLI--LRTYE-----------------------------PGKMIGYLSQNCVICGLKA-------------SSPPGTGKTKTILAIAGAYLPNTRRILVCAPSNAAVDELVLRFKSGPSVVRLGRSDAVNIQVRDVTLEELLDKMVEKNSDENGRQDDNSVREKQQAIIKERNELRRKIDNTQDISGEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXAARMREAQRRKFQDQILRDAQVICCTLSGSSHKVLSKMRFDTVIIDEAAQSVELSALIPLRYGCRCIMVGDPNQLPPTVLSQAASKYEQSLFVRMFEKFPERVYLLDTQFRMHPDISEFASREFYGGRLYNGDGMASLTARAWHSNPM------------LAPYKFFDVVGSQ----KKSIDTKSMYNTEEAEAAYALYEMLFKTCSEAGKVGIISPYKRQVKELRFVFRAHIDFNTIDGFQGQEKDVIILSCVRAQPDQGVGFLGDTRRMNVAITRAKSSMWILGNENNLVKNPVWKRLIGDARQRNMFVKL 1874
210 0.000e+00UniRef50_W1NHT0 Uncharacterized protein n=5 Tax=Embryophyta TaxID=3193 RepID=W1NHT0_AMBTC  ali  31  223..IDDFARHMSGLLRIERDSELEATQEELSLKPIEYLVSHGQTICNLYAVSCSTGLGMHLVLFRNHRLPPISLSPGDMVCVSRGAGATSCMQGFVDNLGEDSISVALESRHGDPGKNVRIDRIADALTYERNCEALMLLQKNGLHKRNPSIAVVATLFGTNEDISWMEQNFDKSQLRAIAVGLNKRPLLVIQGPPGTGKSGLLKELITLAVERGERVLVTAPTNAAVDNMVERLTNGLNIVRVGNPVRISPSVASKSLASIVN---------------DKLATFRKEQERKRADLRKDLRHC-------------------LKDDSLAAGIRQLLKQLGKALKKKEKETVKEVLSSAQVVLSTNTGAADPIIRRLDFDLVVIDEAGQAIEPSCWIPILQGKRTILAGDQCQLAPVILSRKALGLGVSLMERASKLHGILATRLTIQYRMNDKIASWASKEMYDGLLNSSPTVASHLLVDSPF--------IKATWITMCPLLLLDTRGCEEHL--DPAGTGSLYNEGEADIVVEHVFSLICSGVSPTAIAVQSPYVAQVQLLRERLDEGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITRARKHVAVVCDSSTICHNTFLARLLRHIRHYGRV... 899
211 0.000e+00UniRef50_A0A151Z933 Putative splicing endonuclease n=1 Tax=Tieghemostelium lacteum TaxID=361077 RepID=A0A151Z933_9MYCE  ali  26 1165.NLDEYIQIFEPLLLEEFKAQVYKSMEEQTYQPI-----------NVTVDDLMSESDFHICDFMIDANGSNELNE-DMVLISKSAGVKCEAFGKVEKRERSFLKIRLYKNHLKIESSWTIQKITSLSTLGREYIALHSVGRTPLGSAIISPNHIPPYTLPPSLKNALSNDLNEGQWNALNSSLTPRGFTLIQGPPGTGKTKTIMALLASYLAVFNKILVCAPSNAAVDEIASRIIRCPSIVRIGNLIHIDPEVQQISLDRLLERELKSHEQNKLMDIKKKQEENEKKREKYSLKIQELTKLRQTSDDETISHKLTKLYNKKNRVNNDLNYTKETERKAYESVENSKRNMVTNLLKKAQIILSTLSSSGHDTINNKKFDLVIIDEAAQAVELSNLIPLKHVQKCILVGDPNQLPPTTISKLSYQYEMSLFQRL-KNCRLPVLILKTQYRMHPAISRFPSQHFYEDQLINGPNVQQYKQKFYSDP-------------RFGPLAFYDITD----SSEDQHRSHSLRNVQESNLVCLLIRDLIQKYSEKMSIGVITPYKQQQKDIELRLKHHIEVNTIDGFQGREKDIIIFSCVRAHKGGSIGFLSDVRRMNVGLTRAKFSLIVIGHSNLLVQNPDWSKLINHIKKQNSYFPI 1859
212 0.000e+00UniRef50_A0A2P6VA64 Putative helicase MAGATAMA 3 n=1 Tax=Micractinium conductrix TaxID=554055 RepID=A0A2P6VA64_9CHLO  ali  25  44.TVDDYVRVFEPLLLEECAAQMLRGQEEGQ-----VLTSQPAVVAATQARQSGDDESQ-LVRLTLPPGVSSTFHDNDMLLLSRDNPEEEHALGVVEGHEDQSLRVRFRGSLAKVNSTWYVLKLSSMSTIMREWAALHCLAHMPLREVLLSARPSQKLEVPPQMAVAMRKTYNDSQMEAVTGGLDGSPVVLIQGPPGTGKTKTILGLLSIIMHSAPKGAFAAASPTAADAENLPSYVKYRRMSAERKRAVWLETRPYLLGVPDPREEVVPPEQADSSDAFGLLRRCRRIGASEGPKARVLVCAPSNSALDEIVLRLITVGLTDQDGRVFTSIHHSVQRLGGDAAKNVQRWERDRLREANIVCTTLSFSGSSAFTRRKFDVVVIDEAAQAVEPSTLVPLAHGKQVYLVGDPVQLPATVMSQRAQGYSESLFKRLQTA-GYPVHMLDTQYRMHPAIREFPSTNFYGGSLKDGPNIQADTQRPWHASPA------------FHPLVFIDVKGTETVPE----GSSSLVNEKEAEMVLQLYRELRHRGAKP-SVAVISPYKAQVSLLRRLFKKLVDINTIDGFQGREKDVAFFSTVRSQRTRGIGFVADERRINVGLTRARATLIVVGHVESLQTNPRWSALVSHARKSGCMY.. 757
213 0.000e+00UniRef50_A0A1Y1VMB4 Uncharacterized protein n=1 Tax=Piromyces finnis TaxID=1754191 RepID=A0A1Y1VMB4_9FUNG  ali  24 1264.SHEEYVKVFEPLILTECWAQFQKSKEDID-------IENDIIKLILEDRCSVDDFEEIKFSAKTEEIRGKSFSENDILYLRSDDGEKSKYTFFVITIKKNEAILSCRAYSLRKTSAWKTTKVFSCVTCNREYLAMKFMENSNLLKVILEPQDKESNKKIIESRLMEKYKLNESQAQSICGSVKSKDFTLIQGPPGTGKTKTILSLIAELLPKKIKILVCAPSNAGCDEIVRRLKRKPKLVRIG-TEAIHPDCKDVTLDALVDDLFSNDMKSNQSXXXXXXXXXXXXXXXXXXXXXEEDVIVNKHDDILQQEISLKIGELIRKRKEIRQALESTQVKSKQILEQARQHAKQKVLNDADIVLSTLGGSGHDILSNIEFEIVIVDEAAQAVELSSLIPLKYGTKVILVGDPNQLPPTVISLLAQNYEQSLFKRLQINNPDSVYLLNVQYRMHPHISKFPSKHFYNSKIVNSMNMEKLRFQPWHN------------DKRFRPYQIINVEG------RESSYGTSLINQSEVDSIITLVRSLCDMNPSATRIGIITPYNGQSKLLKRKFNSYIDINTIDGFQGQEKDIIIFSCVRAHPKGSIGFVADVRRMNVGITRARNSLFIVGHLSSLIKNEEWKSLIEDGKERKAI... 1942
