current user: public

If you have questions about the server, please let us know.

Query: TM0009 TM0009 281890 Purified-2001-02-14, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# E-value Template Links and tools%idFirst MIGPRDLLNIALRIESTGYSYYKNLTEKTEGETKALFERLAEQERDHSRKFKEILEKYEQDLNPSDEVLGYLEALAEISIFPKLEETPPDDLREAVRRAIEVEKDSIVFYSEILSYVPEKEPVQTIIDEEKKHLRDLLRLEVLast
1 1.000e-23UniRef50_A0A2K3JI63 Uncharacterized protein n=11 Tax=Euryarchaeota TaxID=28890 RepID=A0A2K3JI63_9EURY  ali  24  4.FNMRDAIKTAIQMEKDGHAFYTKAAAQTTSETRAVFESLAADEYVHLDTFQKMFQGRISSVEWEKLVQSNEKSVYPKDVKTMENAPANSDELDALRMGMDSEKDAIDYYTSIMNETSDKEILDEIINQEKNHYQILQQEFS 152
2 3.000e-23UniRef50_I2F2Q4 Uncharacterized protein n=6 Tax=Mesotoga TaxID=1184396 RepID=I2F2Q4_9BACT  ali  48  1MITVGDMLDIALRIESVGYSYYQKLSEKTSGEVKSLFVKLATQEREHAAVFRKMLKDADNSAKDWEDNVGYLKSYAEISIFPRESIDVPDNINKAISSAVEVEKDSIIFYSDLSSFIPDCKELKDIIEEERRHLHDLVKLY. 144
3 5.000e-22UniRef50_A0A1F8N617 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_56_8b TaxID=1797633 RepID=A0A1F8N617_9CHLR  ali  33  4IFSGSELLEVALGIERNGAAFYQALAEKTKNSARAIYEHLAAEEVKHLKTFQGMLDNYQPPEGYAEEYRLYLKSLVDSSVFTDVIAARVSSEVEALDIGIQAEKDSILFYTEMKNLVKDHQVILTIINQERDHLNQLSQLK. 155
4 6.000e-21UniRef50_A0L9R2 Rubrerythrin n=12 Tax=Proteobacteria TaxID=1224 RepID=A0L9R2_MAGMM  ali  21  16.KSLADILDVAIGFEQTAFDFYTQLTPKVGKPLRYLVAELAQEEQRHVVLFTELRNRPELEQQIREMVDTPESDSRFSDAVHLPELGENPDDQSVLQFAMGREHTAMQQYTALAESTPVRDLFAYLADEEMLHKKELEKLY. 158
5 6.000e-21UniRef50_X0YK74 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0YK74_9ZZZZ  ali  32  1..................................QMLLDLAAMEAEHEETFASMRQQLSDEFDPENEMALYLQAMANGHVFDSEQLTGTETAEDILKLAINAEKDSIVFYLGLKDFVPAKDKVEAIIKEEMGHIAVLNR... 119
6 1.000e-20UniRef50_A0A1G3P4N9 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWF1_31_7 TaxID=1802187 RepID=A0A1G3P4N9_9SPIR  ali  37  4.YNFDDILLFAVNIEKNGENFYRNFANKFKDEINALFVFLADQEVEHSRYFSELLQSVTDNGNYNDEYFAYLRAFVDNAIFNQNKNNEINSIVDVLDFALQMESDSITFYSELKLFMNQKDIVDIIIDEEKKHFRKLYELKS 155
7 2.000e-20UniRef50_B8D1S5 Rubrerythrin n=1 Tax=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) TaxID=373903 RepID=B8D1S5_HALOH  ali  35  10.....EALEMAKNIEKDGFEFYQEQADRVDDDLKKLFLKLANDEKDHYKRFEELKHDHEDDYVYEPEVSAYLRVLVESTIFPEKAIKSFNNLDSILNFAIQAEKDSILFYQELLKYNKGREVLTRLIKEEKTHLLDLTKYKA 154
8 3.000e-20UniRef50_A0A0S8KAF3 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium SM23_81 TaxID=1703428 RepID=A0A0S8KAF3_9BACT  ali  20  8...VKEAIQVAIQLEKDGRQFFEKAAEETKNELKKMFLKLASDEVRHLVTFEKMFKSIADPKTWKELLKEGPPPYFSEKAESRSPAEKGAGEVEALRQALDVERKAIDFFKEVAKQASDPEIFEIIAQEEVSHYDLIQ.... 150
9 4.000e-20UniRef50_A0A1F8ZN71 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium GWF2_42_12 TaxID=1797824 RepID=A0A1F8ZN71_9DELT  ali  30  6.FSGREILQIAIQIEKNGIEFYTAAGKAAKDKVKDLFSFLVDEEKKHIGTFEGMMKALTDEDPYLEEEAMYIKALSDSRVFTKPGGGKRLSAEDVLRVAMDMEKDSILFYYEMLKATKDKHAVEDVISEEKKHFVKLQTLY. 159
10 6.000e-20UniRef50_A0A0F8ZNZ2 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8ZNZ2_9ZZZZ  ali  30  206.FSADDIFEMAEQLERNGAKFYRTAAELSDSSAKKLLLYLSEMENAHEKTFASLRADLAEKEKPEGEAMAYLQALANTRVFFEKTID-VSSLKRIYMAALEAEKDSIVFYLGMKDMVPEKDRIDAIIREEMGHIKILSRE.. 353
11 7.000e-20UniRef50_A0A2G9YLT3 Uncharacterized protein n=3 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2G9YLT3_9BACT  ali  33  27IFAGSEIVKLGIQIEKNGRDFYNTLSSQSKNKASEIFKYLAGEEEKHIKTFQEILEKYEPSGLDADEYFAYMNALASEYVFTKEIAKTIKSDQEAMNMGIGFEKDSIVFYEGMKKVVPEYKIVDALITQEQGHLKILSDLK. 178
12 1.000e-19UniRef50_X0U8K7 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=X0U8K7_9ZZZZ  ali  32  4IFSGSEIVKIGIEIEKNGKDFYTKAAEKSEDKAKGLFNYLAAEEEKHITAFEKILDTLDQEESFPGEYVSYMKDLAGKYVFTRKDAEGCKDDKEVIERSIGFENDSIVFYLGMRKAVPEHRVIDELIDQEKTHLKKLSELRS 156
13 1.000e-19UniRef50_A0A1F9XAK0 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium RIFOXYB2_FULL_48_7 TaxID=1797967 RepID=A0A1F9XAK0_9BACT  ali  31  22.FSPSEIVQMGVEIEKNGRDFYNAVAGLSKSAAKKIFEFLAGEEDKHIKVFEDILEKYEPPEAYTEEYFSYLRALSESHVFTKKNQSKVKTDKEAINLAIGFEKDSILFYYEMKKLADSHKAIDRLVAQEQEHLKKLTEL.. 171
14 1.000e-19UniRef50_C7LVG3 Rhodanese domain protein n=28 Tax=Bacteria TaxID=2 RepID=C7LVG3_DESBD  ali  19  126..SAEAILASAYSLEEGLRDFYLRMLERVSDEVKSVFRLLADIEIKHKDRLFAEYTRITGKDDRGDFECRFVTPLMETEEYMDRFKPDFDSPVDVISLAMSIEAQALDLYIRSAQNAENRAILEQIASEEKTHLERLGQL.. 271
15 1.000e-19UniRef50_A0A2J6WIS4 Ferritin n=1 Tax=Mesoaciditoga sp. TaxID=2060323 RepID=A0A2J6WIS4_9BACT  ali  46  1.MGIEDLLGVALKIESSGYQFYTELAKRSKGENKKLFSSLAEQERDHMKIFEKLISASKEKEILNEEAVGYLKVYAETSIFPEIEKSVPENMREALEIALDVEKDSVIFYEELLKYAPETSTIQKIIEEEKRHFKDILKM.. 140
16 2.000e-19UniRef50_A0A202DP41 Rubrerythrin n=1 Tax=bacterium F16 TaxID=1932694 RepID=A0A202DP41_9BACT  ali  22  4MHTVNEILDFAIGEEEKSMQFYTNLAQNAEPAMKAVFEGFAVEERGHKQKLQAVK-----DGATFSPPKSKIQDLRLADYLVDVEASPEMPYEDALIVAMKREKAAFRLYTTLADVSDDRNVLLAIAQEEAKHKLRFEVEY. 142
17 2.000e-19UniRef50_F6DSS8 Rubrerythrin n=1 Tax=Desulfotomaculum ruminis (strain ATCC 23193 / DSM 2154 / NCIB 8452 / DL) TaxID=696281 RepID=F6DSS8_DESRL  ali  27  5.FNLSTVVDLAASNSVKGVQYYRRMQEMAEDSAREIFHRLAEEEGEEQRALLKVAEAEKEQNGMNEQTYCYLSALGDELKFPYLEEFKAVSPREALEIGIQAKKDAILLYHEFLNRCVSQEARNILLHLLESEQRNLLELR. 149
18 3.000e-19UniRef50_A0A1F3Y2X9 Uncharacterized protein n=14 Tax=Bacteria TaxID=2 RepID=A0A1F3Y2X9_9PROT  ali  15  5..SFEDVIDFAIDKEQEAVDFYNELARRSKPQMREIFTQFANEETAHKTRLQGIKRGWRPSPSGHD----NIMNLKIIDYMVEGDPLMEMDYQRALIGAMKREKAAFRLYTDLAARTADKNLFLALAQDEARHKLRFEVEY. 144
19 3.000e-19UniRef50_A0A0X1KPK1 Rubrerythrin n=6 Tax=Thermotogaceae TaxID=188709 RepID=A0A0X1KPK1_9THEM  ali  45  1MVNLSELLSIALNIEAEGYAFYTNLASQTDEQSKQLFQNLAQQEREHQEIFKKLINEFSKDNWVSEEVAGYLKSYANMSIFPTMTKMKQMSSTEALKLAVEVEKDSIIFYSELLPYANERETIKKVISEEKRHLMDLLALLS 149
20 4.000e-19UniRef50_UPI0009FC7BD0 hypothetical protein n=1 Tax=Desulfocurvus vexinensis TaxID=399548 RepID=UPI0009FC7BD0  ali  21  240..DPAQIVLRAWGMEAALGDFYTAMAGQTRGEVAATLTRLAGFEERHKARLLETYRRMTGREPEPGAEAAPLEGGLSAAEFIALHGPDFTDPRAVVETGMMFEAQAMDLYARCAARAEARDLLATLAREEQAHLKAL..... 382
21 5.000e-19UniRef50_A0A1W9UIP3 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium 4572_32.1 TaxID=1971623 RepID=A0A1W9UIP3_9CHLR  ali  22  7...LLEAIDTAIQIEKDGLEFYTKAAKQTDDPGKRMFQTLAQDEAAHLALFEKTRRTLIEKGDWPAPEPGKLIRQPIFPTGDEVETKIPERQLAVLRQGIQAEEDSIAFYSEQKIKIDDPDMYAYLIEQEEGHRTILQGEY. 154
22 5.000e-19UniRef50_UPI0009FFDDAC hypothetical protein n=1 Tax=Desulfatiglans anilini TaxID=90728 RepID=UPI0009FFDDAC  ali  21  54VFELGEIIDLAIQIERNGERTYAEAAGKAKPDLVDALTKLASDEREHVEWFEALKKECADEGRDESMRDFGRRLLGDIFSLAEVDFERIETIKEVLAAALEFEKDTILFYQMIQTAIADSMVLDKIINEEKQHVDLIE.... 200
23 6.000e-19UniRef50_A0A1F8MZR6 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_54_9 TaxID=1797631 RepID=A0A1F8MZR6_9CHLR  ali  34  9....REVLEVAIEIEKNGRSFYEFMAKQAKSEVWDTFTFLAGQEQKHEETFREMLNRLGGYQPYPGEHYQYIKDLADSEIFVGDRVQEMASYDESLDIAIGFEKDSILLYSEIRGFVPDQDIVEKVVFEEKTHLRQLMDLK. 156
24 6.000e-19UniRef50_A0A1F2SRL9 Uncharacterized protein n=3 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2SRL9_9BACT  ali  23  151...ARDALRMAIATERSGLDFYTRAAALTKDRGRAVFRKLAAEEREHLGTLLKRYGELDAQLESRPTFLFFKGAAGGLFAAGARQLREGVDDAEALLIGIRCERGSHRFFKRYGERFEDKQVFLEFADEERVHLELLIREY. 295
25 6.000e-19UniRef50_A0A2N2J3X5 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13 TaxID=2013740 RepID=A0A2N2J3X5_9DELT  ali  32  21..NFADVLEVAVRIERQGTDLYNKLSARHKPRAKDVFSFLAAEEEKHAGVFRKMLQKYPPRFNYPGEYGLFIEEVASDEIEKEIASLPANKENDALDIGIELEKETILFYMEIKAESKEGEMLQDVIDEERLH......... 162
26 7.000e-19UniRef50_A0A1E7IJH4 Uncharacterized protein n=3 Tax=unclassified Desulfuromonadales TaxID=213431 RepID=A0A1E7IJH4_9DELT  ali  19  3......VYDFAIQMETDAEIFYRKLAAESHPGINKIFTDLADDEQRHRQIFQDLKEKQAPDTATESKVLEKAKNIFTKILMEKQSLPSVTSNLESYRYALKLEAEGVRLYTDAAKREADKKVLLRIAKEEENHFNIVENIY. 141
27 7.000e-19UniRef50_S0FY05 Rubrerythrin,thiosulfate sulfurtransferase n=8 Tax=Desulfobacterales TaxID=213118 RepID=S0FY05_9DELT  ali  22  41..SAKEFLVIAYSLEQGLQEFYQEMADKAGNEVKNLFHKLAAIEIKHKDQVFERYQNMVDPEISREGFESMVTVSALEGGLTTKQYLDQFDPDEVVSMAMSIEAQALDLYQRVAGQVTDKDVLHQIAKEEQQHLARLGKL.. 187
28 8.000e-19UniRef50_A1AQY9 Rubrerythrin n=8 Tax=Deltaproteobacteria TaxID=28221 RepID=A1AQY9_PELPD  ali  27  3IFAASDVLQFAVRMEENGGLFYRKAAELSKSEAKKLFQHLASEEAEHKKTFEKFLSQVTPTEDYPGEYLAYLHNYIDGKVFDDTCALKSFDVASALDFAIQREMDAILYYTELKAFADDQKSIDAIIEEERKHFAQLSEIR. 151
29 1.000e-18UniRef50_A0A1W1V261 Rubrerythrin n=1 Tax=Desulfonispora thiosulfatigenes DSM 11270 TaxID=656914 RepID=A0A1W1V261_DESTI  ali  30  1MFKAIEVLNFAVQVEKNGEIFYNTVAELSEDKVKEIFTGLAKAEAQHIVDFTALMENVETPEAYEGEFEEYMKALVDSHVFIKNTAGKVSSPREAIDLAMSFEKDSILFFSELRRVVTDQNTIDDLINQEHAHIRTLARLRA 153
30 1.000e-18UniRef50_A0A1F8MVA7 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_54_8 TaxID=1797630 RepID=A0A1F8MVA7_9CHLR  ali  35  13.LSGRELVNIAIGIEKNGAAFYESLTDSTRSAAKDTYRHLADMERGHVTTFQRMLEEHVFPETYTEEYDLYLKGLIDSSVFTDERVAKEASDFEAIRIAVTAEKESILFYSEMRELVADREVLNRVIEEERSHLRYLSELR. 163
31 2.000e-18UniRef50_A0A0S8D5U4 Uncharacterized protein n=4 Tax=Nitrospirae TaxID=40117 RepID=A0A0S8D5U4_9BACT  ali  28  4.YTVTEALEQAIQTEKLGQAFYTRMAEKFQDPLKNLFDTLAAKERHHEQTFTSLKGRVGDQHENWEEASKYMRAIVESEYFLGKEMKNIQSIEDAVRFAIGFEKETLLYFHQMKDIVDDKETMSAIIKEEQSHLVWLSD... 149
32 2.000e-18UniRef50_A0A2I0NJD0 Uncharacterized protein n=1 Tax=Candidatus Methanoperedenaceae archaeon HGW-Methanoperedenaceae-1 TaxID=2013824 RepID=A0A2I0NJD0_  ali  23  11...VLDILKEAISIEIYGQEYYSLFSDIVKDEAKALFRGLSRDEGEHREMIEKEYGKISGTKVDVGSLAEENREKARRIFPESPESMGITETNEVLKLGIRTEQRSIEFYSGGAQKTGDKKLFMKLSGIEKGHKSALEN... 150