214 0.000e+00UniRef50_A2Z2P9 Uncharacterized protein n=7 Tax=Oryza TaxID=4527 RepID=A2Z2P9_ORYSI  ali  26 1040....QYVEIFQPLVLEEFKAQLQNAYVETP--------AEDMNCGSISILSVERVDEFLVVRGRPDKLKSKNCMENDLILLSKDSGQQVHVLGKVDRRESDKIKFFLSNRLLVERSKWFLNRIMSMTPQVREFSALSSLNDIPVLPVILNPVSCKSIHNSHPMRKVLKSSYNDSQLEAVSIAIRSFDLSLIQGPPGTGKTRQDAALAKQLINDSQRVLVCAQSNAAVDELVSRLSEKPYIVRVGNAKTVHSNSVPFFIDTLVEQRLADELKKNLRANLEKIVDRIRYYKTENDSLVPSEYETDEVSDDAIGAKLNFLYAQKRKVSAELATAHAREKRIADENRFLKHKVRKSILGEAEIVVTTLSGCGGDIYEHALFDVVVIDEAAQALEPATLIPLQKGTKCIMVGDPKQLPATVMSGLASKYECSMFERLQRA-GYPVIMLTKQYRMHPEISRFPSLHFYENKLLDGAQAADKSAPF-------------HGHDCLGPYMFFDVADGREQCGK-NAATQSLCNQFEAEAALEILGFLKNRYPSEMKIGIITPYRSQLSLLRSRFNSEMEINTVDGFQGREVDILVLSTVRASNSRGIGFVADVRRMNVALTRARFSLWIVGNAKTLQTNSHWASLLQNAKERNLFIS. 1834
215 0.000e+00UniRef50_A0A0D7AXW1 p-loop containing nucleoside triphosphate hydrolase protein n=1 Tax=Cylindrobasidium torrendii FP15055 ss-10 TaxID=1314674 RepID=  ali  30  54.....YREHFLDMIEAERVEDEAIFRQRLSTWDTQRLVDEGYTLTDLSAFWQKSLNSRVTLSFQLGPLPENRFENGTQVLISRLDPLKEILRGSVVSSTNSHIRVGLDEAKVDVDGAWRLDVTGSNTSYDRMSLAVKTLGNRPSLGNTRNADQDLPGFSHERPSPPTLDTLNSTQRCAVALMLKER-FSLIQGPPGTGKTKTLVELLKQHFAVPYPILVCTYTNVAVDHLVEGMRGGLRPLRVASSGKSTPELAEYSIDTQLSRHPLAADTQKLE-------------ESSRAAQEAFLSYQTQIGLNPTARQQKTLNAKKNRSAVLDARLWSRRRDMAR-----------DVIKAADVICTTCISAGSPLLSIADFPLVFLDEASMSTEPSSLVPLVKGSRHVLIGDHKQLPPIITSPDAKGLGVSLFERLIEEGRVPSIMLDIQYRMHPSISAFPSLEFYDLGLQDG------------------IQGQEPLNGMHKSVVFIDHSGAESLRDR------SRVNWNEAHIIMSVLEELLASNPNGHDVGIIAPYVAQISLLTRLLNKHVEIKTVDGFEGREKEVIIFSTVRNNSHGNIGFLADRGRLNVGLTRAKRGLVVVGSIDTLRTGDSWKRYVEFCAREGLVV.. 754
216 0.000e+00UniRef50_A0A066V4I3 Uncharacterized protein (Fragment) n=1 Tax=Rhizoctonia solani AG-8 WAC10335 TaxID=1287689 RepID=A0A066V4I3_9HOMO  ali  25 1022.............................................................................MVVLDGPPVMSDRILAKITGFKRGSVTMRLSMAAEQRVKVQVQEKWTILSTINREYAALTTAEYYDLIDEVMSATSARPNPPLELRIQMRAHRLNEPQAKAISASLSTKGFSLIQGPPGTGKTSTICGLAGSFVKDKRRLLICAPSNAAIDEVTKRLADGVRVVRVGTESSMNVSVTAYSLDSLVDEKMAAMPKSTNTSTTDXXXXXXXXXXXXXXXXXXXXXLDNTQPRIALENEFRALKTQRTTITSKLDTARDQQKNAHRVLDAARRKFRHEVLTEADVICSTLSGAGHEVLEPFEFETVVIDEAAQAIEIATLIPLRYGCKCILVGDPQQLPPTVISQLASSLDQSLFVRLQKQNPQSVHLLSIQYRMHPTISTVPSRLFYHGRLQDGPDMDQRTKQVWH------------ASSLFGPYQFFDVAQGQ----EESQSNHSQINRGEADAAIALYSRLTREFKTTNRIGIVSMYRGQVMHMKNRFTKSIDFNTVDGFQGQEKDIIILSCVRAGTNQSIGFLADERRMNVALTRSRSSLFILGHAATLRCNATWKTDVED.......... 1620
217 0.000e+00UniRef50_I7MER3 DNA-binding protein smubp-2 n=1 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=I7MER3_TETTS  ali  34  53............................IKQSTCSDLEELGLAVNRLKLKSVKTGLGRTLVTFAHPKLPESKFQSGDNVSIYKQSDGNPLEKGVIFKKNDYKFVVAFDEEVNESNEVISIVMEVNEVTYNRFLKCLQNIEEKYSDPTNPNPNIKPVHILSKPIVDFYKKDLNEEQKDAINFCLSSQTIGLIHGPPGTGKTMTVCELIYQAVKMGLRVLACAGSNIAVDNMVERLAKTDLKVRIGHPARMLPTIYEQCLDNKL----------------------------------RKTTCXXXXXXXXXXXXXXXXXXXXXISYGEXXXXXXXXXXXXXXXXXXXXXSIKEVIQDTQVVCCTNSGAADYIFKKVEFDLVVIDECAQALELSCWIPILLGKRVVLAGDHKQLPPTIKS-KNQGLSVTLFDRVLKEFENVSRLLKVQYRMNQQIMEWSSQYVYGGQLKAHESVATHSIGGESI------------------LLFIDTAGGETINENANDKNKSKSNLGEADLVKIIFEELKLQGLQEKEVGVITPYNAQVDLIKKLFENNVEVSTVDGFQGREKECIIISMVRSNPLNQVGFLSDYRRMNVAVTRARKFVCLIGDSETVSSDKFLDEMVKYFQEHGEV... 675
218 0.000e+00UniRef50_W1Q9N7 DNA polymerase alpha-associated DNA helicase A n=7 Tax=Saccharomycetales TaxID=4892 RepID=W1Q9N7_OGAPD  ali  30  10.......SQFLECLAVERQESFDQTSELISRASPKNLSANGLAVLNLSVSNVRTGIGKQIVELVPHASIAGKFKTGDIVKLEDAEETSVQIDGVVVLVSERQINIALNYDLYNSDAKVWLVQVDNEITYNRMESTMRKLGELDSDTASELAFISPNLKYQKTKLNWFNGNLNDSQKNAVQFSLVSN-LSIIHGPPGTGKTSTIVELVKQLVLRKKRILICGPSNISIDTILERLNKYSRLVRIGHPARMLPQILRHSLD-LITESESGEILKDILQEINQLTRKI----------------------------------KKTKSYRERRELYQTIKELKKDLRLRSKKAYSDVLSNSEVVAATLHGSSAREIRGDLFDTIIIDEVSQALEPSCWIPLMYHKQLVIAGDNKQLSPTIKTKKNAKLSKTLFDRLIEVHKNHTCFLDIQYRMNKKIMSFFSDALYGGKLIAHSSVENIKLSDLPYVKSPQDDNVAEE------VIWYDTQGGDYPEADSAEDDSSRYNDGECLVVLKHVRSLVEHNVKQEDIGIISPYSAQVSSLRKLLREDIEISTVDGFQGREKEVIILSLVRSNDSHDVGFLNDYRRMNVSISRAKRQLCVVGDMETISESNFLKQWCEWCEEN...... 701
219 0.000e+00UniRef50_A0A2A5E3C1 Uncharacterized protein n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5E3C1_9BACT  ali  32  8.....YITQQKQCTKWEYEAEEQGLSEEMSQVDDWKSETKGLRFSALKIHSMNPGFGKYLIEFFKKRGLKYSFKSGSVVKVCDAKTGETICEGVVHTIELISLKVIVPDPIEILDDEYGIELRPNRVTFDRMMEGLSKVETMEVLPQILLGKTLQPSDYSETVTHTQSKRLNESQQKAVELACDGSPLTILHGPPGTGKTSTLLFIIGTYVQAGKSVLVAAGTNAAVDHVALGLKMGVPFVRVGNPERFHPELKEFTLENMASKAPSGQKVLSFKNELD----------------------------IEVRKKNNRMRKRKFIRSDEHRGDLDLIKSYRTEIKRLEGLCIGELHEMGYVFISTHTGAGHPSLKNLAFDLVVGEEAGQTLEPLMYLSMLKSKRYVFAGDHFQLPPVVTSDKAKGFEESLMEKLARLYPERVNMLQVQYRMHAQIQGFSSKYFYQNKLVCGPNISERKSP-----------LAFKKLGIDSRVVFIDTKNLHYY-EKKTGETGGLNNFKEAQILTECCDRLLDAGIESDHIGVIAPYRGQVKALKKLLPEEVEVSTVDSYQGREKEIILISLTRSNTERIIGFLSEIRRMNVAITRAKQFLWVVGDSETISVDPFFKEFIEYVKS....... 617
220 0.000e+00UniRef50_A0A0P5XSU6 Regulator of nonsense transcripts n=1 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5XSU6_9CRUS  ali  25  280...YQYQNIFGPLVKLEADYD--------------RRVKEAQTQDNVHVRWDVGLNKKTVAYFSLQKDSDMKLMHGEEVGISNGAPTECSTNFVVDFVWKST---SFDRMQSALRKFAVDESSVSAYIYHRLLGHEVEDVVFRLHLPKHFSAPDLPELNPKHFSAPDLPELNRSQVFAVKQAVQ-RPLTLIQGPPGTGKTVTSATIVYHLAKLGSPVLVCAPSNIAVDQLTEKIHRTGLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDQLTEKIHRTGLKVVRLCAKSREAIDSPVSFLALHNQVRCLEGASELRKLVQLKEEVGELSQGDEKRYRMLKRQAERELLEAADVLACTCVGAGDVRLARIKFASILIDESMQATEPECMVPVVLGRQLILVGDHCQLGPVVMCKPAAGLSQSLFERLV-VLGIRPFRLEVQYRMHPRLSEFPSNFFYEGSLQNGVCAEDRILRGVDFPWPM----------PDRPMFFYVTLG----QEEIAGSGTSYLNRTEASNVEKIATRFLRSGVKPEQIGIITPYEGQRAYLVQKLYQDIEIASVDAFQGREKDIIIMSCVRSNENQGIGFLNDPRRLNVAMTRARYGIIIVGNPKVLAKQPVWNHLLHFYKENHVLTE. 1004
221 0.000e+00UniRef50_A0A2T9ZDP7 Uncharacterized protein n=1 Tax=Smittium megazygosporum TaxID=133381 RepID=A0A2T9ZDP7_9FUNG  ali  26 1322.SVEEYTKIFEPMLISECWAQLQRSIEDTLDSST----------LSVKVDSRVSIDGFSDITFVMSSLDSAFLAEHDLVILINKQKGKKIALAKVNSITSKSIRTVLENNLIILNSEWELLRLNSLVTIHREYSSLKSLQYLPPTLLNNILKPNIPSSEMEIRDIMRTNNINKPQAQAIISSCDRLGFNLIQGPPGTGKTKTILAIISNLLSSKNQILVCAPSNAAVDEVVFRLKLHPKIIRLGQSDSIGSSVKEMSLDYLVEKALEKDSVSDQKAIKKNYDAVCAEREKLRAIERSGESSKTLHEXXXXXXXXXXXXXXXXXXXXXLNGLFDKTSLLFKNVEALKKKLRGQILSSADIICCTLSSSGHEIMSARQFETVIIDEASQAVELSCIIPLRYAKRCILVGDPNQLPPTVLSRDATGYERSLFVRIQENRPESVHLLSIQYRMHPEISMFPSKLFYNNRLKDGPNMGLLMKSVWHKNPI------------FSPFRFFGIKG-----SEKVGRGNSLYNSEEISAISGLVSKLISEFPLESRIGIITPYKQQLFELKKFFLEAIDFNTVDGFQGQEKDIIIFSCVRTNSA-NIGFLSDLRRMNVALTRARCSMFVFADPRAMSVNDKWELLLENARIRNCYTD. 2069
222 0.000e+00UniRef50_A0A2P5FIB2 Exonuclease/helicase-like n=38 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2P5FIB2_9ROSA  ali  31  449...DEFTNRMSELLRIERDAELEFTQEELSSRPIEFLVSHGQTICNLNTVSTSTGLGMHLVVFKNHKLPPTTLSPGDMVCVRTCDSRTSCMQGFVNNLGEDTISIALESRHGDPGKNVRIDRIADVLTYERNCEALMLLQKNGLRKKNPSVAVVATLFGDRDDIAWLEENLDESQRRALALGLNKRPILVIQGPPGTGKTGLLKELIALAVQQGERVLVTAPTNAAVDNMVDKLSKGLNIVRVGNPARISSNVASKSLGEIVNS---------------KLANFRAEFERKKADLRKDLSHC-------------------LKDDSLAAGIRQLLKQLGKTLKKKEKEAVREVLSSAQVVLATNTGAADPLIRKLDFDLVVIDEAGQAIEPACWIPIQQGKRCILAGDQCQLAPVILSRKALGLGVSLLERAASLHGGLATKLTTQYRMNDTIASWASKEMYEGSLKSSPIVSSHLLVDSAFVKPTWI--------TQCPLLLLDTRGCEEHL--DPAGTGSLYNEGEADIVVQHVFSLIYSGVRPTAIAVQSPYVAQVQLLRDRLEEGVEVATIDSFQGREADAVIISMVRSNTLGAVGFLGDSRRMNVAITRARKHVAVVCDSSTICHNTFLARLLRHIRYVGRV... 1122