33 2.000e-18UniRef50_A0A2H6ISU1 Rubrerythrin n=1 Tax=bacterium BMS3Bbin09 TaxID=2005732 RepID=A0A2H6ISU1_9BACT  ali  31  3VFSVKEVLEMAVQTEKLGAEFYTNMAARFNEEFRKLFEMLAEQEREHENIFHSIMEKMGSSYQMPEEAAKYLRAIVESEFFLGPNFEHLKTADDVINYAITFEKVTLLFYIELRDIVDDKEAVYNLINEEKGHIVWLSD... 151
34 2.000e-18UniRef50_A0A1F9Y6Z7 Uncharacterized protein n=3 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9Y6Z7_9BACT  ali  34  3VFKTSEMIEFAIQIEKNGEKFYRESVKLIPDEIKTLFSDLADQELEHKKVFESFLKKVEPPELYNDDYFSYLRAYADTKIFNKK-LPRIKEPTEAIRFALDIEKDSILYYSESKNFVDDKKILDGIIEEERKHFLRLWEL.. 147
35 2.000e-18UniRef50_A0A0Q4BF57 Uncharacterized protein n=3 Tax=Methanomassiliicoccales TaxID=1235850 RepID=A0A0Q4BF57_9EURY  ali  22  23......ALAAAWQIEDYGIELYTALSERVKDEGRNILQSLAQDEAQHKAWLEREIDRIFPGRRIRDIEPDPTYGITPAKVFALPDELTSQDEIAALEAAVEVEKRSARLYEEVAAAADDRAMMERLARWERGHQRILED... 159
36 2.000e-18UniRef50_A0A1G0WN34 Uncharacterized protein n=1 Tax=Ignavibacteria bacterium RIFOXYC2_FULL_35_21 TaxID=1798452 RepID=A0A1G0WN34_9BACT  ali  19  5..TFNDVIKFAIARELEAAQFYKDMANKTKDSNIFLFLELEKMELGHAKTLENFKNEG-----WSNPEIPNIPDLKISDYMETPEVNDGMTYQDAIVLAMKREKAAAKLYTDLANEFTDKNLFLRLASEESKHKLQLETLY. 142
37 2.000e-18UniRef50_A0A2U3KPD5 Rubrerythrin n=2 Tax=Syntrophobacter sp. SbD1 TaxID=2043167 RepID=A0A2U3KPD5_9DELT  ali  32  5.FNAGEVFKIAIQIEKNGTEFYEKSVKNIKEEIKALFIDLALQEIEHKRKFESLLAGLPPAWDPDNEIDQYIKMMADDHIFVKDRVDRLKDTMDALKLAIEFEKDSVLFFLGLEDAVKDRELIKSLVKEEQQHLRRLT.... 156
38 2.000e-18UniRef50_A0A0W8E471 Rubrerythrin n=2 Tax=root TaxID=1 RepID=A0A0W8E471_9ZZZZ  ali  22  8......ILKTAILNEIEGETFYQLAADNVKDPMRGVFLYLAKEEQNHQQILKYMLEQITAGKEISVEITNLETKSPGIFKLQDAARTVDNLEISAVSTGILMEKASVDYYRQAASTSSNKNLYENLISWEMGHLDELEKMY. 146
39 3.000e-18UniRef50_A0A0S7XUF8 Uncharacterized protein n=12 Tax=root TaxID=1 RepID=A0A0S7XUF8_9COXI  ali  26  5.FNADEIFEMAEEIERNGARFYREAAKKTDDETKQLLLDMAAMEDGHLHTFEQMRKELGPKDKAQMVFDPDNESGYEGKVSPTEKLTGKETPQEILKIAVDAEKNSVVFYVGLKDLVPAKDKVENIIREEMGHIANLNKELA 160
40 3.000e-18UniRef50_C0QL90 Rhodanese-like domain protein n=1 Tax=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) TaxID=177437 RepID=C0QL90_  ali  22  127..TPREILEIAYGLEQGLREFYLSMDKQVKNPVRRLFATLARVETLHQESILREYQRIKEDQLTAAALQGTLEGGMTTQEYIDYYMPQWEDPEDVVFLAMAIEAQALDLYLRAKTRVVDRKILTRIAQEEKSHLVHLGEL.. 273
41 3.000e-18UniRef50_A0A1L3GL72 Uncharacterized protein n=4 Tax=Desulfuromonadaceae TaxID=213421 RepID=A0A1L3GL72_9DELT  ali  18  3......VYDFAIQMETDAETFYRKLADESHPGMKKIFSDLADDEQSHRQLFQNLKNQQVPDAVTESKVLEKAKNVFAKILAERQSLPSVMSNLESYRYALKLEAEGVRLYSDAAKREVDKKVLLCIAKEEENHFNIVENIY. 141
42 3.000e-18UniRef50_S0FZ55 Rubrerythrin Rbr n=16 Tax=Desulfobacterales TaxID=213118 RepID=S0FZ55_9DELT  ali  16  5..SIDEILTFAIDKENEAVAFYRQAAKATKDSLKEIFESFAKEEEKHAALLSDISGN---KEKIESYEFKKIPDLRISDYMVEKDYEEGMPMPEILKVAMKREEKAVKLYQTLADQADAKKLFLMLVQEESKHKLGLESMY. 144
43 3.000e-18UniRef50_A0A2G6N800 Uncharacterized protein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2G6N800_9DELT  ali  25  1MFTAQDILEIAIRLEKNGEKRYLEAAHTSDDNLKSLLNWVAEEERAHARWFIALKKSLVQGEDHHSQALVEDVIRSQSFSLQEVDFSAIQTTDQIIRTFIGFEDDTIAFYEVLKSLIDDPATLKQIIDEERKHIAQFRNLLA 151
44 3.000e-18UniRef50_A0A1V6G3P8 Putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein n=1 Tax=  ali  21  2.....DIFDFALQMEKDGKRFYQDAAARCGDKLQAVFNLLADAEQEHYDLVKSMKRG-TPPTTTLTDVLDGVKNLFRQMAERDHTLDPKATQMGLYKQGLEIERRSKAFYEEKAAEVKGKNLLRALAVEEQRHADVLENI.. 139
45 4.000e-18UniRef50_UPI000483BA5B rubrerythrin n=1 Tax=Desulfovermiculus halophilus TaxID=339722 RepID=UPI000483BA5B  ali  28  4IFKANDIVRAAVEAEKKGKEFYECLAGRVGDEIKALFTDLAQEELKHKDIFQALLDRLEPVESDQEEYDQYFDALINSHMLFEVMLDQVRTEQEALKLAMNFERDSLLFFKEMKEFVPERKIIDQCIEEERKHLVRLKQM.. 155
46 4.000e-18UniRef50_B7IGF6 Rubrerythrin subfamily n=2 Tax=Thermosipho africanus TaxID=2421 RepID=B7IGF6_THEAB  ali  45  1.MTINELLGVALKIEGAGYSYYEKLSNVSSGALKDLFLELANEEREHARIFEEILSGFKDEKNLNEEEVGYLKAFAEDVIFPKLTIEKPTSVKEAIKLAIEVEKDSIIFYNDIKMLVPDNSAIEKVIEEEKKHMKKLT.... 140
47 5.000e-18UniRef50_UPI000B7FFF16 hypothetical protein n=1 Tax=Dehalobacterium formicoaceticum TaxID=51515 RepID=UPI000B7FFF16  ali  30  16.FNGMDVITFAVEIEKNGREFYGAVAGKTDPEVKDIFLKLKGQEEQHIKDFEQLLEKTTDQETYDGEYLEYVKALVDNHVFNNELAERVKTKEEAIDLALRFEKDSIIFFAELKNVIQSKEIIEELINQERGHIRLLSQLK. 166
48 5.000e-18UniRef50_A0A1V5HCH0 Rubrerythrin n=1 Tax=Deltaproteobacteria bacterium ADurb.BinA179 TaxID=1852872 RepID=A0A1V5HCH0_9DELT  ali  28  4IFNAAEIFEMAIAIERKGRTFYLNASKSFDEPIKSLLKGLAEMEKEHEEVFLSLKEKLIPDEDPDNVAVSYVRAMTSGEVFDKITFEGGESIEEVLKKGIQAEKNSIIFYAGLKGLVPERANVDRIIREEMKHIVLLTEKLA 156
49 6.000e-18UniRef50_A0A256YXC6 Rubrerythrin n=2 Tax=cellular organisms TaxID=131567 RepID=A0A256YXC6_9EURY  ali  21  4MTSIYDLFDFAIEKEQEAHDFYMDLAGKMDNPMKRVFEGFAREELGHKKKLE-----LARDGKIDIMKDEKVPDLKISDYIVDVNPTKTMDYQGALILAMKKEKAAFRLYMDLSEMVDDPELLIGIANEEARHKLRFEIEY. 143
50 8.000e-18UniRef50_A0A2M6YJX4 Uncharacterized protein n=2 Tax=unclassified Syntrophobacteraceae TaxID=869804 RepID=A0A2M6YJX4_9DELT  ali  26  19MFSIQEILSMAIRIEENGERFYRQAARISDQSLASVLLCLAEEEVRHQQMFRELREASEGSGKFHWAEDSMLQNVVGDQTFSLKELDPATSEWKILKAAIEFENDTILFMEMIRDFVTDAATLQQLIAEEQRHKETL..... 164
51 8.000e-18UniRef50_A0A081BXS0 Rubrerythrin n=3 Tax=Bacteria TaxID=2 RepID=A0A081BXS0_9BACT  ali  28  7....LDIFDFAINAERDGMNFYIKATEKFDNKVKDSFRRLAEEEGKHIQTFLNIKAKLEKSGKVDPFTIGNVDEYLETIIHDEKRLEKVEDVASACAVAMEAEKNAILLYSELAKTAKDREAFEKLAKEEKTHIVMLKQVRA 157
52 8.000e-18UniRef50_A0A2N1PNQ3 Rubrerythrin n=1 Tax=Candidatus Wallbacteria bacterium HGW-Wallbacteria-1 TaxID=2013854 RepID=A0A2N1PNQ3_9BACT  ali  30  3.FNAVEVFRLAEQIERNGVKFYRRAAERTSEKEKNLFMDLADMEQEHESFFASVRANLESDQAPDFDPSSYLNAIADGYVFDDEILTGSESVADILNMAIAREKDSIVFYVGLKELVPGRDNIETIIQEEMNHISGLTAILA 156
53 9.000e-18UniRef50_A0A1F7F9G0 Uncharacterized protein n=1 Tax=Candidatus Raymondbacteria bacterium RIFOXYD12_FULL_49_13 TaxID=1817890 RepID=A0A1F7F9G0_9BACT :_  ali  28  5.FNADQVFGIGVEIEKNGKEFYTAAAQSAGQSIKTTLEELAKWEDQHIAIFSNLRKNLDNTYDPNNEITLYLKAAADNHVFIKNKDPRADTPIEVIGIAMNFEKDSVVFYSAMRNAIPAKSDIEKLIDEELKHIVILTKI.. 158
54 9.000e-18UniRef50_A0A1F8WZA6 Uncharacterized protein n=3 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F8WZA6_9DELT  ali  29  6.FTGKEILDMAVRIEENGMRFYADAAKGAKSKLRELFKALSEDEGTHIKMFLDLKKLLEGFDPYLDEAQSYLRTMADAEVFTKETARALKSEEEAIKLAIGMEKDSLLFYYELERMIKDRKLVESIIEQEKDHVKRLTALQA 159
55 1.000e-17UniRef50_A0A1G1ITW3 Uncharacterized protein n=1 Tax=Omnitrophica bacterium GWA2_41_15 TaxID=1801814 RepID=A0A1G1ITW3_9BACT  ali  33  4IFSGSEIVEMAVEIEKNGRDFYNKVSESLKDEIGRIFKYLAGQEEKHVKVFKNMLKKYEPSEAYTDEYFSYMKALSEEHVFTKKNKGKVKDGRKAVELGLGFERDSILFYHEMKNFVSEHNIINGLIKEEQMHLKKLSLLR. 155
56 1.000e-17UniRef50_A0A081BTH0 Rubrerythrin subfamily n=1 Tax=Candidatus Moduliflexus flocculans TaxID=1499966 RepID=A0A081BTH0_9BACT  ali  26  4LFDIHEIVNFAIQREQESLELYRTLAEQVQPELKNIFLLLMEEERQHRVYLAALAQQADPSLQRDEEYDAYMRVLLDSGRISKTLPVDMENLQATIDYAIGREKDAVLFYTGLEQYVPDRETVRGIVREEARHIVKLTHIKA 152
57 1.000e-17UniRef50_A0A1J4VR79 Uncharacterized protein n=1 Tax=Candidatus Omnitrophica bacterium CG1_02_49_10 TaxID=1805289 RepID=A0A1J4VR79_9BACT  ali  34  4IFKAGEIVDIAIQIERNGYAFYKELSKTSRNPVQEAFGLMAAEEKEHIAAFEKLSEKFTPPESYPGEYMLYLKAFAGQNIFTKEKQDKVSSDAEAIDMAVGFEKDSIIFYYDMKKFIPREEVIDSLIDEEKKHLERLLRLR. 155
58 1.000e-17UniRef50_UPI000DE4F79F hypothetical protein n=1 Tax=Vallitalea guaymasensis TaxID=1185412 RepID=UPI000DE4F79F  ali  24  5..NALEIINFAISIEEEGIKFYNEYSKLAKGEIKDLLLKLASDEECHADEFRKMLDKVSADNYYFSEEVDEYFRSYANHIAFNRRNQKLTSVKEVLEVAIETEKITTEFYQGLIPKTSDEKILKTLVEEETKHRVVLED... 144
59 1.000e-17UniRef50_A0A286TZZ8 Uncharacterized protein n=1 Tax=Candidatus Scalindua sp. husup-a2 TaxID=1284222 RepID=A0A286TZZ8_9BACT  ali  25  2.....DIYKYAMKMELDGRHFYLDLANKTNNKIKNILNMMAESEAKHYNVILSMQRNDKTEYSTDTEVLTEVKNIFERMKEEKKELNVDVSQVEFYKNALEVENNSEKFYKERADEETDKKILLMLAKEEKSHCILLENL.. 140
60 1.000e-17UniRef50_A0A1G2YC59 Uncharacterized protein n=1 Tax=Planctomycetes bacterium RBG_13_44_8b TaxID=1801960 RepID=A0A1G2YC59_9BACT  ali  28  5.FNALEVFKIAEKIERNGATFYRKAAELFDDNIRSLFQELAGWELRHEQIFAAMRKRHSESDYESKTPKSKDDLLLDAQAMPAGVFSGKMNKRDIVKIAIEKEKDSIVYYTGLTDFVPDKDKIDNIIKEEMHHIRILNQ... 157
61 1.000e-17UniRef50_A0A1F4T7L5 Uncharacterized protein n=1 Tax=candidate division WOR-1 bacterium RIFOXYC12_FULL_54_18 TaxID=1802584 RepID=A0A1F4T7L5_9BACT  ali  33  5.FHADEVLRGAIRIEENGEALYRELSGQTVDSLKTLFSSLADQEVEHRTIFMAMLEKIDLPESYPDEYYEYLKAFAGEHIFT----SERKDPVAGLAIALQAEVDSILYYLELRTLVPDRKIVDQVIEEERRHYLRLLRVKA 147
62 1.000e-17UniRef50_V7I7D5 Rubrerythrin n=1 Tax=Youngiibacter fragilis 232.1 TaxID=994573 RepID=V7I7D5_9CLOT  ali  28  8......IIAQAILNEVEGNEFYRMAANATRSETKETFLRLAAEELSHVKYLTELRKKLGEGLDPTEIMDLGPVPSPEIYKWGKITVEDSSLALSALSIGIKLEKDSIDFYREAKEKSESKEIFEKLVAWETVHLNILE.... 145
63 2.000e-17UniRef50_S7U0N0 Rubrerythrin n=1 Tax=Desulfococcus multivorans DSM 2059 TaxID=1121405 RepID=S7U0N0_DESML  ali  26  1MFLINEILDMAVQFEKNGEKIYREAADKVSDPLSALLAWMADEESHHATYFSRLKQKHPDSGNHSELSREMLDEILGDRGFEDVDFSNIADQNDMIRTFIEFEKDTILFYEMLTPFIEDKRMLETIINEENRHVERLT.... 147
64 2.000e-17UniRef50_UPI000B82596D hypothetical protein n=1 Tax=Methanococcoides vulcani TaxID=1353158 RepID=UPI000B82596D  ali  18  72..SVEDAVKLGISFEDQGRDFYLEFAESATDPAKDMFLYLAEEEKKHAKYLQSYLEGEDLSIEEDTDMPDFREA------FASEFTGEDLGEVGVMLAAMRLERKTEDLYLMLSSVSSDREFFEKLAAVERDHYDLIDGLLA 209
65 2.000e-17UniRef50_A0A1G1EBB6 Uncharacterized protein n=1 Tax=Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22 TaxID=1801687 RepID=A0A1G1EBB6_9BACT  ali  25  1MEEALALLKSAIELEKDGYKFYIEAAKKTDPKGKAIFEQLAKDEIGHEKALVAEYESLHQTGQLIQHPQTPLPKIFSSDPEGKARIKPSTTDLEALRIAMANEKKAVEFFSQARDKSHDKGLYSRLVAEEESHILLLEGEY. 154