223 0.000e+00UniRef50_A0A0B2SKV9 DNA-binding protein SMUBP-2 n=61 Tax=Embryophyta TaxID=3193 RepID=A0A0B2SKV9_GLYSO  ali  29  252..IDEFTTHMSELLRIERDAELEFTQEELDAVPSQPQQELCDTICNLNAISTSTGLGMHLVLFKNHRLPPTTLSPGDMVCVRTYDSMTSCIQGFVNSFGDDSITVALESRHGDPGKSVRIDRLADTLTYERNCEALMLLQKNGLRKKNPSISVVATLFGDGEDVAWLEKNFDDSQWRAIAMGLNKRPVLVIQGPPGTGKTGLLKQLIACAVQQGERVLVTAPTNAAVDNMVEKLSNGLNIVRVGNPARISKTVGSKSLEEIVN---------------AKLASFREEYERKKSDLRKDLRHC-------------------LRDDSLASGIRQLLKQLGRSLKKKEKQTVIEVLSSAQVVVATNTGAADPLVRRLDFDLVVIDEAGQAIEPSCWIPILQGKRCILAGDQCQLAPVILSRKALGLGISLLERAATLHGILTTRLTTQYRMNDAIASWASKEMYGGLLKSSETVFSHLLVDSPFVKPTWI--------TQCPLLLLDTVGCEEHL--DPAGTGSLYNEGEAEIVLQHVFSLIYAGVSPTAIAVQSPYVAQVQLLRDKLDEGTEVATIDSFQGREADAVILSMVRSNTLGAVGFLGDSRRINVAITRARKHLALVCDSSTICHNTFLARLLRHIRHFGRV... 926
224 0.000e+00UniRef50_A0A1E5SKH8 DNA-binding protein n=2 Tax=Fabibacter TaxID=446458 RepID=A0A1E5SKH8_9BACT  ali  31  14............LLKLEKEEDYAQYERKVLHTSVDERRKQGVTWYPIQITNKYISTGRFTLELDRHQDRHHAFQVGAVVSVFSGLDVDADTLAVVSYVRKDRMKVVLDDLPDWKQGKLGVNLLFDEGTYREMNKALKEVIGAETGRLADLREYGAKTANFKNGFDFQSVNLNEGQNKALTQIFNAKDVAIIHGPPGTGKTTTLVNAIKEVVKAEKQVLVCAQSNAAVDLIVEKLDTGLQVLRLGHPARLTPEVIENSLDVKISKHPFF----------------------------KEXXXXXXXXXXXXXXXXXXXXXFGFEERMQRKLVMKEARMFKEDADRVESQIMEDLVDEAQVVACTLTGSTHHLLRDRVFRSIFIDEASQALEPACWIAIRKAHRLIMAGDHLQLPPTIKSLKAAGLAETLFEKAINHIEQSV-MLSTQYRMHPDIVKFSGDHFYNGGLITAEEV-----------------ILRESNSESDHFLFIDTAGCG-FNEKVKKETLSTYNTDEAAL---LIKHLSSNLSIQETVGIIAPYKAQIEVIRDAVRDQVSVNTVDAFQGQERDVIYISLTRSNEKSEIGFLKEYRRMNVAMTRAKTRLVIVGDSATLGKDNFFNAVIDYAQQ....... 615
225 0.000e+00UniRef50_UPI000C6F88B0 DNA-binding protein SMUBP-2 n=3 Tax=Chalcidoidea TaxID=7422 RepID=UPI000C6F88B0  ali  30  26.......................KFFNDFSPVNLHYLEKSGLALTKLNINNSVNGPERYQIDFEKADGLEHGLSRGDLVICIRSKEKGQMIKAIVMDISESTLSISSNGQDVQDDEQFTVVKSDSDYTYRSQTRALNALEKKEIYSSQCLEIIKILFHDDDDNIKFHNRSLAKDQKLAVEFSLKRRHFAIVQGPPGTGKTTTLIEAVVQLHRLGKKILICAPTNVAVDNLVIRLGGTEKPLRLGHPTRIAKSALKYSLDSYLERDDSFKDLKDIKKSIKNLETNVESSGRKY--------------------------------------IYKEIRDLKKEYRKRLSRLTCDILRRSTVILCTLNSASAQSLPKDHFDVLIVDEASQAMEASMWIAIPNAPKLILAGDINQLPPVVLCQKAVGLNISLMERAIKKLKDNCVRLTRQYRMNEKIMSWASAKFYDNTLEADDSVKNHLLKDLPLSDK------HDDTLTSEAIVFIDTCGCDCEEFRSGVDSASKGNVREVIVVHKVVTALIKTGLRHRDIGVITPYALQVDFIKRNFASDVEVSTVDGFQGREKEAIIISLVRSNQEKELGFVTDFRRLNVAVTRARRSLIVIGDSETMESDDVIKSLLNHIEENGLL... 643
226 0.000e+00UniRef50_V9KXC6 DNA-binding protein SMUBP-2-like protein (Fragment) n=1 Tax=Callorhinchus milii TaxID=7868 RepID=V9KXC6_CALMI  ali  37  40........................................................................................................................................................................................................................VLCCAPSNVAVDNLVERLASKAKVLRLGHPARLLESIQQHCLDAVLAHSDGTQIVMDIRKDIDQAFS----------------------------------GMRKARDKGEKSWLRGEIKGLKKELREREEAAMVHILKRAEVILATTTGASSKLLPDDHFDVVVIDECAQALEASCWIALPRAPKCVLAGDHKQLPPTIKSRKAAGLSLSLMERLIGRHGEGVVMLTVQYRMHASIMHWASEQMYQGRLLAHETVAQHLLKDLPGVA--------STEETEIPLLLVDTASCGLF-ELDEEDEQSKGNPGEVQIVAAHIQALTEAGVQARDIAVIAPYNLQVQLLRKELHPELEIKSVDGFQGREKEAVVLSLVRSNRKGEVGFLAEDRRINVAVTRARRHLMVTCDTRTVCTHPFLRSLVDYLTNRGQV... 438