66 2.000e-17UniRef50_A0A0F0CQ26 Rubrerythrin n=1 Tax=Candidatus Omnitrophus magneticus TaxID=1609969 RepID=A0A0F0CQ26_9BACT  ali  33  5.FSACEVIEMAVQIEKNGRDFYSAVYDMVKKKIKNTFLILMEEEIKHIEIFEKIFSSISPDAAYPDEYFAYLNAIAGAHVLFKKNEGKKDNAKDAISLAIQFEKDSILFYLEMKQVVPKKDLIDELIIEEKKHLRCLTSLK. 155
67 2.000e-17UniRef50_A0A2E9Y7B4 Uncharacterized protein n=2 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E9Y7B4_9PROT  ali  24  8...LVEVVREAIDLEVNGQRFYERATAVTRSKTKKVFRRLAEEEVGHLDEIGRIFTAITGSGDWKKIAERRIAGDAPSTVVEQLEAAESVDEAEALRLAMNMERRAIRLYEGLRDRTPDPKLAERLVDEERFHYDLLQ.... 154
68 2.000e-17UniRef50_A0A1F8ZZP7 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_43_22 TaxID=1797825 RepID=A0A1F8ZZP7_9DELT  ali  18  5..TIQEIFQFAINKEKDAQTFYRSTASLSQPGISPLFLELAAEEENHQKLLEEL-----PDPLTLPESSRSIPDLKISDYLMDLKFHKDMKYQEVMILAMKNEEKSLKFYRAWEAKAQDKKLFTYLADQEAQHKYRLESIY. 142
69 2.000e-17UniRef50_A0A1F5B8N6 Rubrerythrin n=2 Tax=Bacteria TaxID=2 RepID=A0A1F5B8N6_9BACT  ali  28  4VFNADEIFEMALQIERNGEKFYRDSAKRIKNEAQDLLTRLADMEIEHQKVFQGMKTALTPADDPNNEAGLYLASLANTKVFFEKDIDTSK-LEGIFKSALAAEKDSIAFYLGMKDVVPGKEKIEDIIKEEMRHIRILGERLA 154
70 2.000e-17UniRef50_A0A1F9Y7U2 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium RIFOXYB2_FULL_49_7 TaxID=1797968 RepID=A0A1F9Y7U2_9BACT  ali  27  4LFNMEEICSIGIEIERNGEQFYRKAAEQSQDALKKLFLELSEWENQHITLFENIRTQTSKDKPYDGEEGRYLKAIADSHIFIGKPVKACPTPDAILDKAIQFEKDSVTLYSALKAHVTDALDVERLIQEEVLHVALLVRKKA 160
71 2.000e-17UniRef50_A0A2H0XS17 Uncharacterized protein n=1 Tax=Candidatus Marinimicrobia bacterium CG08_land_8_20_14_0_20_45_22 TaxID=1975524 RepID=A0A2H0XS17_9  ali  31  3IFNVKDIFKIAVKIEERGEKFYRETAKLNSPKVVQLFNKLADDEAQHRVTFARMAEKLGETENLQDEFYAYLKAYTQNLIFDDDDFSKIKDARTALTFAIDKELDSVLYYTEIKNLIPEHAFVDEIINEERRHVVNLSILR. 151
72 2.000e-17UniRef50_K1Z9R7 Rbr2 n=4 Tax=root TaxID=1 RepID=K1Z9R7_9ZZZZ  ali  27  1MFTITDILNIAIQIEKNGEESYRNASKIAKDEVAKMLNWMADEEKCHAKWFEAFLTAEQGEMEAMGRSLLQEMVKGNTFLLAQSELEQMETVMEVLDRSVEFERDTILFYEFLLGIIDDRETLQRIIEEERKHLSRLE.... 147
73 2.000e-17UniRef50_UPI000730ED10 hypothetical protein n=1 Tax=Defluviitalea phaphyphila TaxID=1473580 RepID=UPI000730ED10  ali  27  6.YDAKEILKFAISMEEEGEKFYKKLAEKAKGEIKEGLLSLAEDEVKHKKIFTKWYDDINTDNKEDYLFEETVDLFFKSYAKFDGREEIPNSLEEAIDMGINTEKITIEYYKSLLEHAKAKEVLQNLIKEEEGHYNKLKTYK. 150
74 3.000e-17UniRef50_A0A1V6H2V6 Rubrerythrin n=1 Tax=Thermotogae bacterium ADurb.Bin062 TaxID=1852923 RepID=A0A1V6H2V6_9BACT  ali  50  1.MDKLDLLNIALRIESTGYEGYAQLAEKTKGKMKEFFSHLAAQEREHFETFKTIFQKIEKHEEPQSEALGYWQAYAQVAIFPKISNPKPATMQEAIHAAVEAEKESIIFYNGIKEYFEDKTEIQKIIQEEQKHLLDLLSL.. 144
75 3.000e-17UniRef50_C0QCB6 Uncharacterized protein n=5 Tax=Proteobacteria TaxID=1224 RepID=C0QCB6_DESAH  ali  16  5..TFEEIVDMAIANEIEAWEFYQAAAAKIKDPLKKMFQGFAKEEKGHEQLLRNILTKKTMVLNFNETI-----DYKVAETIDEPRLSLDMKPADAIALAMKKEERAMKGYTQLAEACSDKKVFVDLAAMERGHKLALEQM.. 141
76 3.000e-17UniRef50_UPI000D64AC31 hypothetical protein n=1 Tax=Moorella sp. Hama-1 TaxID=2138101 RepID=UPI000D64AC31  ali  26  1MFRASEVFAFARAIEQNGRAFYQAMAAGADNQVQQLFQRLAREEAQHILDFERLAARYDPPETYPGEYAEYMQALVDNNVFPRELDPQISNDQDALKLAMGFEKDSLLFFGGLKNLVPDVEAVDELLRQERRHLCEL..... 148
77 3.000e-17UniRef50_A0A151AZN8 Rubrerythrin n=5 Tax=Thermoanaerobacteraceae TaxID=186814 RepID=A0A151AZN8_9THEO  ali  27  1MFHASEVFAFARAIEQKGQAFYQAMAASADDKVRKLFQRLALEEGQHILDFDQLASKATPPESYPGEYEAYMQALVDSNVFPKDLHPETTTDIEALNFAIQFEKDALLFFSGLKNSVTETAMIDELLRQERRHLCEL..... 148
78 3.000e-17UniRef50_A0A1G2Z3X7 Uncharacterized protein n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G2Z3X7_9BACT  ali  29  5.FSADEVFEMAEQIERNGAKFYRQAAAKTASEVKDMFLRMAAMEDGHLQTFQEMRKGLAEAERGGDVFDPYNEAGFEGMISPTQELTGNESIQELLEIAIDAEKNSVLYYVGLRDLVPGRDKVDAVIREEVRHTADLRRQLS 160
79 3.000e-17UniRef50_A0A1M5GQ39 Rubrerythrin n=3 Tax=Desulfacinum TaxID=35836 RepID=A0A1M5GQ39_9DELT  ali  19  8..SFDDVVNFAIRKEELAMDFYQKCADRAKNPIREFFLEMVEEEKKHRKLLQDL-----DPAGLKDFTLDKVEDLKISDYLMDVEFREDMTYQEALTLAMKKEEKAHLFYSAWKDKCKTAKVFEMLAQEEIKHKRKIENIY. 145
80 3.000e-17UniRef50_F2NCV7 Rubrerythrin n=2 Tax=Desulfobacca TaxID=60892 RepID=F2NCV7_DESAR  ali  24  12.......LQIAIQMEQDGKKYYDQAAYNAKSEVRAIFSHLAIGEVYHIQRIQEIYDALEKDPTWTEDMCEFNPPAADASFFADAMAKAEMDDLKALDIGLSMEQKSIEFYQNLAKQAQDPKFLLSLVNEERGHYYYLMD... 152
81 3.000e-17UniRef50_A0A1G1F6F5 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A1G1F6F5_9BACT  ali  32  4.YSISEVIEMALQTERLGFQFYTTIAEKFRPELAKLFTTLASKEKVHERTFSELQEKVAPEPAQWEEVSDYMRAFVESEFFLGKSMEGIKTPQDAVRFAMGFEKETLLYFMGLRSMVSEKAAVDAVIDEEKSHIVWLTRL.. 152
82 3.000e-17UniRef50_A0A1F8NAC4 Uncharacterized protein n=4 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8NAC4_9CHLR  ali  31  4IFSGAELINIAIDIERRGISFYDVMAKSSENDARAAFAGLAGMEREHLKTFQGMLRENDAEETPPAEYPAYVRSLIDAAVFSDEMATQADTDVKAVELGINAEKDSLLFYYEMRDSLPHRPVINRIIAEEKTHLQQLAEIK. 155
83 4.000e-17UniRef50_A0A0S8FS01 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A0S8FS01_9BACT  ali  24  5.FSVGEVLEIAQQIERNGARFYRRAAEQAPSRVGETLLELAAMEDRHEQVFAAMAADLSDVERRPPAYDPYDESVFDLRTDPVEWLEGSRTMQQVLGRAMELEKDSIVYYLGVRGVMPDRARVDGVIREEMGHLTLLNTM.. 158
84 4.000e-17UniRef50_A0A1V5I6D5 Rubrerythrin n=1 Tax=Spirochaetes bacterium ADurb.BinA120 TaxID=1852913 RepID=A0A1V5I6D5_9SPIR  ali  30  3.FSTKELVDIAIGIEESGYYFYSQARKRFDDPFRELLAFLAEEELRHKEVFGNMLRNLGEPGVFTDEYYQYLKALGEDRVFRNNDVAKVNSIFDVLKIAMTAEKDSILYYSELQKIVDAVNVLKKLIDEERKHV........ 146
85 4.000e-17UniRef50_A0LN91 Rubrerythrin n=1 Tax=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) TaxID=335543 RepID=A0LN91_SYNFM  ali  28  5.FNAAEVFNIAIKIEENGKKFYDASLKVIQDPVRKLFADLAEQEVEHKKRFEALKAQLPKSWDPDNELDRYIKMMADEHVFLDQELARVTDVKSALRLAIEFEKDSVIFFLGLEDATQDQELIKALVKEEQEHLRRLSLELS 160
86 4.000e-17UniRef50_A0A1D8GIW1 Uncharacterized protein n=2 Tax=Geosporobacter TaxID=390805 RepID=A0A1D8GIW1_9CLOT  ali  27  5.FDGSKLLQTIIRNEAKVAEFYSNAAQMEEGKGKKIFESLAQDELKHEKIYTGLLNRLPDELELTEDDASYIALLIETDIFSQSDDVLTKSKEDALHIAEKIERDAILYINELKLLFPEPDEINIVLAEEKKHLRMVLSKEA 155
87 5.000e-17UniRef50_A0A0N0D2X2 Rubrerythrin domain protein n=3 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A0N0D2X2_9DELT  ali  15  4.KDIDEIIAYAISKEIEAEDFYLEAASQADSGAKELFEDFAKEENKHKTLLENL-----DKSQIQSFVPETVPDLKRSDYLIDMTYEKGMGFADILRLAMKREEKANKLYLDLSQKADIRQIFEKLAQEESKHKYGLESMY. 142
88 5.000e-17UniRef50_A0A1W9X6R4 Rubrerythrin n=5 Tax=root TaxID=1 RepID=A0A1W9X6R4_9DELT  ali  29  5.FNAEEVFKMAEQIERNGVDFYQNAAKNVEDESKDLLLKLADMEVEHEKTFAALRADLGAKDKTSSVFDPYLKALADTRVFFEKKID-VSSMEKILKAAIGAEKDSIVFYLGMKEAVPGKDRIEAIIKEEMGHINILSQ... 151
89 5.000e-17UniRef50_A0A0X1KSU7 Rubrerythrin n=10 Tax=Bacteria TaxID=2 RepID=A0A0X1KSU7_9THEM  ali  30  4MFNIDEIFEMAEQIERNGVVFYNKAAEMFPEYTKKIFLKLAEMEKEHEKRFHQMRLDLANKEDPQGEAAAYLRAMVSGKVFDAKRFNQVRSLSEVLRIAIDVEKDSIIFYLGLKEMIPGRDKIGLIVREEMSHVTILSDL.. 159
90 5.000e-17UniRef50_A0A0L6JU75 Uncharacterized protein n=1 Tax=Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933 TaxID=398512 RepID=A0A0L6JU75_9FIRM  ali  25  4VFSLEDIFNVMIELESMGSVHYSNMKNMTNSNLIVLFDKLSKQELAHKELYTRFKTETISAQKVDDEYKAYMDCLLTQTIGFLNGDREVTDFEKGFAIAVQLEKDTIMFLNELKEIIGSAEEIDRIILQEKAHLRALYE... 147
91 6.000e-17UniRef50_A0A1V4WQQ9 Rubrerythrin n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V4WQQ9_9DELT  ali  30  3LFTASDILQFAIRIEEDGEQFYRRAASFTKAEINHLFNELADEEIRHKKVFTDMLEKITDPGEFMDYLRDYIDGKVVFSTDLKTMADDIKDSVSALKFAMGRELESIAYYHEVKSFVPQKSQVDAIIMEERRHFAKLAE... 151
92 6.000e-17UniRef50_A0A1F9ET64 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F9ET64_9DELT  ali  30  5.FNADEIFQIGVQIESNGQKFYETIAKNTDPSAKKIFLDLAKWESKHIELFKKWQERLPDSAKRGDLFDPYLKATADSHVFIRELASKCKTPVEALDLAVTFEKDSVVFYTMMKKLVTEKAEMDTLIDEEISHIFMLTQKK. 159
93 6.000e-17UniRef50_A0A1V5LH59 Putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein n=1 Tax=  ali  21  8...LAESIRMAIDLEKSGRAFYLLAAERTANPTKTIFSRLAKEETQHLLTFERMLDDEEGLSGWRSWLKEYPNHPPLPEKAEKSIKEGSMDELQALRVAMKQEREAMEYYGRIAESSDNEAIFSFVREQEVYHHDLLQAEY. 152
94 6.000e-17UniRef50_A0A1F5FH79 Uncharacterized protein n=1 Tax=Candidatus Coatesbacteria bacterium RBG_13_66_14 TaxID=1817816 RepID=A0A1F5FH79_9BACT  ali  26  6.FSADEIYELAEQIERNGAAFYRKAALGFEDPTKDMLDDLAVMEDEHGKIFRELREKLTKKDRAASIFDPDNQAVFDTRVEPADVLTGEESLEKVLRYAIGLERDSIAFYVGLKQATPEKDKIEWIIGEEIGHVNTLSAKLA 161
95 7.000e-17UniRef50_A0A2G6JBV3 Rubrerythrin n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2G6JBV3_9PROT  ali  18  6..SVDEVLDFAIEREQAASDFYKDLATKASKPMAKVFEQFSREEIGHKKRLMSIKADHSLAP-----AAQKVLDLKVSDYLVDVEATPTMSNQDALILAMKREKAAFKLYTDLAASTDNKALFNMLAQEEAKHKLRFEIEY. 143
96 7.000e-17UniRef50_A0A2N2H7Y2 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2N2H7Y2_9DELT  ali  23  1MFSIREILGLAVKLEKNGELFYRAALSRSEPSLVSLLGWLADEELRHKEWFMSKKSDLKPRGEERAPDEAGDELLRDTFSLQEVDLSTIHDDETLLNIAIEFESDTILFYRMLLTMIEDRETLSEIIEEEDRHIQSLR.... 147
97 8.000e-17UniRef50_A0A2G6HT66 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2G6HT66_9BACT  ali  24  4.FNIEEILKIAIKIEQNGRKFYLKAAE-ACPEHRTWLTRLADEEIAHENVFATFFKNHTDEEPAFEDSETYLHSIADSIIFPARSFRENPTIDGIIEDALRREHEAILFYTGLKSAMYDEKTVDLIIKEEMSHVNWLKQ... 155
98 8.000e-17UniRef50_A0A2N5YV28 Rubrerythrin n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YV28_9BACT  ali  18  6..NINDILDFAIAREQGAVDFYTRLAEDVSNEMRDTFLQYAKEEMGHKAFLMKIKKEGT----FEMAPAEITNIKVSDYLIPEEKDTDKLTYPEALVLAARREKAAYELYLKLSETTSDKQLFNKLAQEELKHKNRFETEY. 144
99 8.000e-17UniRef50_A0A0S8FU53 Uncharacterized protein n=2 Tax=candidate division WOR-3 TaxID=1703755 RepID=A0A0S8FU53_9BACT  ali  26  6..SISDLLEVAIRVERCLLDFYKKMRDQIEHSGRDQFDSLASEEQTHVVMLRRFLDGIGEDEDGFRLKRGQVKSSHAMRVFSRAEETRTDDALEALSIGMELEMESIFYFTELHDMFEQQDLIAHILKNEKSHLLRLIAM.. 152
100 9.000e-17UniRef50_A0A1G3QJP7 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWF1_41_5 TaxID=1802188 RepID=A0A1G3QJP7_9SPIR  ali  24  4.LNVHEIIQFAVQIEKNGLDFYLDQKKNSRPEIKKIFSELAEDEIRHAEIFQAMSDKIEPAESFPEDYFLYIKSFSDRLIFNRIQAGQIRHPAEALDFACARELEAIAYYQEIQKITETRSAVEKIISEERGHFLKLSAI.. 152
101 1.000e-16UniRef50_A0A1G1PYZ0 Uncharacterized protein n=1 Tax=Omnitrophica WOR_2 bacterium RIFOXYA2_FULL_38_17 TaxID=1801873 RepID=A0A1G1PYZ0_9BACT  ali  31  5.YSIAEILQIAVQIEKNGRDFYEELVNLSYDEAIKVFTYLAQEEERHIAVFKKLLDSYDQQEVYPDEYFSYLNKLASEHVFTKEAANGIEDPVEAVDLGIKFEEESISLFQAMKKIVDNQNVIDILIMQEQKHLKDLSNLK. 155
102 1.000e-16UniRef50_D8F6M8 Rubrerythrin n=1 Tax=delta proteobacterium NaphS2 TaxID=88274 RepID=D8F6M8_9DELT  ali  27  5.FNADEVFRTAIEIEKNGVIFYKNGRNLAEDDVKEIFSQLEKDEEAHLDKLRKMRAELDIKRKTDEETNQYIQDTADMNVFREKYTTEIKTVEDALRLAIQFEKDAITFFLIMRDLTEDKQFVGGILSEEKEHLKILSR... 165
103 1.000e-16UniRef50_I0GJS2 Rubrerythrin family protein n=2 Tax=Caldisericum exile (strain DSM 21853 / NBRC 104410 / AZM16c01) TaxID=511051 RepID=I0GJS2_CALEA :_  ali  21  1MSDVLEVLKAAMEVELNGINLYKVAAEKTDDKAREVFLFLASEEGKHYKYLKDLHDAIKDKKEIEVNIPKPSISFRRIFSEDFLNNLKGKNEFSAISTGMILEKNSILFYKEQAEKANDAKLFEELMKWEEEHLNMLTNEY. 146
104 1.000e-16UniRef50_W4L4Z3 Uncharacterized protein n=4 Tax=Candidatus Entotheonella TaxID=93171 RepID=W4L4Z3_9BACT  ali  24  160....RDALEVAIANEEQGLHFYTNAVEVTVDEAKSVFSNLAEDEAQHLAALQQEYNDLRHAHSWLDDEPERLRGIFPKGNENIRHIVQLIGAAEALKLAMDAERRSQEFFSYYANRVEGREIFAKFAQEEEHHLQLIHDAY. 307
105 1.000e-16UniRef50_A0A1J5CTY7 Uncharacterized protein n=8 Tax=Chloroflexi TaxID=200795 RepID=A0A1J5CTY7_9CHLR  ali  27  11.....DILQTAIQMEVEGKEFYQQASRKSSNKAKELFQRLANEEAEHQKKFEEIYEALKRGQDWPDVELPSEKAKKLKSIFAQARFKVAESELEAIKTAMDMEIKTYDLYRSRSEQSTEKRFYEALAAEERGHHLALLDSY. 156
106 1.000e-16UniRef50_A0A2L2XFC9 Rubrerythrin n=1 Tax=Desulfocucumis palustris TaxID=1898651 RepID=A0A2L2XFC9_9FIRM  ali  25  5.FSLQDIVSMAMENEEKGHRFYSHMSLKVKNQARDIFHKLALEEIEHKKSFQKLLGSGQKEDALDGATKKYLKAIILADVFPEIDESRGDTPLWALGIGIQAEKNSILVYQEMYNKIPARDLFSKLLEEEKMHLVELRE... 154
107 1.000e-16UniRef50_A0A2J6WIB4 Ferritin n=2 Tax=Mesoaciditoga TaxID=1495038 RepID=A0A2J6WIB4_9BACT  ali  33  4MYAPNEIFEMAVKIEKDGEKFYSYLSKNFENPAKELFSYLAAQEAQHAKDFERISKEIVDEIDPWADAKPYLESLVNGRIFPMISKSKYMDMNEIVDFALSIEKETIVFYDQILDTSKVREILEKIIHEELGHVQKLLKIK. 154
108 1.000e-16UniRef50_A0A0S8K036 Uncharacterized protein (Fragment) n=1 Tax=Anaerolineae bacterium SM23_84 TaxID=1703388 RepID=A0A0S8K036_9CHLR  ali  27  7...ALDLLRIAMQIEADGYTFYSTAAAETKDAAVKMFLSLARDEMEHLGKLEMVYCALTKDKEWPSVERKPSRIVFPAPEEAAGAVTPNTRELAALKRGIQAEKDSIAFYQKALEEAADPEMYEYLIGEEEGHLAILNAEY. 151
109 1.000e-16UniRef50_A0A2M7PBN9 Uncharacterized protein n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2M7PBN9_9DELT  ali  25  17MFSISEIIDLAIQIETNGEDTYRKGASQTRDPIASLLRWLADQEKEHIEWFRNLKSRVDAGPVTAQLDDAAHEILRSTFSLADAEVSKQDNVIELLKVSLEYEKDTIVFYEMIMEFVEDEETLGAIVLEEENHVKALRD... 164
110 1.000e-16UniRef50_A0A2N6AXJ9 Rubrerythrin n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=A0A2N6AXJ9_9RHIZ  ali  25  5.FSVDEVFEMAEMMERNGADFYRKTAEKTDDPLKNFLVSLSNMEIKHEAMFRKWRKELAESDPPDNEGAMYLQTIVDGRVSFEHEEHGNESMQEILHGAIASEKDTVIFYLGIQEAMGDRDKIGRIISEELGHIRQLTQL.. 152
111 1.000e-16UniRef50_UPI0006D0FEF0 hypothetical protein n=1 Tax=Desulfosarcina cetonica TaxID=90730 RepID=UPI0006D0FEF0  ali  28  1MFTAHDILDIAIRLEENGEKTYREARRHTPDSLAALLTWMAQEEHNHARWFNRLKERLTEDEDSP-LLAEFSRALAESFSLQEVDLATIDTREKMIRTFIGFEGDTIAFYETLGSFIDDPEQLGQIVAEERNHIAQLQRLLS 151
112 1.000e-16UniRef50_A0A1V5CCD4 Putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein n=1 Tax=  ali  20  6....EQCLRQAIAMEEEGKAFYLNAASSSSNQARNVFEALANEEDYHIAKIGEVYRRVREGGSLSEWITCIAAGGPHEIFEKTLLMNATSSDIDALRLGLEIEEKSIKYYQGLADEATDKRFYLALAQEERGHYLKIMD... 146
113 2.000e-16UniRef50_UPI00040803CD hypothetical protein n=1 Tax=Desulfovibrio inopinatus TaxID=102109 RepID=UPI00040803CD  ali  21  147..TPLQLFQLAYAMEDGLERFYQELAGRIEPDVRELFTRLAGFEEKHKALVFTLAKRANTGISDENELKTNQFSNVMEGSSEKIQDALPSTIHAALEYAMQFEAMALDLYMRYAAKAEVEEALTELADEEKRHLHALGQL.. 291
114 2.000e-16UniRef50_A0A2I0P0Q2 Ferritin n=40 Tax=root TaxID=1 RepID=A0A2I0P0Q2_9EURY  ali  18  6...FKKILLMAIDREVDSYALYTALADKVKDALKTTFRELAKEETMHRKTLQEYL-----TGSRKELKFDEVKDYKLSNILDSPSPSSDMKPLDGLKLAIKKEEEAMEMYEKLADASADKKIFTELAKMERGHKGRLEDLY. 142
115 2.000e-16UniRef50_UPI000B59E215 DUF835 domain-containing protein n=1 Tax=Thermococcus gorgonarius TaxID=71997 RepID=UPI000B59E215  ali  21  24...VKEVLSYAIFNEKDEVEYYRKLAEHARESIKVLFIQMAEESQEHYDRLYSLFKKL-----YPDEEPVKVDAPPVEVAPLYPKFETVDDYLEALEYCMQSELFAKETYEVLALKAENEELFAQLAEMEKDHYLRLKKLY. 160
116 2.000e-16UniRef50_A0A2N1S428 Rubrerythrin n=2 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A2N1S428_9SPIR  ali  27  22...VMELFDIAIRMETEGAAFYRDLVNKATSEGKNIFKMLADDEDRHKAIFEAMKAN---TSIPASTTDASVRAAQIFKKFSKADFLGEENQLALYEDALEIELKSIEFYSEQHELVTDKRALANIIEEERRHYDLIDDI.. 159
117 2.000e-16UniRef50_A0A1J4T0Y7 Uncharacterized protein n=1 Tax=Desulfovibrionaceae bacterium CG1_02_65_16 TaxID=1805130 RepID=A0A1J4T0Y7_9DELT  ali  27  121..TAAELLERAWGMEMALEKFYGALAGRADPELSALFRRLAGFEQRHRRTLSEIWSRLDEGEIESFEVRAKAPSVLEGGIKAKDYMSDPADSAEALELAMAVEAQAQDLYLRRSAATDDPDMLLLLAEEERAHLKVLGR... 267
118 2.000e-16UniRef50_A0A1F5EYE2 Uncharacterized protein n=1 Tax=Candidatus Coatesbacteria bacterium RBG_13_66_14 TaxID=1817816 RepID=A0A1F5EYE2_9BACT  ali  21  3.KTVAQVLAQAIEAEITGFTTYLEFARQTRDETKNMFITLAREEVDHYEILRRQFNDAFAGKPIEPGEISRTEVPKLDSVAKRTAGAEGANELHALKTAIDLERAAIDYYTEWSAKADDRETFKNLAQMEEGHFELLR.... 147
119 2.000e-16UniRef50_A0A0Q1CFF0 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A0Q1CFF0_9DELT  ali  20  7LYSIDDIIAFALDKEQEAHDFYVYWAEKINHEITEVFLEFAQQELKHKEKIKNISL-----GESFNAPRQKVPDLKIADYLVEVKPTEDTNYQDALIIAMKREKESYNLYQDLAKLSNTRNLFLTLAQEEANHKLKIETLY. 146
120 2.000e-16UniRef50_A0A090AGP9 Rubrerythrin n=3 Tax=Thiotrichaceae TaxID=135617 RepID=A0A090AGP9_9GAMM  ali  17  22..SIGEILTTASSFEYNAFIFYTSLQEKVGEQLRSLVTELAKEEQAHYELFQGLSKHPYVQEQIAKLVPMPPSTDRFSYYTQAPALNEFIDDQAILQYAMGREQAAMDQYSSLAKEVPIQDLFYYLAHEEQQHKIELEKRYA 164
121 2.000e-16UniRef50_A0A2M7WFH1 Rubrerythrin n=1 Tax=candidate division Zixibacteria bacterium CG_4_9_14_3_um_filter_46_8 TaxID=1975520 RepID=A0A2M7WFH1_9BACT :_  ali  19  6MDSIKDILKFAIDREEEAANFYSHLAEKAKAGLKSVLKEFEREEWGHKKKLEQISA-----GAQAMPLLAKINDLKIADYTIPVKIAPDMSYQDILIVAMKREKASFRLYTDLASRAADTNIFKHLAQEEAKHKLRFETEY. 145
122 2.000e-16UniRef50_A0A1V4SBB6 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium 4484_190.3 TaxID=1956169 RepID=A0A1V4SBB6_9DELT  ali  24  1MFTVGEIIDLAIRIEKNGEKVYRKAAEEVSDPLSALLEWLADEELEHEKWFLRLREEEKTEEKIPQFEDMGKEILRQAFSMNDADFSHIDELNDLLSLSLEFEKDTILFYEMLGDFIDDEDTLAKIIEEEQRHVEHLE.... 147
123 2.000e-16UniRef50_A0A0G2Z912 Uncharacterized protein n=2 Tax=Kosmotoga TaxID=651456 RepID=A0A0G2Z912_9BACT  ali  38  1MFSAHEILDIALNIEVEGFKFYREMADKAKDETRSTFKFLAAQEEEHMVTFRTLLKKFEDEAQNWDEATEYLKTLSEHKVFPDEEMFKDSTPEEVIKYAIEREKDTVIFYYELLDMLRDKEAVNKIIKEEKKHVVILREL.. 151
124 2.000e-16UniRef50_C5CDG3 Rubrerythrin n=2 Tax=Thermotogae TaxID=200918 RepID=C5CDG3_KOSOT  ali  37  1MFSPHEILEIALNIEVEGYKFYMTMAKNSNREAKSTFQYLAKQEEEHMQTFKTLLKRFEEEADNWDEASDYLKTMSEHKVFPDVKRFANSEPEEVIRYAIEREKETVIFYYELLEIITDKEAVKKIIVEEKKHVVTLREL.. 151
125 2.000e-16UniRef50_A0A0B0EP44 Uncharacterized protein n=6 Tax=root TaxID=1 RepID=A0A0B0EP44_9BACT  ali  24  2.....DIYKYAMQMELDGRHFYLDLANKTDNAIKGILTMMAESEAKHYNIILSMQKNDKTPYSTDTEALTEIKNIFKQMK-DEKEINVDVSQVELYKKALEVETNSEKFYLERADGEKDKEIFLTLAKEEKSHCILLENI.. 139
126 2.000e-16UniRef50_A0A1G0WNZ0 Uncharacterized protein n=1 Tax=Ignavibacteria bacterium RIFOXYC2_FULL_35_21 TaxID=1798452 RepID=A0A1G0WNZ0_9BACT  ali  27  4.MTVKRAIETAIKAEELGITFYSELARKANQELKSVFELLSKDEVEHKRQFTDLLKGIKGDVSISKLDSAFMSGVDIASYFPAMEVNMNLKPSEILKSAYDFEKDSVLYYSAIRDIIGTNPVIDEIIRMEKLHMTQL..... 142
127 3.000e-16UniRef50_R4KCY0 Uncharacterized protein n=1 Tax=Desulfotomaculum gibsoniae DSM 7213 TaxID=767817 RepID=R4KCY0_9FIRM  ali  32  5LLTELDVYRIAITNEMRGASFYSSAANSTDDKTKAIFHKLAEEEKEHHKAFQAILQKAEEAEPLNKQTASYLKTLSENSVFPVEMNDARITPNQALAMGIQAEKDSILLYQELYSSADVKDMLSKLLQEEKLHLVELREQY. 153
128 3.000e-16UniRef50_A0A0F2N9F2 Uncharacterized protein n=2 Tax=Peptococcaceae TaxID=186807 RepID=A0A0F2N9F2_9FIRM  ali  21  1MYTGEEILKQAILNEHEGYHFYRLAAEKADDEVKNVFESMAEEEKRHEEWLRKAYGHMLENKPPIVEPFSVEQADSPGIFSEKRMMHQGL-EVSALHIGVMMERLSVEYYKEASEKTRVSNLYSELARWEQEHLEKLEKAY. 145
129 3.000e-16UniRef50_A0A2N2D1Y9 Uncharacterized protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-15 TaxID=2013776 RepID=A0A2N2D1Y9_9FIRM  ali  20  4..NDLKIIKTAILNEIEGEKFYKNAAQNAKNPTSNDFLHLAEDEKRHQEMLRGMMDQILAGQDYSFDV-KNLQGVPSLRIFNAVDSMVTDNSMEIFHIGILMEKASMDYYSKAAHSTTARSLYEYLAEWEMNHLEEMEKIY. 147
130 3.000e-16UniRef50_A0A1F3K1M5 Rubrerythrin n=8 Tax=Bacteria TaxID=2 RepID=A0A1F3K1M5_9BACT  ali  17  5.KNINDILNFAIENEQNSVDFYQKLAKNSKTEMKTTFEQFAKEEVGHKARLMKIK-----EEGIFESDGQKIIDLKISDYLISGDINENMTYEQALVLAMKREKSAFKLYLKLAERAPSQNIFLKLANDESKHKLRFEIEY. 143
131 3.000e-16UniRef50_A0A0S8IZ80 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A0S8IZ80_9BACT  ali  27  10......ILKDAIKVESDGYHFYKMAAEKTDPKGKEIFESLASDEIEHMEALKKQYQLYQNEGKLDWQEKEFEKESPIFSDDFKERITDSHFEMTALSIGIMLEQNSIDFYRKSAEKSEDKKLFSYLASWEGEHLRAL..... 152
132 4.000e-16UniRef50_K2NCM4 Uncharacterized protein n=51 Tax=Bacilli TaxID=91061 RepID=K2NCM4_9BACI  ali  24  23.......LEKAINGEYSAIQCYEKLAQKAKNEAKKIIQEIRQDEVRHYQLFSKLYYSLTGKNHKPS-----------------VTEPCPDQFREGLVFAFKDEQKTVDFYLTVSDYVRDKELMKRIAQDEQQHAVWFLYL.. 142