227 0.000e+00UniRef50_UPI000A383A62 DNA-binding protein n=2 Tax=Bacteroidetes TaxID=976 RepID=UPI000A383A62  ali  32  12..........LKLLKQEWQEDLAQYKQKFLNTSLADKKKEGITWHPIQLKKSKIGMGRILVEVERDQGSSSAFGSGKSVAFFTTQSNDDRIHGVINQVRKDSMVVTLDEIPDWMHGRLGVDLLFDEASYREMEFALKRVISSEDKRVKELAEILLGEKAPQVSIRQIKPNLNFSQNQACALIANAKDVAIVHGPPGTGKTTTLIEAIQDAVEAGQAILVCAPSNAAVDLLVEKLDRGIETLRIGHPARVEEKILNQTLDAKIAFHDSYRDXXXXXXXXXXXXXXXXXXXXXFGH----------------------------EERMQRKLMYEEVSRLRDASKALEEYIQFDIFQKTKVFASTLVGASSYHLKGMKFDVVFIDEAAQGLEAATWIPILKSKKVVFAGDHFQLPPTIKSRQAAGLAETLFEKVIKRKPQAAHMLELQYRMPEKIMGFSNEWFYHGNLKAAENTLTHT------------------FEGEAAIEWIDTAGSG-YTEQVEEESLSTFNPEEARFACTHLNRLITSGLEGWTIGLIAPYGAQVRLIRSLLGELITIDTVDGFQGQERDLMLISLTRSNDRGEIGFLSEERRMNVALTRAKRKLVLIGDSSTLAQNAFFDGLLGYFEEHEGY... 633
228 0.000e+00UniRef50_A0A099P4A9 Uncharacterized protein n=4 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A099P4A9_PICKU  ali  34  405..............................................................................................................................................................IPKKLSIPNMPNLNPSQICAVENALTS-PLTLIQGPPGTGKTVTSATIVYHLSKMHKKILVCAPSNVAVDHLTEKLTMGLNVVRITAKSRVDSSVSKYCLHELVK---------------------------------------------------KRAKGEFKKLIKLREEGNELSNEDNQKYFSNLRRSENSIISNCDVICCTCVGAKDKRLDRIKFKTVLIDESTQASEPESLIPIVKGCRLILVGDHQQLGPVIVNKKAAGLKQSLFERMI-VLGHTPIRLEVQYRMHPALSEFPSNMFYDGSLQNGITNEDRTILNSNFPWPIN----------DIPMMFWAIYG----REEISVGGTSYLNRVEAMNVERIITRLFKDGVKPSQIGVITPYEGQRNYIKKELYSEIEVVSVDAFQGREKDYIILSCVRANSQQLIGFLRDPRRLNVALTRAKYGMMILGNPKALNKDKLWNHLLTFYRSKGCLVE. 847
229 0.000e+00UniRef50_A0A1E3QCU2 Uncharacterized protein n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3QCU2_LIPST  ali  31  12.......ERFKSALKKEREEDISQTQAQLLSLPPKALARRGLAILNLCVSNIRTAIGGSVLELEPDTAISTEIRTGDIVAVERKPTMSPRMEGVTLRVSPKQIQVAVDDKFANLDGRLWMTKLVNSVTYNRMNETMEHLTSAPTKLQRIVLGSIKPSKPPEHPVKYFDNTLNDSQKDAVQFALSASE---------TGKTYTIIEVIRQLVEKGGRVLVCGPSNISVDTILERLDGLIPLLRVGHPARILASTQRHSLDIILRTSDAGQIVRDIRAEIDDSFAKI----------------------------------KKTRSGREKSEIYQNIKHLRKEYRMREKKALTQVLNQGLVVVCTLHGAGSSFLSAIEFNAIIIDEVSQSFEPQCWIPLLMAEKLIIAGDNKQLPPTIKAAMNEKLGTTLFDRLVAAHGEKKKLLNVQYRMNDIIMQYPSTSMYYGQLTAHDSVKGRTLADLEYV--------MRSEETETKVLWVDTQGGEFPESKTDVDVSSKYNDLEAWLVIEQVLELLNKGVKMSDIGIISPYNAQVTIISKRLEEEIEISTVDGFQGREKNAIIISLVRSNANGEIGFLTDDRRLNVAMTRPMRYLCVIGDTETLSKSTFLTGWVDWA......... 648
230 0.000e+00UniRef50_A0A0V1HM26 Regulator of nonsense transcripts 1 n=3 Tax=Trichinella TaxID=6333 RepID=A0A0V1HM26_9BILA  ali  28  351.NAVHYKKVFRELIFKEADYQLKEAYNEN----------------NVTVRWSYSLKRTRIAYFVFNKGTEVNLIPGDELILSNYDGKVWKASGRVMQVPEKFIELMDDRHPPDVTSGYSVSFGWRSILSDRMFMALRKLTDDDFVSYHDFEAPPLNISYPEHYLAPGLAELNHSQVMAVREVLTRN-VSLIQGPPGTGKTVTSASIVYHLAKAERPILVCAPSNVAVDQLAEKINRGLRVIRMCARSKIDSPVSSLALHNQVRSSDG-------EGELEKLWRLKEKTGKLST-------------------------------------------EDERRFRHLRSKFEHDLLTLADVVCCTCVAAGDSRLKDIRFRVVLIDESAQATEPECLIPIVTGRQVILVGDHCQLGPVVTCKEAAGLNRSLFERLL-ILGNRPIRLQVQYRMHPLLSLLPNNLFYEGTLQNGVTEQERILEGVDFRWPNSTV----------PMFFWSTA----SHEEIPSSGKSYLNRTEAAHIGKVATKFLRCGIRADQIGIITPYEGQRAYINNELYQKIEVASVDAFQGREKDIILLSCVRSNEHSRIGFLNDPRRLNVALTRARYGLIIVGNPQVLSHQPMWHSLLSFCRENHCLFD. 953
231 0.000e+00UniRef50_A0A238C6D5 Uncharacterized protein n=1 Tax=Onchocerca flexuosa TaxID=387005 RepID=A0A238C6D5_9BILA  ali  26  303.DAYQYKRVFEPLVKAEADYD--------------RREKESQTQSVGHVRWDIGLNRKPQAFFQLPKFSEMKLMLGDELRLKHSQGGEWSSIGCVIKIPDNHMRLKAENVPTDTRTNFTCEFVWNSTSFERHLEDCVSQFIYHKLMGHDIDDIIFKVSLPKRFSVPGLPELNHSQVHAVKTVLQ-RPLSLIQGPPGTGKTVTSATIVYHLVKQTNQVLVCAPSNIAVDQLAEKIHTGLKVVRLCAKSRLDSPVAFLALHNQLKALHGAA-------ELHKLQQLKEEMGELADADERRFRALRIAKEC-------------------------------------------QLLAAADVICCTCVSAADSRLSHMRIKCVLIDESTQATEPEVMVAVVCGRQLVLVGDHCQLGPVIMCKKAAGLSQSLFERLV-LLGNRPIRLQVQYRMHPALSSFPSNVFYEGSLQNGVTEGERQLIGIDWQWPVA----------DKPMMFWSCYG----QEELSSSGTSFLNRTEAANVEKLCTRFLKAGIKPEQIGIITPYEGQRAYIVQKLYLEMEVANVDAFQGREKDIIIVTCVRSNDHQGIGFLNDSRRLNVALTRAKFGIIIIGNAKVLSRHPLWNYLLSMFKEKGCLVE. 930
232 0.000e+00UniRef50_A0A0P0FXD7 ATP-dependent RecD-like DNA helicase n=226 Tax=root TaxID=1 RepID=A0A0P0FXD7_9BACE  ali  30  6LSPTDHLQRQELLLRMEYEFEKEEFKRQTETMGIARKVKRGLCWYPATGRSYYNSLNQLVIEITHDTDIEHNFEFGRPVCFFDEKITYFNSIGTISYANETRMVVAMPGAEVQSAENLGVQLYFDETSYRTMFEALSDVIRAKGNRLAELRDIMTLKPGFRELYPVRFPWLNSTQENAVNKVLNSRDVSIVHGPPGTGKTTTLVEAIYETLHREPQVLVCAQSNTAVDWICEKLDRGVNVLRIGNPTRVNDKMLSFTYERRFEGHQAYSELWSIRKAMREMGGKHRGSYEEXXXXXXXXXXXXXXXXXXXXXIN------------------------------------ADLFDNAHVIASTLVSSNHRILNGRHFGTLFIDEAAQALEAACWIAIRKADRVVLAGDHCQLPPTIKCYEAAGLECTLMERVVANKPSTVSLLKVQYRMHEDIMKFPSQWFYNGELQAAPEIRYRGILDW-----------------DTPINWIDTSDM-DFKEEFIGETFGRINKAEADLLLQELKAYIDRRVLEERIGIISPYKAQVQYLRNKIKASLTVNTVDGFQGQERDVIFISLVRANEDGQIGFLNDLRRMNVATTRARMKLVILGEAETMKRHKFYKELIEYI......... 623
233 0.000e+00UniRef50_A0A0M0J369 DNA2 nam7 helicase family protein n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0J369_9EUKA  ali  23  41.SVDEYLDVFEPLLLEECRAQTLRSLYEMTDSRDH----------HLQLKLVEPLEPFRLLHFESPEGEKSLFFETDLVFVSHEPPQQFHALAIVVNSTTSMLKVYLPEDPTSRSGKWHVRKLGNMVTINREFQALYSLRELTLASMLLAPAPPPRLQKPPSLWPAIKATHNPSQLAAIRTCLCGRGVTLIQGPPGTGKTKTILGILS--------VLLASHSAHTLTKSERSSWRDVGEGGDAASTDRHVHLGRAVAEEPPKHVLVCAPSNAAIDEIVSRLLRHTGPGMLNARGESFLPYVVRVGPNVKESLIEVALETMAKKRMATLLEHGE--------TISFDAAKTLVLNEASIVCTTLSCAGYSIFSQLKFDTVLIDEAAQAVEVSTLIPLKYCRRLILVGDPSQLPATVFSDHSMKYEQSLFQRLQ-IGGQRVAMLTTQYRMHPAISRFPGRRFYAGALLDAPGQSQLRRAAWHSQRW------------LGPYVFYDVSDG-----TASEVSSSWSNELEAQLALAIVRHLLNAYPDPSSIGIISPYNGQVRHIRTLLKESIDVNSVDGFQGREKDIIVLSTVRSDGQRGIGFLRDARRMNVSITRARSSVFVLGHADTLAKDPLWEAVLQDATDRHCLV.. 710
234 0.000e+00UniRef50_A0A2K2BXS2 Uncharacterized protein n=4 Tax=rosids TaxID=71275 RepID=A0A2K2BXS2_POPTR  ali  28  310.DAYQYQNVFAPLIKLEADYD--KMMKESQSKD------------NVTIRWDIGLNKKRVAYFVPKEDNELRLVPGDELRLRYSGDPAWQSVGHVIKLTAQEEVAASQGVPVDMNHGFSVDFVWKSTSFDRMQGAMKTFYIYHHLLGHEVENQTVRSALPRRFGAPGLPELNASQVLAVKNVLQ-KPISLIQGPPGTGKTVTSAAIVYHMAKQGQQVLVCAPSNVAVDQLAEKISAGLKVVRLCAKSRVSSPVEHLTLHYQVRHLDTSE-----KSELHKLQQLKDEQGELS-------------------------------------------SSDEKKYKALKRATEREISQSADVICCTCVGAGDPRLANFRFRQVLIDESTQATEPECLIPLVLGKQVVFVGDHCQLGPVIMCKKAAGLAQSLFERLV-LLGVKPIRLQVQYRMHPSLSEFPSNSFYEGTLQNGVTVNERQSSGIDFPWPV----------PNRPMFFY----VQMGQEEISASGTSYLNRTEAANVEKIVTTFLRSGVVPSQIGVITPYEGQRAYIRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQ-VGSL................................................ 865
235 0.000e+00UniRef50_A0A202G9S6 Putative ATP-dependent 5`-3` DNA helicase n=2 Tax=Clavispora lusitaniae TaxID=36911 RepID=A0A202G9S6_CLALS  ali  30  7.......ESFRNAIELEQKADMLLTASYLEAYSPKKLASFGLAVVNLVMQNMRTGLGGKTVSRPEEEISPGSLRVGDIVRIDRMGNSSESLEGVITRLSGKALTVSVDEDANDENVRMSVVKLTNSITYKRMMQAMKKLEDLSEVVRLLLGEARYTPRPKKGPWDVFDDSLNESQVSAVDFALSS-PIAIIHGPPGTGKTYTLIELIKQLFNHGERVLVCGASNISVDNILERLKDREGATEKAKKDRTTDKEKRKEKRAKRENDKNGKRARAKKSTPEKLIRVGHPARLLPCNLQHSLDERSILRDIEKDIGSTLGQIKKCKRYGERRQLWTELKQLKRELRTREKKIVRDLLVNAQVVLATLHGSGSNELFAVSFDTLVIDEVSQSLEPQCWIPLLAHRRLVIAGDNMQLPATVKSREVADLEYTLFDRLVDKLHGSKKLLNVQYRMNEKIMEFPSRTLYNGELRAAAGVRDILLCDLPNV--------QSTDETSVPCMWLDTQGGDFPEQADDSGSGSKLNPGEVAVVQRHVQALVDAGVDAASIGVISPYSAQTAALRKMMFGPVEVATVDGFQGREKEAIVLSLVRSNDNREVGFLRDRRRLNVAMTRPKRHLCVVGDMALLCGVRFLSEWARYADS....... 727