133 4.000e-16UniRef50_A0A2N2KPA5 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-12 TaxID=2013739 RepID=A0A2N2KPA5_9DELT  ali  17  39...FDAIIEKAIANEEEATQFYLKLAEIITDKAKDTLLYLANEEKQHKNYLLHYRQIGFIGNAADNDEAGNNK---IAEFLQSPQVKADMDSKEVYLLAAARELNSYNFYRGLAALHPDKQMLLKMANQEIKHKEKVEYLYA 178
134 4.000e-16UniRef50_A0A1F5AWF8 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=A0A1F5AWF8_9BACT  ali  21  7..DVMTLISEAIKLEINGQAFFNHAAEATGNVLKKMFTRLAQEEVKHLETFSRLFSAVIKSDDWKKQVRSEETSAVIQQLADRMKRAEGKSEVEALRIGMELEQKAVDFFSAGMADAAAREIFEKIADEERFHYDLLLAQY. 152
135 4.000e-16UniRef50_A0A1V4QUY1 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A1V4QUY1_9BACT  ali  30  1MFDIAELVKIAVEDERTGVSFYSALAERANPELKKVWAELAQQERQHQRRFEEMLKSLGEPEGYGGEYASYLRALTSNRAFPDEMAQESQGDAAAVDLALRFERDTLILMQEMRALVPDRAVVDELADEERAHIVTLTEARS 153
136 4.000e-16UniRef50_A8MM79 Rubrerythrin n=8 Tax=Terrabacteria group TaxID=1783272 RepID=A8MM79_ALKOO  ali  25  8......IIKQAILNEIEGYEFYNMAAQQATSESKEAFKELANEELKHAEYLKELFNKVK-NNPGDDFKLSFLENPPSPNIFDWKKLDRQYTAMSVFGIGIQMEKASIDFYEEAKANTEAKKFYDILIQWEKVHLNQFTEQY. 147
137 4.000e-16UniRef50_A0A2N5RD93 Ferritin n=10 Tax=Thermotoga TaxID=2335 RepID=A0A2N5RD93_9THEM  ali  39  1.MKVKDVLTMAIRLEEEGERFYRELSEHFDGEIKRTFLELADQERVHAEIFRNM-----SDQDLWDEVDSYLSGYAFYEIFPSIDERKDLTLKEILEIAISVEKDSIILYYELKDDSDEQKTVKKIIEQEKEHLRKLLALK. 141
138 4.000e-16UniRef50_C4XUA7 Uncharacterized protein n=9 Tax=Desulfovibrio TaxID=872 RepID=C4XUA7_DESMR  ali  27  125..TPRQILLAALGMEAALGGFYQKLADAAGDETAATFSRLAGFEERHLRHVHSLYAKETGETADLEALVAELEGGLPATAFLEMLGGEPASAREALELAASVEAQALDLYTRLARQTGDKALYETLSLEEKAHLRAVANLLA 272
139 4.000e-16UniRef50_UPI000CFB7259 hypothetical protein n=1 Tax=Vallitalea sp. S15 TaxID=2078660 RepID=UPI000CFB7259  ali  26  5..SIGEILRFAISIEEEGVGFYNKYSELAKGEVKELMLKLANDEIAHAEVFQKMYEEFAGHDDYTEEVDQYFHSYANHVGFSR-RKQELHSIEEALAVAIETEKITTDFYKGLIDKTKDREVLVRLVEEESDHGDILQ.... 144
140 4.000e-16UniRef50_A0A150FT00 Rubrerythrin n=1 Tax=[Clostridium] paradoxum JW-YL-7 = DSM 7308 TaxID=1121328 RepID=A0A150FT00_CLOPD  ali  26  1MLNELEVLKIAEGIEKEGERFYTQAMENEKNPIKEIFKMLAQEEKMHFELFKKMYEEAKEETKQNDDYAISLTAVFNTNGITNSKIRQVVDTKDALLIGIQAEKDAMLFYTKIYENAKTKKYLKKLIQEENDHLEKLINIY. 156
141 4.000e-16UniRef50_A0A1V4M116 Uncharacterized protein n=1 Tax=delta proteobacterium ML8_F1 TaxID=1775671 RepID=A0A1V4M116_9DELT  ali  26  4.FNGMEILNLLVESEGKVAQLYTDMAGKTDDKAKNLFMKLAGDELNHQKMYEALMADLDQDLELEDEDYEYIDSMIRYNYFRTEAVRDKDVKENALMVAEKVERDAVMLVQEVMELFPKPKEMKKILKEEKKHLKYVLQ... 146
142 5.000e-16UniRef50_A0A1F8Q633 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_56_11 TaxID=1797649 RepID=A0A1F8Q633_9CHLR  ali  17  5.LTLQSVLERAIQKEIEAQELYRSLAATVKNDARTMFRQLSEVEKKHEELLRKYVRGELGEG---TLKAGHVLDYRIAEHFKQPPIRPDMKLDEVLLLAAGREKASHELYMGLAAETPVRDLLEDLASQELEHKQRIEKLY. 145
143 5.000e-16UniRef50_A0A1F8MXR7 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_53_26 TaxID=1797629 RepID=A0A1F8MXR7_9CHLR  ali  32  5.FSGRELIDIAVGIERSGAAFYDYLTESTKDKIGIMYSELAAREREHIQTFQNMLGAADDYEPYEEEYGLYLKTLVDSAVFNNERAQKAASELEALEIGIRAEKDSILFYSAIQGLIRDADLIGGIIKEEKGHLAQLSDLK. 155
144 5.000e-16UniRef50_A0A1V5Y3K5 Rubrerythrin n=1 Tax=candidate division BRC1 bacterium ADurb.Bin183 TaxID=1852823 RepID=A0A1V5Y3K5_9BACT  ali  27  4.FNAQEILKFAVRIEESGEEFYSQAAALAESEAKQIFQYLAGQEREHKATFNAASAQMSFSGDYQAYLEAYLDNILFPVDTISSRVTALNDILNVLNFGIKSELDSILFYHESKRMLPAHDVIDKIIEEERRHFIKLLELK. 153
145 5.000e-16UniRef50_A0A1B7LF57 Uncharacterized protein n=3 Tax=Clostridia TaxID=186801 RepID=A0A1B7LF57_9FIRM  ali  31  7.FRAKEIVEFGRRVEKNGLAFYRTVAEKTADAVKEIFNYLAAEEEEHERIFAAMLPGLEPPESYPGEYQDYVRVLVDEHVFSSDTDPKVNNALEALNLAIGFEKDSILFFYELRGLVPERETVDKLIHEEQKHIRKLAQFK. 157
146 5.000e-16UniRef50_A0A1E7HQ09 Uncharacterized protein n=1 Tax=Desulfobacterales bacterium S5133MH16 TaxID=1869300 RepID=A0A1E7HQ09_9DELT  ali  35  4......................................................AEKTTTVFDPENESPLYLRALVDTRVFFE-KKIDISSMKEILKATIVAEKDSIVFYLGLKDFVPDKNRLDTIIKEEMGHIRILSK... 90
147 6.000e-16UniRef50_A0A1F8MXW9 Uncharacterized protein n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8MXW9_9CHLR  ali  26  10.....QALRTALQMEIDGKEFYQKSGAQSSNLLRKLFQHLAEQEDIHYRVIKEIYQRVTIKQAWPEKETPFARDKSLRSVFREKNSKATPSEIEAVKIAMQMEDQSYSFYRSRSEEADEKAFYQALTAEERNHYLTL..... 151
148 6.000e-16UniRef50_A0A1M7YGC4 Rubrerythrin n=7 Tax=Desulfobacterales TaxID=213118 RepID=A0A1M7YGC4_9DELT  ali  17  5..SLKGIIDFAISQEQEAADFYRSVGERVQDGKKHLFLQFAAEEDKHRRLLENLKSGSGGSDAVDTYTFTWITDIKRSNYVADLVYTPGMPYRDILMLAAKREEKALELYNLLLAKAEDRKLFKMLCQEEAKHKLALE.... 146
149 6.000e-16UniRef50_A0A212LRY3 Rubrerythrin n=2 Tax=Sporomusa TaxID=2375 RepID=A0A212LRY3_9FIRM  ali  28  11LFSDLEGLRIAIDMEARGRDFYKKAYEQAKNEHKDLFMFLMNEEIYHHEKFTALYNKLKENKDFDQETSKYLTVLAEPHIFPKDKLPELNTIADILKAALQDEKDSILFYDALAKCAEARTIFNQLKAEEQTHVVKLREM.. 165
150 7.000e-16UniRef50_A0A1F5R246 Uncharacterized protein n=1 Tax=Candidatus Edwardsbacteria bacterium GWF2_54_11 TaxID=1817851 RepID=A0A1F5R246_9BACT  ali  25  4......ALQAALKLERKGTAFYLKMSEKTGNLAKRLFDQLAMQEVEHIGRINEIYSAITQGQVWPEPKGKKIGYLEAEMKINHSKSREKPDNISGLKVAMDMEWYSYKMYQKFFSAAPEKDFFKRLLEEETKHYEALSNVYA 148
151 7.000e-16UniRef50_A0A1F7SQ23 Uncharacterized protein n=2 Tax=Candidatus Schekmanbacteria TaxID=1817811 RepID=A0A1F7SQ23_9BACT  ali  24  8...IQELIR-AIQAEKWGYEFYLGASQRAKDKAKKIFLRLTQEEVDHQLALKKLLEKM--DEDWDIEELTPVAMPGTDLPSLKKIAQSRISDKEALEIGIKMEEAAVNYYTELGRMVEDKKFFKQLVEFEKEHLTSLQKSYS 147
152 7.000e-16UniRef50_A0A2M9FW72 Rubrerythrin family protein n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=A0A2M9FW72_9RHIZ  ali  19  100..TLAELVGIANALEHEAERRYRWLAEEFEPETAEAFEGMAGEEEHHIVDVSRWADNLGQPVPAAESFFWRLPSDL-AESWDEVAGSALLTPYRAFAIAVDNEERAFAFYAYVSAWAEDRKIAEMLAREELRHAAKLR.... 241
153 7.000e-16UniRef50_UPI000D550F0B rubrerythrin n=3 Tax=Peptoniphilus TaxID=162289 RepID=UPI000D550F0B  ali  24  1MRNEVEILRQAMLNEVEGAEFYKLSADKAPSSTKDALLDLARQEEDHIEYLKSLSEKLIDDSRSINFDPETLKKEVPSFKWDKVDEDMVRLAVTVFSVGLNMEKDSVKFYTEAKEKVESKKLFDILAKWEESHVETLQKQY. 148
154 8.000e-16UniRef50_A0A0S8E6H2 Uncharacterized protein n=1 Tax=Planctomycetes bacterium SM23_25 TaxID=1704028 RepID=A0A0S8E6H2_9BACT  ali  28  6.FNEIEAAKIAQNMERNGLAFFQKAAEKAHPKVKALFEQLADDEVRHLEWLENLEEQLGPGYADDTEIAAYIDRLLQTQVFSDEGADQAGDASAALAVGMRAERDSILFYHEMLDFVDAKEAFEKILAEERDHLRILGD... 158
155 8.000e-16UniRef50_A0A2J6JDL8 Uncharacterized protein n=7 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2J6JDL8_9DELT  ali  22  7.FSGFEVIRAAMEVEKNGHRFYSTMSTLAKDPLRELFTWLAQDEVGHLNTLEKLAPKYSDGSFWADEFLPYLQRFSESEIFPEEVLKEEGADLKALDLAIEAEEKFADYFEAAAQNADGKEAFSWLAEEEVRHAQVLRERQA 158
156 8.000e-16UniRef50_A0A1F7RYL5 Uncharacterized protein n=2 Tax=Candidatus Schekmanbacteria TaxID=1817811 RepID=A0A1F7RYL5_9BACT  ali  21  3LKNIIELMKNAVHSEIDSQGFYQEAVKCTKDEAKKMFKRLIDDEKRHEKILTERYTGLTKDPLPSMEPHKKRIDMA------RKIVKGRTTEVDALKIAINKERWTHNNYLEMADNVKDKDLLQLLAQDELGHEQILVAEY. 141
157 8.000e-16UniRef50_A0A2N6BG22 Uncharacterized protein n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2N6BG22_9DELT  ali  26  8......ALEQAIKFESDGRDFYLRAAERVTNPAKAVFTKLAEDEKSHISRVREIYEELKDNAGWPSEMKMVAAASGVMDVFERESLSPDASAKEALEEAAKMEREGVAFYRLRANQATEREFFNRLVDEEVDHLAAIEK... 148
158 9.000e-16UniRef50_A0A081BX92 Uncharacterized protein n=6 Tax=root TaxID=1 RepID=A0A081BX92_9BACT  ali  17  6...FEQIMSVAIAREIEAHEFYQQVYERTEDEVKKVFAQLAKEELGHKELLEQFKY-----DPTMVMKIQAPPDYKVAEATELPKLSIAMKPADAIALAMKKEQQAVEFYRELRDRATDKDIFENLANMELGHKHRLEN... 140
159 9.000e-16UniRef50_A0A2W4KH19 Uncharacterized protein n=2 Tax=Caldicoprobacter TaxID=715222 RepID=A0A2W4KH19_9FIRM  ali  31  5IFNDLEAIKLAIAIEERGERFYRQSARKVSDSARVLLERLAEDEKEHKAVFEGLYQKFDDEYLYDQDVAAYFNALAHSLIFPNEEEDQLQSLEDVIRFGIQAEKDSILLYTQMSKLSEAKDAFRRLLKEEKRHLVDLQ.... 158
160 9.000e-16UniRef50_A0A0F8Z5W5 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8Z5W5_9ZZZZ  ali  24  10..TGDEVIQTAIQLEEMGRDFYEALGTATSDPMVELCRSLAQAEEDHPQVFQRIRSELARPDDRFAEARRAVKEAVLPDPDTIRRIADTGDVDNLLKMAIRMERDSIQFYMAIASGLPDHPAIEAVIREEQTHLRQLFAARA 157
161 9.000e-16UniRef50_A0A2V8BCG4 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8BCG4_9BACT  ali  22  3...ARDALRMAIATERSGLEFYTRAAAMTKDRGRTVFERLAGEEREHLATLQKRYRELIAQDPQLESRPTFLFFKGAASGLFAEQLRKGVNDEQALLIGIECERGSHEFFKRYGERFEDKQVFLEFADEERAHRDLLVREY. 147
162 1.000e-15UniRef50_D8K0X8 Rubrerythrin n=2 Tax=Dehalogenimonas TaxID=670486 RepID=D8K0X8_DEHLB  ali  27  10...MLEVINTAIEMELDGKECYLAAARDSGNAARALLQSLAEEEDGHRKHFEELYRKISDGHDWPEVDLQLRSDLTAACQALGMEVIGSEDERDAVKAAIEKENQSYKFYKTHAGKASEKQFYETLADEEWQHELALLD... 155
163 1.000e-15UniRef50_L0K6W6 Uncharacterized protein n=5 Tax=Halobacteroidaceae TaxID=53434 RepID=L0K6W6_HALHC  ali  28  5.LNGLEILKMAMNIEQQGKEFYQRCAKNSKPKVKKLFTQLKDDEEEHYQYFKRLLNNLNEEDKYNEEVSGYLRSLVDSKVFPEDEKEIAHNLEEALKIGIKAEKNSLLLYQELIQVEENSKALEKLILEEKRHLIKLQTMR. 158
164 1.000e-15UniRef50_UPI000DABA5EF rubrerythrin family protein n=2 Tax=Rhodoplanes TaxID=29407 RepID=UPI000DABA5EF  ali  17  75..TMADLFAVAHAMEADAVAYYTRVAADVRDALARLFERLATIEAGHVDLITSWSAEAGGTPPAQTPLPWPVPGMFDAPA-EEVGQSRLLTPYRALAAAVRQEERSFAFWTYVAATAPVRAAAERMAHEELDHVALLRRER. 219
165 1.000e-15UniRef50_A0A2N6C4U6 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium TaxID=2049433 RepID=A0A2N6C4U6_9DELT  ali  20  1MFSLKDIVDIAVQIEQNGEKIYRRAAENIQNPLSTLLQWLADEEVKHIEWFEALKDKIPDTGEHPEQAKFGRALLQNSLALEDAEFFAMEKVQDLINLVMEFENDTVLFYKMLQPLIEDQETLEQLIQEEEDHAERLKKVLS 151
166 1.000e-15UniRef50_A0A134AI84 Rubrerythrin n=1 Tax=Peptoniphilus coxii TaxID=755172 RepID=A0A134AI84_9FIRM  ali  23  1MQNEVKILRQAMLNEVEGAEFYKLSADKAPSGTKDALLDLARQEEEHVEYLKSLSEKLIDNAKDINFDPETLKEEVPSFNWDKVDEDMVRLAVTVFSVGLNMEKDSVKFYEDAKSKVESKKLFDILVKWEQSHVDTLQKQY. 148
167 1.000e-15UniRef50_A0LET4 Rubrerythrin n=1 Tax=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) TaxID=335543 RepID=A0LET4_SYNFM  ali  24  1MFSVSEIVDVAIQLERNGERFYRRGIEMVDDSMRQLLRWLADEEVRHREQFAAIKAGFLRREESRAERVSILQSAVSDHAFDEVDYSSIVDEAMLVDIAIGFEKDGITFYEIMQGFIDEPELIREISDEERKHIEVLTERK. 149
168 1.000e-15UniRef50_A0A0S8DAI6 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A0S8DAI6_9BACT  ali  15  49..NAEEIVALAWSLEEGSKLFYQGVADNFSDEALEMFNWLVSAEKSHENHLMKTYESLSGSQPDLEKLRSKFSDSLRGNVMEALAWVKDKGVTESLELAMAMEVNAYDLYIKMSRTIEDKQIFEKLSEEEQVHLERLASL.. 198
169 1.000e-15UniRef50_A0A1V5LCT8 Rubrerythrin n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5LCT8_9ACTN  ali  16  5..DIKSILEVAIGREEEAYEFYANVAERMTNPVKEIFGQLSQDELGHKMFLLA-----AQKDDQIVAKLPVPADYKVAEATELPALSIDMKPADAVALAMKKEQQSVELYRGLAQAASDPAMFENLARMELGHKARLETM.. 141
170 1.000e-15UniRef50_A0A1V4SLU2 Putative trifunctional 2-polyprenylphenol hydroxylase domain-containing protein n=1 Tax=Clostridium hungatei TaxID=48256 RepID=A0  ali  21  1MSKIKEILEYAMRMENDAQEFYSFNMDRVKSELKKLFEELAEMEKNHYAVLSSIYDILKVTPPPDDTSREKNISIIADNSELIITDENTISDLAVIRLAYLMESDFALFYSNAAAQVEDRNFLLELAEWEKKHETMFKERY. 152
171 1.000e-15UniRef50_D7EAI0 Rubrerythrin n=2 Tax=Methanosarcinaceae TaxID=2206 RepID=D7EAI0_METEZ  ali  15  15IESIEEAIDMAISLEQQGREFYLEKASQIKNPVKDMYEYLADEEKKHEQYLQQFKKDKQVSPVVEEEKAPDFKVSFSS------EFDDRLDEIGVLLGALRLERKSEDFYKQLAEMTGDKQFFKNIASVERGHYELIDGI.. 152
172 1.000e-15UniRef50_A0A2N6ED21 Rubrerythrin n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6ED21_9DELT  ali  15  4.LSFTEIVQVAIRKEEESEKFYQKAARMARSGIREMFLELAGEEAGHRKLLLGL-----GSGSAPEGHPEDVPDLRISEYLVEPPLTETMHYDEILRMAMKREEKAVHLYEHLLAKVQDRKLVTYLLEQEHRHKFRLEGEY. 142
173 1.000e-15UniRef50_A0A212PKP0 Rubrerythrin n=3 Tax=Desulfuromonadales TaxID=69541 RepID=A0A212PKP0_9DELT  ali  21  9.YTFEAAVEMAVQMEEEGFRHYLDALRKVENKAREILRDAALDELEHKHQLEKAL--VDGHMKGEGELAKRVPTMNLGYVLAKKELKPDSDVREALAYAIHLETNSIDFYRRMSAGAPMGNLFELLLADESRHLQSLEDMY. 150
174 1.000e-15UniRef50_A0A2N2B9P6 Uncharacterized protein n=3 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A2N2B9P6_9FIRM  ali  28  5.FSNLEVIKFAVGMEDMGIVFYEKYAKKSDGEIRTLFLRLADDERRHKAFFQNLLDETTKEGAFDYMFDESVTSFFEAFAQSAGFSREIKDIREAILEGITTETLTIDYYKELLTYSKEKETLEIIIKEEEGHLALLNGL.. 149
175 1.000e-15UniRef50_A0A1V5QE72 Rubrerythrin n=1 Tax=Verrucomicrobia bacterium ADurb.Bin345 TaxID=1852930 RepID=A0A1V5QE72_9BACT  ali  28  5.FSVNEVLEMAARIEANGGRFYRKAAKL-HVSARDLLNEIARQEDVHQKVFTEMRRALTPSEDLYGDTDLYLKAMVENQSFPAEFITGSESLADIFNIAIGLEKDSIIFYLGLKPLVPGREKLDAIVKEEMKHVAWLNQ... 155
176 1.000e-15UniRef50_K0NJ52 Rbr5: rubrerythrin n=20 Tax=cellular organisms TaxID=131567 RepID=K0NJ52_DESTT  ali  31  5.FNANEIFEIAIKIEQNGAIFYRDAAKQIKEEHKEFLLELAKMEDEHEATFATMQKDLQDEEKPDDETVLYLKALADIRVFFEKD-QPDNSFKGILNSAIQAEKDSIAFYLGMKELVPAKSKIDAIIKEEMSHIRLL..... 149
177 1.000e-15UniRef50_B5EIW2 Ferritin-like domain protein n=5 Tax=root TaxID=1 RepID=B5EIW2_GEOBB  ali  23  3......VFDFAMKIELQGKAYYETLAESARPELKGIFTGLAADEQKHYDLFKSLKEGKNWGMA-DSTMLMQARSVFTDLIERPEAPRETQDALGAYQLALKMEAESVMLYEQMAKKEEDPRLYLTLANEERSHYNILDNL.. 139
178 1.000e-15UniRef50_A0A1G3HTA5 Uncharacterized protein n=3 Tax=Betaproteobacteria TaxID=28216 RepID=A0A1G3HTA5_9RHOO  ali  23  11INTLPELLAHALAMETEAAERYGELADQMESHVAAIFRRLEKAEKEHLGDLAEMCSKVELPHIAPWDFKWNHSESPEAIDFTKVHYQ--LSVREAILLAFEHERKAAEFYAGIALTTTDQKLARQFAAEEQQHIGWLEAWLA 157
179 1.000e-15UniRef50_A0A1E3XD59 Uncharacterized protein n=18 Tax=Bacteria TaxID=2 RepID=A0A1E3XD59_9BACT  ali  23  2.....DIYEFAMQMEKDGENYYRDLAQKVDNKLKNILSFLADAEVKHHDILKKMKDN-EKTQLSETKILSDVKNVFEKMKEENDTSGADTSQIELYKDALEIEKKNHEFFLEKAEEVEDKEILLKLADEEESHCTILENI.. 139
180 1.000e-15UniRef50_A0A2N1U6A4 Uncharacterized protein n=2 Tax=Candidatus Riflebacteria TaxID=1817810 RepID=A0A2N1U6A4_9BACT  ali  20  20...LSEILDTAIAREEQAYFFYLDLIERADSEAKETLNFIAEEEKKHRRFLVDYKN---GKKGSTELSMATPIDYKLAEHLDEVDPDKPLTSTDIYLIAAHREKRSNQFYTELAGMHSDKNMLLKMASEELKHKEKMEYLYS 159
181 1.000e-15UniRef50_A0A1H3K726 Rubrerythrin n=4 Tax=Tindallia TaxID=69894 RepID=A0A1H3K726_9CLOT  ali  32  5.FNASKLLQVLVRNEARVAELYTNLAQMEEGKGKKLFEILSEDELKHEKIYSELLKKLSDEAQVSEEELEYLDSLIENDMFADSDKAMEKTKDEALEIAEKVERDGIMYIYELTRLFPEPKEMKKILNEERRHLKAVL.... 151
182 1.000e-15UniRef50_D9PLN2 Rubrerythrin n=1 Tax=sediment metagenome TaxID=749907 RepID=D9PLN2_9ZZZZ  ali  26  1................................MKALFRFLMEEEVKHVAAFEQIRDQLSVEMRPDEDMQAYMDSVIDDRLYADMDSKEAIHAKEVFRLAMGFEKDAILYFTEFLPYLTDRKIVSELIEQEKAHIRKLAEMK. 118
183 2.000e-15UniRef50_A0A2M9DKT9 Rubrerythrin n=5 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2M9DKT9_9DELT  ali  32  5.FNADNIFEMAEELERNGAQFYNTAAASVSDESKKFLLELAAMEVDHEKTFAQMRNTLSSNEKPEDESALYLRALADTRVFFEKEAPGG-DMKEILKSAITAEKDSIVFYLGMKEMVPEKDKLDGIIKEEMGHIRLLSK... 151
184 2.000e-15UniRef50_A0A2H0XZ30 Rubrerythrin n=1 Tax=Candidatus Marinimicrobia bacterium CG08_land_8_20_14_0_20_45_22 TaxID=1975524 RepID=A0A2H0XZ30_9BACT  ali  34  5.FNIDEIFEIALKIEKNGAKFYRKAMEFAKDETKKMLADLATMEDRHEKTFSNVHSQLGSPFDPNNESIAYLQAFADGYVFDSEQITGKESMEEIMKTAIGLEKDSIVFYIGIKHIVPERDQVDSIIREEMKHIAFLTD... 157
185 2.000e-15UniRef50_A7HJ23 Rubrerythrin n=24 Tax=Thermotogales TaxID=2419 RepID=A7HJ23_FERNB  ali  52  1.MTGKELLSIAVKVESTGYSYYSKLAEKASGNLKTLFQELANQERDHAKRFEEIMKKYENDSNFNEEVSGYAETYAKAFIFPEIENEQPETLVAAIRKAIEVEKDSIIYYNELRLIVPDPKPVEEIIKEEKEHLRKLSE... 143
186 2.000e-15UniRef50_A0A1G2W977 Uncharacterized protein n=5 Tax=Desulfuromonadales TaxID=69541 RepID=A0A1G2W977_9DELT  ali  23  7.FSGFEVIRAAMEVEKQGRQFYSILSTKARNEVREIFSLLAQDEIAHLKTLESMVSKYQDGAFWENEFLPYLRRFSSERVFPEELLKSGKDDLQFLELAIEAEEKFADFFRENSRTSDGRDAFAWLADEENRHAKILQD... 155
187 2.000e-15UniRef50_A0A176RW63 Rubrerythrin n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A176RW63_9GAMM  ali  33  10.FNADDVFEMAEQMESNGAKFYRATADSTDNELKKLFNHLADMEIAHQNLFKSLREELSEKEKPNEESTLYLQALVNSRVSFENEY-QGNSIESILKGAIESEKDTIVFYLGIKEAVPDKNQIDKIIKEEMAHIRILSQE.. 157
188 2.000e-15UniRef50_F3ZW90 Rubrerythrin n=1 Tax=Mahella australiensis (strain DSM 15567 / CIP 107919 / 50-1 BON) TaxID=697281 RepID=F3ZW90_MAHA5  ali  21  1MDKMQRILSFAIRLEKQGQNFYSYYKDQANPSTKKIFEQLAEMEDGHHQMLQDKYDEIYGSSEWVVDTSKYIKHPSIAQQLPEVEGDDDMSDLAVIRMAYSIESDFVEFYAAAEKEVDDKKLLNTLKQWEEGHKQFFHDRY. 154
189 2.000e-15UniRef50_A0A2I1MAJ3 2-oxoglutarate oxidoreductase n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2I1MAJ3_9FIRM  ali  21  226........EYALQFEQNAVDYYTYLSKNLNDSYRGIFESVAMQEVEHVDYIKALLEKLENHGDNLNQDFEAYKNIALFEDENYENDEDEMTI-SALKNALYIEYNELEFYKKASEKVDDKELYSELVKWENDHYNQFDE... 358
190 2.000e-15UniRef50_H0S827 Uncharacterized protein n=30 Tax=Rhizobiales TaxID=356 RepID=H0S827_BRAS3  ali  17  19..SLNEMFALANAMEQEAADRYTELAEEMRGELAQVFTELAVAEREHVDSVVKWSHARTGHAPDASLVRWQAPETFDADAVAEIERSRLMTPYRALSIAVRNEERAFAFWSYLADKADVRTASEAMAREELGHVATLRK... 162
191 2.000e-15UniRef50_A0A1V4MWZ1 Uncharacterized protein n=1 Tax=Candidatus Aegiribacteria bacterium MLS_C TaxID=1775674 RepID=A0A1V4MWZ1_9BACT  ali  28  5.FNALEVLTMAIQIEQNGQEFYREASAAVDDQVSTLLADLAKWEHGHESLFAAMKDELSEEEDPYGESGMYLSVMADDHVFRQKEMVRGKSTDEIIDLAIRFEKDSLLFFLGLERLVTGKERVYTVIDEEIGHISYLER... 158
192 2.000e-15UniRef50_A0A1F9YL21 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium RIFOXYA2_FULL_69_6 TaxID=1797963 RepID=A0A1F9YL21_9BACT  ali  21  9......VFDFAVKMEQDGEKFYRALAAKSADKVKFILNGLADDEVKHAKVLREL-EQGASPAMKQTEILAGSKNVFSDMASRKAFQSVGSDQMALYEQALELERKSRDYYTAHADDAPVRDLLLRIADEEGRHMFLLESM.. 145
193 2.000e-15UniRef50_A0A0C9Q1F5 Rubrerythrin n=11 Tax=Planctomycetes TaxID=203682 RepID=A0A0C9Q1F5_9BACT  ali  15  1.MDLNEIVKQAAQQEDKAYKFYMDALKYVKDEPSRILKELANEELKHKELLE-----HFDPSKIKKFKPSKIQDLHIAEYLVDKDISEIKSFQDVLIVAMKKEQKSYNFYVSMAKSADNKKLCKMLAQEELKHKHKLELYY. 139
194 2.000e-15UniRef50_A0A101IDT6 Uncharacterized protein n=2 Tax=Thermotogae TaxID=200918 RepID=A0A101IDT6_9BACT  ali  47  1MVGLKELMGIALKIEGAGFAYYQKLMERASGKMKELFADLAEQERAHAETFRTMLDDEEKDGWIEEESAGYLSSYAEISIFPKLQSDEPASFEDAVKLAMDVEKESIIFYSEIKEYLPKQRDIAQIISEEKDHLRRLVRIY. 146
195 2.000e-15UniRef50_A0A2M8D394 Uncharacterized protein n=1 Tax=Acidobacteria bacterium CG_4_9_14_3_um_filter_49_7 TaxID=1973888 RepID=A0A2M8D394_9BACT  ali  23  8...FREIIGIAISNEENAEKFYREAAEKVKDHAKKALLELAKEETGHAEFLKTILEKGVEEILSAQPTRG-IQDLKIVDYLSVKELNEYANYQDVLTAAMQREKIAYDFYSEMANLVHNEKILLKLAEVEMGHKNRLERLY. 148
196 2.000e-15UniRef50_A0A2U8PEE6 Rubrerythrin family protein n=2 Tax=Bradyrhizobiaceae TaxID=41294 RepID=A0A2U8PEE6_9BRAD  ali  17  19..SLDELFALAHAMEQEAANRYESLAQDMRGQGKEVFTKLAAAEREHVDSVTQWSQSRRGKSPDPALVRWEAPEALAPEAAAEVKTSRLMTPYRALAMAVRNEERAFAFWSYLAAYSKDPDIKEAMAREELGHVATLRKER. 164
197 2.000e-15UniRef50_A0A2I0N5P5 Uncharacterized protein n=1 Tax=Thermoplasmata archaeon HGW-Thermoplasmata-2 TaxID=2013853 RepID=A0A2I0N5P5_9EURY  ali  26  5.FSMCDVMQTAVEVEKNGEKFYKTLAERADNPAAKLFEVLASEEKKHIAKFQDIQESATKKPLVCEFDEETKQEVFTKEKLDAILKKKNMSAEDAIRHAADFEKSSILFFSELRDLVEDAKVIDLMIEQEKAHLTKL..... 150
198 2.000e-15UniRef50_T0LDT8 Rubrerythrin n=3 Tax=candidate division Zixibacteria TaxID=1379697 RepID=T0LDT8_9BACT  ali  22  6.LTSLEALGIAIRSEMDAQDLYEELGQMTASAVAGRFKQLLKEEKQHQKILEDMYNRLFPQ------VKLKLPPSVLPVIFSTKGKIANKSLAEVLQLAIDEERKSRDFYLDAAEQTPEKKMFRFLADMEYSHQMRLQAE.. 142
199 2.000e-15UniRef50_A0A2U3QEV6 Putative Sulfurtransferase n=1 Tax=Candidatus Sulfobium mesophilum TaxID=2016548 RepID=A0A2U3QEV6_9BACT  ali  25  126..TTGELISLALALEEGSRIFYTSVAELTSDEAKKLLTAIAEAEAKHKTNILEAYKLVTGEEHGEDILDEPLKGVMESGIKIEDAVSKGNTLIEILEVSMQVETNALDLYIKIIEKTDAKKVFTILIDEEKHHLSRLGKL.. 272
200 2.000e-15UniRef50_A0A0A8WT83 Rubrerythrin n=15 Tax=Geobacteraceae TaxID=213422 RepID=A0A0A8WT83_9DELT  ali  20  5.YTLQEALRLAVQAEKDSMDFYRRAVSVTNNEAKKVFELLANEEVGHLKAFFEHYKGGEFGDLKTFIDSPPNKKGATIMALEKA-IDEKTHEQKALEIAMKEEKATIEQYTILAQDIVDKKVFDQVVKETQNHYDMIEDEY. 147