236 0.000e+00UniRef50_L8H8R0 DNAbinding protein SMUBP-2, putative n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8H8R0_ACACA  ali  25  165.SAEDYIRIFRPLLVEEFRASLEQDKEE----------DEFPHVQQVKLSSLDKVDSFHVVHFKYKVEPDRHFFENDILLIADQRN-----------------------ILLKGKAQW-----------LRM------GQLYFVKKGLPYNDHAPRVQGPHVRRAPTLASLCESDS-----------FVLLQGPPGTGKTKTILGILSSSLNKRNPVLVCAPSNAAVDEICMRLLE----DGLFNESSVHPMVKAITLASLLDAESDKGNSKKEQVEFEGFRTKTDATRKEXXXXXXXXXXXXXAKESELRRELTELHNGKAKLGKEISRFHETRKKYGSRVSKLRKQMELQILNETDIVLTTLSGSGSDILSHMSFETVVIDEAAQAVEMATLIPLKYCRRCILVGDPNQLPATVISQAASSYAQSLFQRLQKA-GHPVIMLDVQYRMHPLIREFPSKHFYDNRLTDGPNIDTSQSGLYNQP--------YHADPSFQPFLFYDLCKG---VEEQGARGQSYVNPAEATFCLQLFQDLCSRFPHIES-GVITPYKQQYFLLQRTFYSAIDINTIDGFQGREKDVIIFSCVRAHETKGIGFLSDIRRMNVALTRAKFGLFVVGKSTALLNNPHWGALVNHAKEKQLSCSL 796
237 0.000e+00UniRef50_A0A1S3XTI3 uncharacterized ATP-dependent helicase C29A10.10c-like n=7 Tax=Solanaceae TaxID=4070 RepID=A0A1S3XTI3_TOBAC  ali  26  453.SADEYVEIFRPLVLEEFKAQLQSSFQEITSL-------EEMSCGSLSVMSVERIDDFHFIRCVHDSAGSKSCSENDLFLLTRQSSHDIHMVGKVEKREKDCIRVYLQNRPHLERSKWCISRLMTITSQVREFQALSAIRGIPLPSSYDLCKHHSESFYSRPLQQVLKSAYNGSQLEAISAAIGPFDLSLIQGPPSTGMSCTDAALARQLNSIKRRILICAQSNAAVDELVSRIMYKPYIVRVGNAKTVHANSLPFFIDTLVDHRIAEEKMNALRSNLEKLVDTIRCYEAKRASLRDGNSDSKELSDAEVEAKLRILYEKKKSIYMDLASAQAREKKTNEEAKALRHKLRKAILKEAEIVVTTLSGCGGDLYEGVLFDAVVIDEAAQALEPASLIPLQKGTRCVMVGDPKQLPATVLSNIASKFSCSMFERLQRA-GYPVTMLTQQYRMHHEICRFPSFHFYDGKLVNGDKLSSKVASFHGTKG-------------LGPYVFFDVVDGKELHDKKSG-TLSLYNECEADAAVEVLKFFKKRFPSEGRIGIITPYRRQLSLLRSRFSSDMEFNTVDGFQGREVDIVILSTVRALEAGRIGFVADVRRMNVALTRAKLSLWIMGNTRTLQTNQSWAALVKDAKERELVMAL 1257
238 0.000e+00UniRef50_D8SG52 Uncharacterized protein n=2 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8SG52_SELML  ali  24  330.SYKHYLEIFRPLCFEEFKAHLERSLETMDLSRSDV----------VTAFSLRQEGYFHLVEFDGHTVEK---RNNLLVKVYLPHS--------CERLSKLREMLVTE-------STWHLNKLTSVTTFIREQQAMAAMHLFPLLETILSASPPREISRTQSLPPQLRSKLNESQLSSI-AAVADQMISLIQGPPGTGKTRTILGIVSALLAHANRILVCAQSNAAVDELVTRISKWPSIVRVGDTKRVHSQAMAVHIDRLVAKRMAENAGVHNAHSPQELRSKLDEVLGNMQALAAPAEVESQDGIPKLDKLAGLQEQQRLLLSELIKVENREHGFLMGSNRKKKQAMKLEVLREADVVLTTLSGCGGHIYSEMLFDAVIIDEAAQAVEPSTLIPLQLLKKCILIGDPKQLPATVLSVPASRLDCSMFERFQK-HGYPVSMLTTQYRMHPEIRSFPSTHYYGGQLKDGSTVLH-----------GNRSATFHRERCFEPYRFFDIRDGQ----ERPGSMQSLTNPDEAEFIFQLLRVLKERYVRPGRIGVITPYQEQRKVLQRSLHSGIDVNTVDSFQGREADIIVLSTVRASSQAGVGFLADVRRMNVALTRAKFSLWVVGNARTLERNPDWKALLQDCRRRGLV... 1004
239 0.000e+00UniRef50_G1R4B8 Immunoglobulin mu binding protein 2 n=4 Tax=Euteleostomi TaxID=117571 RepID=G1R4B8_NOMLE  ali  29  6..VESFVTKQLDLLELERDAEVEERRSWQENICLKELQSRGVCLLKLQVSSQRTGLGRLLVTFEPRRLPSNSFTSGDIVGLYDASESSQLATGILTRVTQKSVTVAFDESHDFQLSSYRLLKLANDVTYRRLKKALIALKKYHSSLIEVLFGRSAPSPASEIPLTFFNTCLDTSQKEAVSFALSQKELAIIHGPPGTVND--------QILTCGSQVLCCAPSNIAVDNLVERLLCKQRILRLGHPARLLESIQQHSLDAVLARSDSAQIVADIRKDIDQVFVGVMATWWCLLWCGCGCWEAAVPLETLGSLFPPGASDDGP--LKLLPESHFDVVVIDECAQALEASCWIPLLKARKCILA--------------------------------------------GDHKQLPPTTVSHKAAGLSLSLMERLAEEYGARVVRLTVQYRMHQAIMRWASDTMYLGQLTAHPSVAGHLLRDLPGVA--------ATEETGVPLLLVDTAGCGLF-ELEEEDEQSKGNPGEVRLVSLHIQALVDAGVPARDIAVVSPYNLQVDLLRQSLHPELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNHAFLKTLVEYFTQHGEV... 612
240 0.000e+00UniRef50_A0A2E4IB84 AAA family ATPase n=1 Tax=Saprospirales bacterium TaxID=2026790 RepID=A0A2E4IB84_9BACT  ali  29  1MKHQRYYN-LLKAIEEERKNEEAYFRELSKSATPKDKIESGILWYPVDIVKQRYTIGEFVVERTKHLDKSHKLKTGIGCTVFKQLDERQEYKGTISFIKRNKMGIVLEKGQLSEKGLTGIELVYDERPYKVMRDAIHTLINTKERHHMVLRDGISNQDDFTYSTRNYNTDYNPSQQTAIKGVMNTGHLGIIHGPPGTGKTTTLVTLIKTLLNNEKRILVCAPSNNAVDLLASKLDAAGVKVRVGNVTRISDDLAHVTVVEKLRNHDDWQXIKKVKIEATKARKIAGNFKRKFG----------------------------FKEREDRNAMYKEARDLQKWAKDLENKLVESILHDSQVVATTLIGTQQRMISDMQFETVIIDEASQALEAECWVAILKAKRVIMAGDHMQLPPTIKSSKAMGLEETILNRMTACIKDS-YTLGIQYRMNEKILSFPNKKFYGGKLLSHISNSTXLIQ-----------------ERDEPLIWIDTSGCG-FEEQTSTEHRSKWNEGEYFILREHFIQQIEKY-KGXSIGIIAPYAQQVRYIKSQVSEDVTINSIDGFQGQEKDVIYISLVRSNESGELGFLKDLRRLNVAITRAKKKLIIIGDVATLSSDQTFLELLEHVEKYGLY... 621