201 3.000e-15UniRef50_A0A081C8F0 Uncharacterized protein n=1 Tax=Candidatus Vecturithrix granuli TaxID=1499967 RepID=A0A081C8F0_9BACT  ali  28  5.FNAELIFEIGVQIEKNGKAFYLEAAKNATDETKALFTELADWESAHIALFQQLKAELPEMADPENELISYLQAAADSHVFENSAVAQCRSTVDVFDLALTFEKDSVVYYTTMKKVVPDQAKIDRLIDEELKHIAIL..... 155
202 3.000e-15UniRef50_A0A1T4WK62 Rhodanese-related sulfurtransferase n=2 Tax=Desulfovibrio TaxID=872 RepID=A0A1T4WK62_9DELT  ali  20  120.....DVFSAAYNMEFCLADFYSRLADQSSQEVRKLFHELAGFEDKHMNAIYALYRRSVEPALDRASFAARTEGGVAPQWFLHDEQRILNSVSGGCELAMSIEAQALDFYSRCAQHAETGEVFFRLAKEEQSHLRMIGR... 262
203 3.000e-15UniRef50_A0A1E5L8X2 Uncharacterized protein n=2 Tax=Desulfuribacillus TaxID=1543703 RepID=A0A1E5L8X2_9BACL  ali  22  3.MKELEIIKKAVLIEKEGYEFYKMAAEKATEEVKDAFMFLANEEKAHLDWLMSLYEDIKADRNITLDIENLKEPDQPKRIFTWKNVSPESGAVSVFGIGANMEKNAIDFYRKAAKESEAKALFEKLVDWEAEHMDEFQKNY. 148
204 3.000e-15UniRef50_A0A2M7K5T2 Rubrerythrin n=9 Tax=root TaxID=1 RepID=A0A2M7K5T2_9BACT  ali  20  3......IYKYAMKMEKDSENYYRELANQTEDGLQNILKMLTDEEVRHYNIIEQMMKSKASAELAETDILKKVNNIFIKIKGKNLVFNFDLPQINLYRKAQEIEEKSYKFYIEMSDKVEQRKVFLKLAGEEKKHMFLLENL.. 140
205 3.000e-15UniRef50_A0A2M9DXP2 Rubrerythrin n=1 Tax=Desulfofaba hansenii TaxID=157842 RepID=A0A2M9DXP2_9DELT  ali  14  18.KTFEKSMDLAIGREKEAAEFYTRVAQKLTDPMKKLFTDLSAEEVKHAKTLTSLKKR-----DALHQIFKETPDYNISETLEKPEVSENMTPAQALTLAMKKEEEAMHYYKTLAEGCQDPETLMALSKMEQGHKTRLEK... 154
206 3.000e-15UniRef50_A0A1G1Q5A2 Uncharacterized protein n=1 Tax=Omnitrophica WOR_2 bacterium RIFOXYA2_FULL_38_17 TaxID=1801873 RepID=A0A1G1Q5A2_9BACT  ali  22  3......IFDYAMQIEKEGEALYQSFAKDSPQKLATIFTGLAEQEHKHYKTFKKMKYS-EGTESIDTPFLDNVKSIFTEWKKEKHKFKFKISQADLYRKALDIEQKSIDLYMEKSKEVDSRQIFKKIANEEKSHYEIMENI.. 139
207 3.000e-15UniRef50_A0A1W1XUB8 Rubrerythrin n=4 Tax=Desulfacinum TaxID=35836 RepID=A0A1W1XUB8_9DELT  ali  23  1MFSAWEVLKIAIKLEENGENYYRKAAALQKDPAIQVLEGLAEDEAKHKKWFRQFQDRLQEEPEDRWVQEISGDLLQSSFSLQEVDPAELDTMEKILATAIEFEKDTILFYDMLRGFMDEANALRQIIEEERLHVEVLEARRA 151
208 3.000e-15UniRef50_A0A1M5GV86 Rubrerythrin n=5 Tax=Syntrophobacteraceae TaxID=213465 RepID=A0A1M5GV86_9DELT  ali  32  5.FNAAEVFQIAIEIEENGKSFYEKAQAKIDDEVKAIFEDLAQQEVEHKRRFQELKDQLPQGADPQNEMAAYLKMMADNHVFRDAKVSQVKDAVDAIKMAMEFEKDSVLFFLSMQDATEERALIGLLVKEEQAHLRRL..... 155
209 3.000e-15UniRef50_A0A1F9HZG9 Rubrerythrin n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_02_FULL_57_26 TaxID=1797884 RepID=A0A1F9HZG9_9DELT  ali  15  1MNTVDEILDYAIDQEQQAADFYASVAARAKAGMKKMLLEFAEEEKRHKERLLA-----AKTGERKLTPEKEVLDLKISDYLVEVDASGNISYQDALIFAMKRERAAFQLYRDMAEKVQDKQVFLGLAKEEAKHKLFFETEY. 140
210 3.000e-15UniRef50_A0A1Z2TMI8 Rubrerythrin n=1 Tax=Thermococcus sp. 5-4 TaxID=2008440 RepID=A0A1Z2TMI8_9EURY  ali  22  13.LSPKEILGYALASEDDARELYEHLASKSGSLLGEFFGDLAKAEESHKRILLKLYEGLFGDTDYPVPQD-------IPFAETTVKIDTVGNLIEATRIALENERNAERIYSHLADMFPERGIFKFLAAQEKAHYAAIK.... 143
211 3.000e-15UniRef50_U7D8N3 Ferritin-like protein n=1 Tax=Chitinivibrio alkaliphilus ACht1 TaxID=1313304 RepID=U7D8N3_9BACT  ali  24  4.YNAREIIRMGVEIEKNGEQFYREAAQKHSNSIHDILLNLANWEVNHAQLFEKLAEKLPAEPDTEDLSFKYVKAAADSHIFIKNSVETCNTPADVLSMALTFEKDSVVLYQSMLDNMEGKSYIKEIAQEELKHVAIIQE... 159
212 3.000e-15UniRef50_A0A2J6HDF9 Uncharacterized protein n=10 Tax=Bacteroidetes TaxID=976 RepID=A0A2J6HDF9_9BACT  ali  24  27...AIDILKTAIIMEKRGQAMYEEVVEKTKSEVKKIFRTMADEENMHAKFLGEQLKNLMNNNSFQDLHAAEMDESIISEILTDKITSEISGEAAAIGAAIDMETKSIEVYRKRAEESNDKDLFNWLADWEKGHYEVLNKL.. 172
213 3.000e-15UniRef50_UPI0004785B71 hypothetical protein n=1 Tax=Aminiphilus circumscriptus TaxID=290732 RepID=UPI0004785B71  ali  31  4.LTAEELRNMAIALEETGAKFYRNAAGLLSPPLADLFNRLADWEDRHRDFFYELGFDTEAGEDPDEETAAYLRVLAGSRVFSAEPKGDAPTRRDILQDALDREKESVVFYSSLRQVVTGKEMLERITREELHHLQVLARE.. 153
214 3.000e-15UniRef50_A0A1V5KKW4 Putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein n=1 Tax=  ali  31  3VFNDLEGLRIACEMEKRGEAFYRNAARVSKREVIDMLESLAEDERQHLREFNRLYEEAARSDPYDDESNAYLSAIAADIVFPALRKEGFDDIHAVLDHAIQSEKDSILFYAELARMSGDEKAFLEIAGQERAHLSRLTRQK. 155
215 3.000e-15UniRef50_A0A1M7YJC8 Rubrerythrin n=5 Tax=Desulfobulbaceae TaxID=213121 RepID=A0A1M7YJC8_9DELT  ali  24  3......VFEFAMQMEKDGEKFYREIAEKTKDALKKIFNTLADEEVIHYNTFKSLHEKTAAKAVESNVLEKAKNIFTEMKAKGGLQVSDDTAQVEAYKKAMKAEEEAYTFYEKKAAEAADKNILLTFAREERRHYRLLEN... 139
216 3.000e-15UniRef50_Q9UZU3 Rubrerythrin-related protein, fused to C-terminal DUF835 domain n=6 Tax=Thermococcaceae TaxID=2259 RepID=Q9UZU3_PYRAB  ali  18  22.LSPKEILSYAIFNEEAEIRYYRELAKRSEREVRVLFLQMADESQEHHDRLYKLFKEL-----YPNEEPVEVDAPPVEVAPFYPKFETVDDYLEALEYCMESELFAKETYEVLALKATNEDLFAQLAEMENDHYLRLKKLY. 160
217 3.000e-15UniRef50_A0A1F4UAS5 Uncharacterized protein n=3 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1F4UAS5_9BACT  ali  21  18......IVREAIKLEINGRAFFEHAARQTGNELKKMFTKLANDEIQHLKVFGDIFSSVVNVQEWKSLIEQEETNKSEXXXXXXXXXXXXXXXXXAISIGMELERKAIDFFDKSANETSDPKLMKKISDEEKFHFDLLQAQY. 161
218 3.000e-15UniRef50_A0A1V5SS00 Rubrerythrin n=1 Tax=Candidatus Atribacteria bacterium ADurb.Bin276 TaxID=1852833 RepID=A0A1V5SS00_9BACT  ali  26  5.FSADEVLEMAVELERRGIAFYENLSKKTSDKSREIFIFLGEEEKKHLEYFQKTKDDLNTQIDFVPDTMDETSNYLGSLIENGVLGKGDSSIEKALEVGMEVEKESVKFYESMEIMVPEKEWLKKVIQEEKKHYAILLGIK. 156
219 3.000e-15UniRef50_A0A2G2DUN9 Uncharacterized protein n=1 Tax=Desulfotalea sp. TaxID=2030813 RepID=A0A2G2DUN9_9DELT  ali  20  7MFTFGDIKSIAVQIERNGEQSYLTASKSTDPKITAMLLWMAEQEGKHATWFSNLKATTAEQEKMESVGQELLQDMVRGNDFEEKNLEEITSVKDVLDVSITFEQNTILFYQ............................... 123
220 4.000e-15UniRef50_A0A1G3QZD0 Uncharacterized protein n=2 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A1G3QZD0_9SPIR  ali  28  4LLSSAEIFDLAKAVEKGGQAFYQAIASTTSPELRELFTHLAGEEVKHFHTFERLYPELEVDAEEWGQTSAYIQATSDSRFFVGEDAKTVKDPLKAVDIAIAFEKDTLLFFYELLGVTPAKEAARAIIEEEKRHVQLLSQ... 153
221 4.000e-15UniRef50_A0A1E7H8I8 Uncharacterized protein n=3 Tax=unclassified Desulfobulbaceae TaxID=231686 RepID=A0A1E7H8I8_9DELT  ali  24  1MFTVTDICNIAIQIEQNGAEIYRNASKTVKDPLARVLADLAKEEENHVEWFKSIQSDQTEQKEMEAIGRSLLQDIVKNNSFDKKMLENANEPGELITQSIELEQDTILFYEILLDFLDNDQTIEQLIQEEHNHIKKLETMK. 150
222 4.000e-15UniRef50_A0A2G9PQ62 Uncharacterized protein n=2 Tax=Candidatus Woesearchaeota TaxID=1801616 RepID=A0A2G9PQ62_9ARCH  ali  26  1.MDLKKALQIALDFEKKGHDLYKIAAEKSSPFVKTTFTYLAAQELQHIKDINVYLAEQPGDMKLSGDRPVDVKQFFNTTIQFKDKVTLNQSDTEAYETALALEKDAFNFYKEQLRATDDKKFFKFLMEQENSHFVLLEN... 143
223 4.000e-15UniRef50_A0A1V5YG95 Putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein n=1 Tax=  ali  15  6VKSAMQVLEDAKCLEQQGQAFYSQAAKRIKNPGKKIFRQLAKDEVAHEKLIQREILNLIKEGYWVELLETQGPAFPRGREGLAKAVNADPDDVEAILTGLDMENKSYDLYRTEAEKAKDRQLYEFLASQERDHFNLL..... 153
224 4.000e-15UniRef50_A0A0S7ZSP6 Uncharacterized protein n=1 Tax=Spirochaetes bacterium DG_61 TaxID=1704237 RepID=A0A0S7ZSP6_9SPIR  ali  19  1.MDLKKAFGVAMKGEIEGRELYRAAADRTNDKAKEVFMYLAEEEDRHFETLKAMYNSYSSEGKMPRIVRFDDASSPIFSRDFKKRIGEKHFEMSALSLALRLENDSVQYYAKMAKESDNKDFFNRLSQWEKDHYDAI..... 145
225 4.000e-15UniRef50_A0A1G3AH77 Uncharacterized protein n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G3AH77_9BACT  ali  28  5.FNAFEVFEIAEQIERNGTDFYIRAAELFDDDACQMFLRLAEWEKEHEGTFAQMKQQLSEQSRQVSTSESEDLAVFGIRTYPAEELRARQEKTDIIRRAVEKEKDSIVFYHGLKEFVPDKDRIDEIIKEEMRHIVVLDQ... 156
226 4.000e-15UniRef50_A0A1M7YDA7 Rhodanese-related sulfurtransferase n=1 Tax=Desulfopila aestuarii DSM 18488 TaxID=1121416 RepID=A0A1M7YDA7_9DELT  ali  18  125..DFSSAVSMALTMEMGLRRFYQLLADSADDDNRELLEYMARLEDGHMAKLKTLLPSTDDSVP---DTSSVAEGGFNVTEFLATYGDQLKTIETILHTGMRFEAQAYDMYSRLAQHADLREFYLQMAAEEQTHLKRLARE.. 263
227 4.000e-15UniRef50_C8VZ58 Rubrerythrin n=1 Tax=Desulfotomaculum acetoxidans (strain ATCC 49208 / DSM 771 / VKM B-1644) TaxID=485916 RepID=C8VZ58_DESAS  ali  27  4.LNVSDIARLAMLNEEKGARFYRSMTEKADSKAKDIFHKLALEETEHCKLFASLVRQSDKSERIEQKSAAYLKTLLQFNVFPDDVEDQVKSPQEALSIGIQAEKDSILLYQELFNNAKTKNILSQLLQEEKMHLIELR.... 146
228 4.000e-15UniRef50_A0A0K9IA37 Uncharacterized protein n=1 Tax=Desulfocarbo indianensis TaxID=1348163 RepID=A0A0K9IA37_9DELT  ali  20  6..SAEAILDFAIAREQEAQSFYRDLAGKVKSQAQKLLMEFVAQEARHEARLKGVKQGRKSLG-----AGGKVPDLKVSQYLAPTQPKPEMDYQDALMVAMQRERAAFALYSDLAGSTDDQEVFEALAQEEAKHKLFLEREY. 143
229 4.000e-15UniRef50_A0A1V5JS80 Rubrerythrin n=1 Tax=Candidatus Aminicenantes bacterium ADurb.Bin508 TaxID=1852832 RepID=A0A1V5JS80_9BACT  ali  24  2.....EIFDFAVKMEREGKSYYRSLSEKVSHRGKGILNLLAEEERAHAELIEKVHGGKEPQTLNSPVLKEAVSVFADMKVSLDL-PEFSAGEVELYKKALVVEEKSYEFYQRLSNESQDRKVFRNLAKEEKKHCFLMESLIA 141
230 4.000e-15UniRef50_A0A1D8GHY8 Uncharacterized protein n=4 Tax=Clostridiaceae TaxID=31979 RepID=A0A1D8GHY8_9CLOT  ali  27  4.FNELELLKMAKGVEEEGYRFYMEAAERFQDEIKQMFHYLALEEAEHVKVFEQLYDRVSEEYLMEEEVVQYLKAISDTAIFNTNRVQQVNTVRDALLIGMQAEKDAILFYETFLKNTKTQKVLERLIKEEVKHLYQFK.... 155
231 4.000e-15UniRef50_A0A1V6KGW1 Putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein n=31 Tax  ali  19  6...FKKIIANAIKAEVAANKFYSGVAKKAKDALKKLFQELAAEEAQHKLTLKGYMTKGAAELQFSESA-----DYRVADELPTPPLTPDTKPVDGLVIAIKNELAAMQMYTQLAKASADKKVFLELASMERGHKKRLEDLY. 142
232 4.000e-15UniRef50_A0A1H3JN31 Rubrerythrin n=2 Tax=Tindallia TaxID=69894 RepID=A0A1H3JN31_9CLOT  ali  21  1MNTEKSIIEFAMTMELQGQKFYESFMDQAENETAKLFKSLAQTEKEHYEILKAQYDSLNEKGKWLDLSDKLEQN-PDQLLFTKRKETENFSDLSILRMAYLIENDFAEYYQKAADQTKDKKILLTLCEWENEHRRLFHEEY. 152
233 5.000e-15UniRef50_I2F6P7 Uncharacterized protein n=10 Tax=Thermotogae TaxID=200918 RepID=I2F6P7_9BACT  ali  25  3......AIDYALKLEKDGKAYYTKQAQCSEDQLKKLFEMLANDEQRHYEIISGFKDK--NYKYKGTYTFKTTRNMFSEMLIDKKCFEIDATNLEAYEHAVEMEKESVKLYLDQAKQTSEKEILLKLAAEENKHQIILENL.. 138