241 0.000e+00UniRef50_A7TMC6 Uncharacterized protein n=5 Tax=Saccharomycetaceae TaxID=4893 RepID=A7TMC6_VANPO  ali  25 1139.SVTEYQNVMRPLLLLECWQGLRAARDREEHKSFSII---------VGNRTAVSDFYEVYASVRKSKLAESDISESDLIVLTSETFKRCSCLAKVKSLKNTKITLRIHRSHKFSRSEIHAMKVMQMTTVEREYTSLEGLEFYDLVPLXXXXXXXXXXXXXXXXXXXXXYKLNTSQAAAIVNTVVQEGFSLIQGPPGTGKTKTILGIIGYFLSKKQKVLICAPSNAAVDEIVLRLKGKPKLVRIGRSDAVNSAIKDVTLEELVDKRVAEKNYNISSN--PDLERKFNSCVMKRRELRAKLDSENTEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSITYRNRDLDRRNAQARILASSSIICSTLSGSAHDVLASLKFDTVIIDEACQCTELSAIIPLRYGKRCIMVGDPNQLPPTVLSGAASKYNQSLFVRIEKN--STPYLLDVQYRMNPAISVFPSLEFYCGRLKDGPNMEAITKRPWHDVAPLST------------YRFFDIVSGRQ---EQNIKTMSYVNMEEIRVAIELIDYLLKKFENKYDIGIISPYKEQVIKMRREFRKYVDFNTIDGFQGQEKEIIIISCVRASDSGSVGFLKDFRRMNVALTRAKSSMWILGHHKSLQNNKLWNHLISDAKERNML... 1845
242 0.000e+00UniRef50_D3BNT8 Putative splicing endonuclease n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3BNT8_POLPP :_  ali  27  629.NLSEYIQIFQPLLLQEFKGQLLKAVEELEPSGTQY-----------VLDDVAREGEFHVVLFFLDGDEEFSLE--DLVLLQKELGVKFEVFGKIENKGKKEISVKFHQKHMKIKTQWNIQKLTSLSTVNREYLALHLVGKIPLGSYIISPALAINVVIPPALHNKLLSELNSSQMEAIYHSLIPHGFTLLQGPPGTGKTKTIMALLSVLLSTPPKILVCAPSNAAVDEIASRIIDGDMFIRIGQPSAISRKVQQISLEYLLEKNSNQSKIISVREKLAEINSSLESVKQKISTLQRSLGTS-LGTATDSTRDLTTLYHEKDRLFKEIQATKDSEKKVSDVLESARKNMAHSLLNKCNIILSTLSGSGHQETFSKKFDVVIIDEAAQAVEPSTLIPLKHVMKCILVGDPNQLPPTIISRMASQYETSLFQRLS-SCGIPQQVLKVQYRMHPSISRFPSRHFYMNVLEDGPNVKNYTEEFYKDP-------------RFGPFIFYDIYD----SNEESGPGHSLKNVTEAKLVALLITNLENSFPNKKSIGVITPYKQQVHEIKRRINQDIDVSSVDGFQGREKDIIIFSCVRAHRGGTIGFLSDVRRMNVGLTRARSSLIVIGNSNLLKLNPDWEALVMH.......... 1300
243 0.000e+00UniRef50_Q5AAW1 ATP-dependent 5`-3` DNA helicase n=5 Tax=Debaryomycetaceae TaxID=766764 RepID=Q5AAW1_CANAL  ali  30  4......FDQFKDAILDEQKEDIALTTSYINNYPPKKLAQLGLGIINLQIVNIRTGLGQFDSAFSDGEINTSTLRTGDIVKLEKKKPSKNHIEAVVIKVSTQTISISVDESTDDSKIRMWLVKLTNSITYKRMITTMDKVLAMKESDKQYIPKSNGTSNNNNGEINFFNDKLNASQRQAIDFAINDSNITIIHGPPGTGKTYTLIELIQQLTSKGEKVLVCGPSNISVDTILERLGDKMKLIRIGHPARLLMKNLQHSLEILSKTY-GRDIINEILNDIQSVLTKI----------------------------------KKCKKYGERKALYSELKLLKKELRQRERKIVNELLVQAQVVVATLHGSGSYELKNIVFDTIIIDEVSQSLEPQCWIPLLLSKRLVIAGDNMQLPPTIKTQKXXXLATTLFDRLMKHCHGEKYLLDVQYRMNKSIMQFPSMQLYDNQLKCDDSVREISLVDLPGV--------EINDDTMTKCIWYDTQGGEFPEQSESIDGDSKYNDMELLVVKGHIKKLLSSGVQPQDIGVIAPYSAQVQNLKKQMDGQIEISTVDGFQGREKEVIILTLVRSNDSREIGFLSEQRRLNVAMTRPKRQLCVVGDLELMSGNKFWSKFVED.......... 697
244 0.000e+00UniRef50_K8F6R7 Uncharacterized protein n=1 Tax=Bathycoccus prasinos TaxID=41875 RepID=K8F6R7_9CHLO  ali  32  152.TISEWTTKTLHLLELERVEEIAQSLDALNTSTSKKKGQHKNALDGLKIVDARGGLGQTIVTLEVPPLPTHSFTPHDVVRLRPSNVKFEEMQGVIYRIRDSSVELALDDVPEFLDSPLRLEKLSNEQTHKKLVLAVQGLQHALASGYSLGKNILEIVFESAVRFHPFNENLDCSQKSAIQLCLDCVDVGIIHGPPGTGKTTAVVEYVSQEVARGNRVLVCSASNVAVDNVVERLDQSKTIVRYGHPARLAPAVLDASLDAYILRSDDSALAKECSEDSKKIRTRISKLDYRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKT-----------------------------LEKASVICATLAGALSFALKNEEFDVVVVDEAAQALECAVLGVVMKGKKLVLAGDHLQLPPTVLSDEAKGLSTTLFERLVKRFGAKITMLNTQYRMHEDIMVWSSDAMYDSKLIAAESVRFRKFEQFDKV-----------------LTLVDTTGEDDSFMENVGDDDSKSNLGEAEIVMQTIEKFLSDKILPNEIGVITPYSGQVSLLREMLFKDIEISTVDGFQGREKEAIIISTVRSNENNEVGFLSDARRMNVAVTRARKHVTLICNCETVSKDTFLAHLVQYFEENGELVS. 843
245 0.000e+00UniRef50_A0A2D4CDG5 Uncharacterized protein (Fragment) n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4CDG5_PYTIN  ali  37  7...............