234 5.000e-15UniRef50_A0A2J6XVU9 Rubrerythrin n=3 Tax=Dictyoglomus TaxID=13 RepID=A0A2J6XVU9_9BACT  ali  31  4LFSDKDILEMAIHIEEEGEKFYNLFSEKAKDEVKKIFNFLALEERRHAETFKEIYKNLEKEEFLTAYEDEEANKYLHAWVSAQVFIDWDRILKEAIDLAISLEKDSLLFYYGILDHLKEKKIVREIINQERTHLEQLITLK. 155
235 5.000e-15UniRef50_A0A1F7WTZ3 Uncharacterized protein n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1F7WTZ3_9BACT  ali  31  7..DITDVVEAAVRIERGGVDLYLKLYESASPKARDVFNFLAAEEEKHAGVFRKLLESYSPRYNYPGEYGQYLEGIASRMADAVKRGAAALDVKDAIKVAMELENMSIEFYADVQKQFENAETVQKIINEEKGHLAKLEAI.. 153
236 5.000e-15UniRef50_A0A1F9D951 Uncharacterized protein n=7 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9D951_9DELT  ali  19  4.KKFEEIIGFAIHREIESMDFYNKASNMVKHSTRDLFLDFVKQEEGHKRKLEEVLAGKIELGKI-----EKIPNLKISDYMVETELKPDISYGDILRIAMKREERSVKLYTDLNEKNQDRNVFSFLIQEESKHKYYIEKLY. 142
237 5.000e-15UniRef50_B1KW75 Putative rubrerythrin n=44 Tax=Clostridiales TaxID=186802 RepID=B1KW75_CLOBM  ali  23  9.......IKQAIINENEGYEFYKMVSKDTNSEAKKAFLELAEEELKHVKWLKDLFTKLKDNKVDSIDLKEIQVASPKIFAWENLDREGASKAVSVFGIGIQMERDSVDFYKKAAKDTEVQEIYEELAKWEQSHLEQFYKEY. 146
238 5.000e-15UniRef50_A0A2N1PCU1 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium HGW-Zixibacteria-1 TaxID=2013855 RepID=A0A2N1PCU1_9BACT  ali  19  2.....DILEFAMQMEKDGKAFYEKASGTTNPGLKKVLLSMAEEEERHYKYFKRLKEDPDDASFTGAETISKIQNIFEQMASNPKGVQFGENELSAWKEAFKLEEKSKKLYEEQAAKEGDPKLFIKIAGEEQNHIYMIDGMYA 146
239 5.000e-15UniRef50_A0A1G1F1Y8 Uncharacterized protein n=1 Tax=Nitrospirae bacterium GWC2_42_7 TaxID=1801694 RepID=A0A1G1F1Y8_9BACT  ali  17  1...MKKAVETAIKMETDAIAFYKEAAKNTKHVGREMFKGFVKDETRHLKMLKNIFNGLGIEADFHRPKEAVQTVFSKLKNKMMRRVKALDNEMEVIKIALNFEKAGYDFYKKAAAKADEKELFERLVVEENDHYTILNETY. 142
240 5.000e-15UniRef50_A0A2H0ABE1 Sulfurtransferase n=5 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2H0ABE1_9DELT  ali  20  127...FGDALQLAFAMEEGSQHFYQHLAAAATDELRHLFNRLAGFEERHKARLASLFKEKEGRELDAALAAATVGIMEGGGRLADQVAAGPDQITAVLDFAMALETQAYDLYGRLSKNESAKSLFIGLMDEERTHLGFLSRE.. 270
241 5.000e-15UniRef50_Q2LWJ7 Hypothetical cytosolic protein n=5 Tax=Bacteria TaxID=2 RepID=Q2LWJ7_SYNAS  ali  17  7....KEILSMAIGREIEAAIFYQDVCDKTADSLKTIFGNLAAEERGHRALLEGFLA-----DESRIMKFQAGQNYKVSETVERPKLSMDMKPVDAIALAMKKEEDAMNLYLGFSQASDDKNIFDKLAAMEQSHKAKLEDLY. 142
242 5.000e-15UniRef50_A0A081BQ05 Rubrerythrin n=1 Tax=Candidatus Moduliflexus flocculans TaxID=1499966 RepID=A0A081BQ05_9BACT  ali  30  4.FDVRDIFTIAMKIEENGQAFYATMAKQQSSELRSFFTFLADEESNHQKIFAAMLTRLSPVESAPTDYFAYLQAYVDISIFRPEEVEALRDLPAAINYSLSRESDSILYYHEIKGFLPDHAQIGKIIEEERRHYVKLSQL.. 152
243 5.000e-15UniRef50_U7DAC4 Rubrerythrin n=1 Tax=Chitinivibrio alkaliphilus ACht1 TaxID=1313304 RepID=U7DAC4_9BACT  ali  28  4......VWNTAIEMENKGIAFFEARAKETKSEALAIFTFLQNQEEKHRNFFMRISNSEPADMQSDDDAIAYARSAFDSDNFPALQE-ELEYSSEVYAQAKQMERDAIEFYTSLLDEAEQKRIIRVIIGEEEKH......... 135
244 6.000e-15UniRef50_A0A2M7F4X2 Uncharacterized protein n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A2M7F4X2_9BACT  ali  24  20.FNTDEAKKIAVALERQGFRFYHGIKDRVTGKARTVFEKMAEEEQKHVSDIESMITDPNSEGYPDPAVEEIVQRYFEGYMEGGIFPEGPDDEIQAVKLASNFEKDAVAFYSEMVRMTQDRKAFSDLVEFEKGHVRTLESL.. 171
245 6.000e-15UniRef50_A0A2M7SG97 Rubrerythrin n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M7SG97_9DELT  ali  30  4.FSGGEIIKVAIQIEKNGFAFYRSLADSIEQKVKMLFDHLANEEEKHIRSFESLYKDYEPDIPDKEEYYDYIQAMAGMNVFTKKELNKVKGKKDALDMAIRFEKESIIFFVEVKGLVRESQMIEELVHQEQEHLRKL..... 150
246 6.000e-15UniRef50_A0A0J1ISK8 Rubrerythrin n=14 Tax=Peptococcaceae TaxID=186807 RepID=A0A0J1ISK8_9FIRM  ali  23  8.FTGEEIIKLALEMEKSGKEFYEKALSYAQDQLKEVLAYLAKEEEKHLKDFEKLGERLSKEESYAGEYGDYLTSIVNNHIFNEDLVKGIKTDLDILRFALSFEKDSIMIFQEFENFVNNKDIVKDLLNEEKEHIKKINAL.. 157
247 6.000e-15UniRef50_A0A1G2XY27 Uncharacterized protein n=1 Tax=Planctomycetes bacterium GWF2_41_51 TaxID=1801957 RepID=A0A1G2XY27_9BACT  ali  25  3.YSADNVLQIAMQMERLGQILYESLAHRSDNEITALAAKLVEEEKKHLWTFQRMYYSLSIDRCGPKMTEEQLTTAAGKFYKEVRRIALSEDTSRVLAMAMQMESDSIAFYLTMTASPGDASVIRNIVEEEKKHLAALRKL.. 149
248 6.000e-15UniRef50_A0A1I4SPM0 Rhodanese-related sulfurtransferase n=1 Tax=Thermodesulforhabdus norvegica TaxID=39841 RepID=A0A1I4SPM0_9DELT  ali  21  127..SPGELIKLAYLMENNLEAFYIGLSDHYPEELRKTLGLLAGFEKSHKELLTRLYREEVGTSISIEFALDILEGGVGAGDIEATLSLSPDRPDEVLEFALTVEAQAYDFYYRCLTEWKDKKVLSELAQAEKKHMRIVGDL.. 270
249 6.000e-15UniRef50_A0A1J1C548 Rubrerythrin n=2 Tax=Caldithrix abyssi DSM 13497 TaxID=880073 RepID=A0A1J1C548_9BACT  ali  18  14..NIDEILQFAIEKEEEARTFYELWSQKVKQSIKEVLLEFAVEEQKHKELLLNVKAGRDFNQPKNQII-----DLKLGDYFTEVKAHENMTYEAALRIAIQREIGAHQLYQYLASIAENKELFDRLALEELKHKMRLENMY. 151
250 6.000e-15UniRef50_A0A1G1A5Q1 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium RIFOXYC12_FULL_60_16 TaxID=1798582 RepID=A0A1G1A5Q1_9BACT  ali  18  9...MDAVLDRAIANEESAAAFYRQAASRVTDALREALEGLMRDEVEHKRLIEEFRNGARP------LPEERTSGGSLLEYFGAPDFTPDLSPAEAFLLAARKEQLAVEFYEHWADLYPERELLLRLAEVERRHKVKVEYLY. 144
251 6.000e-15UniRef50_A0A2M7A0W7 Rubrerythrin n=1 Tax=Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_38_7 TaxID=1973971 RepID=A0A2M7A0W7_9DELT  ali  31  5.FNMDEIFELAEMIETNGANYYRKAAEIFSDQIKKLLSGLSEMENSHKIIFHAMRTELKENDKDKDQVAPYLRALADSKIFPSKKLSGNETLAQIFNTALNMEKDSIVFYLGMKEIIPEKNKIDGIIKEEMNHIIILNE... 159
252 6.000e-15UniRef50_K9GST0 Rubrerythrin n=2 Tax=Caenispirillum TaxID=414051 RepID=K9GST0_9PROT  ali  20  19...PEDLFAVATAMEREAARRYDQLAERMDDDLAALFRRLKAMESEHEEGIQAWATRAEVEPEQRLSFTWDMAEGIAEAALADAGGAESLTSYKALQLAVRNEERAFAFYANVAAKSSDREYAERMADEELHHVALLR.... 160
253 6.000e-15UniRef50_A0A1F4T813 Uncharacterized protein n=1 Tax=candidate division WOR-1 bacterium RIFOXYC12_FULL_54_18 TaxID=1802584 RepID=A0A1F4T813_9BACT  ali  27  4.LSAEDVVTIAIKMEDNGEMLYRRLAKKYSGDIGEMFNQLAEQELMHKSYFEGLLSTVKKEIWFKPDLFEFLKVFAGDFVFFPNNMTEFNSLAEALTFAMSTEKDAVLFYGELKNISSEKAAIEKVIEQEKAHFILLANEK. 154
254 6.000e-15UniRef50_A0A0S8HNA1 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium SM23_33 TaxID=1703412 RepID=A0A0S8HNA1_9BACT  ali  25  4VFTADQIFQIALELEETGQIFYEALAIACQQQVAALCRRLARDESNHYRTFDQMRRRLAGEVQQQESVQALINERVIPSPQAARELAAKGGLAETLDLAVKLEKDTVRLYQEMAAAVEDARAVRQIIAEEQNHVQELTN... 152
255 6.000e-15UniRef50_X0UFN7 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0UFN7_9ZZZZ  ali  30  4............................................RKHLKTFQNFYNTLKEKSENWEEAKLYLEALVDSKFFSSPEKAEAKDELEVIYAAIDFEKDTLLFFYQILEMIKSQELVKKIIEQEKKHILRLSTMKS 110
256 6.000e-15UniRef50_A0A1G5RTK0 Rubrerythrin n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1G5RTK0_9FIRM  ali  27  8.FDGKRLFKTLVLNEAKVAEFYTTLAEMKEGKGRKLFERMAKEELRHEKIYAALLDKLPNELDLDDEDAEYMNALIQDNMFDDAEDTVAKAKDDALTIAEKIERDGLIFVSELMRLYPDPDEIKVVLAEERKHLKSVLQAK. 157
257 7.000e-15UniRef50_A0A1C3FHN1 Rubrerythrin n=12 Tax=root TaxID=1 RepID=A0A1C3FHN1_9BACT  ali  25  4.......IEIALKMETDAVKFYTEASQKVHPAGKKMFLTIAEDEKNHIKMIEEVLKGLELTIREANPIKTVKTIFEEMKDQMMERLKVEEDELEAFRIAMEMEKEGIEFYKKVKNEVKEKKLFERLIYEEEQHYKIFSETY. 141
258 7.000e-15UniRef50_A0A2S8K6M3 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium SEEP-SAG9 TaxID=2100161 RepID=A0A2S8K6M3_9DELT  ali  20  12...PAEVIRLAYGMEMGLGEFYTKMAESTNDEMAAMLSNLAGFEEKHKLRLLELFRTIDQSPIDPQTFESDIEGGFTTEEFLEKNKAFLQTVADVLSIAMMLETQAMDLYMRYADKAKTKEIFFGLAEEEKIHLKHLGEL.. 157
259 7.000e-15UniRef50_A0A2U3CCB0 Uncharacterized protein n=1 Tax=Candidatus Heimdallarchaeota archaeon B3-JM-08 TaxID=2012493 RepID=A0A2U3CCB0_9ARCH  ali  17  1MAEIKEIIDFAIKKEIEAYDLYSGIAKTSNNPVQKLLQEIANDELGHKEALENLSRA----EEILNFDIDQVQDLKLSDHLQTTSIDEDSDLQEILVFAMKEEKGAYELYTKMTKAAQTKEIFQKLAQMELIHKNKLESLY. 141
260 7.000e-15UniRef50_A0A0F3GYE1 Rubrerythrin n=5 Tax=Bacteria TaxID=2 RepID=A0A0F3GYE1_9BACT  ali  30  6..SIHEIIEMAIRTEKLGFSYYSELAQKFKDELHALFNKLSENEVAHAARFTKLKESLQQDQENWPEVSQYMKSYVESAFFMGPHMQNIQDPNAALGLAIAFEKETLLYFYGMADAVKDKHVLDEIIREEKSHIVILSDLK. 155
261 7.000e-15UniRef50_D8K458 Rubrerythrin n=5 Tax=Dehalogenimonas TaxID=670486 RepID=D8K458_DEHLB  ali  32  5.FSPTELYDIAIAVERRGAAFYDTLARTCSSETREAFVVLAAMEHAHIQTFQRLAAEAPGEGAEAEEYADYFKALVESAVFNDDLVTKVDTDRQAVEVGIEAEKDAILFYEQLRDIVDAGEAIAGIIAEEKAHLRQLAAIK. 155
262 7.000e-15UniRef50_A0A069RQA4 Uncharacterized protein n=1 Tax=Peptoclostridium litorale DSM 5388 TaxID=1121324 RepID=A0A069RQA4_PEPLI  ali  31  3.FNELELLQMAQKIEQEGESFYTAAADRADDEIKAMFLNLAKEERCHREYFEKLYKEASEKSSISDEYLISSSAVFNKDGVMAAMLGQVKTAKEAIIMGIQAEKDSILFYSKLYESTSAKENLKKLIIEEEGHLNELLQLY. 157
263 7.000e-15UniRef50_A0A1W9REB7 Uncharacterized protein n=1 Tax=Candidatus Omnitrophica bacterium 4484_49 TaxID=1970784 RepID=A0A1W9REB7_9BACT  ali  28  5ILAPDEVLKLAIEIENNGKEFYESMAVKVKEELKKLSGFLAQEEEKHRKVFEEMLENLGETEIYSGEYQAYMKALSDECVFTQKILKEKENPGQLLDFALRVEKDSIILYTEMKQHVRNQSALDKVVEEERKHFIMLSELKS 156
264 7.000e-15UniRef50_A0A2M7TY93 Uncharacterized protein n=2 Tax=Candidatus Marinimicrobia TaxID=62680 RepID=A0A2M7TY93_9BACT  ali  18  14..TAEDALKQAILLEMNGHEYFIMAANSARSPARELFEFMAAEEDHHLKVLKITFNNLLKNGSWELPTKEELNFAFDNPILNHEFLDRLKEDSSAISIALTLEEKAFKFYQEAEKQTDDKKLFRWLTEWEMEHHERLRGL.. 158
265 8.000e-15UniRef50_A8F728 Rubrerythrin n=3 Tax=Thermotogaceae TaxID=188709 RepID=A8F728_PSELT  ali  22  8......VLKYALAREIEGRNFYKDLSKLSNSQLKDIFKQLAEMEQAHAEYIESLLK----DEIDAGLSFQGSQYFENRKLQEIGEKDEFLTDLSVLRMAYLIEHDFANFYENAAKKTDDKDSLISLANWEKEHRDMLRELY. 142
266 8.000e-15UniRef50_A0A1V5MJR8 Rubrerythrin n=1 Tax=candidate division TA06 bacterium ADurb.Bin417 TaxID=1852828 RepID=A0A1V5MJR8_9BACT  ali  32  4IYSAEEIVRIAVEIENNGNRFYREAARLARSPAVDLFKMLAEDEIKHRDYFESLSRQVPKTEAYPGELELYLKALADAAIFFKAITAAAFNEAEALELAVGAEKDSILYYHELLAFVPEKVYVRKILEEERRHLTSLR.... 152
267 8.000e-15UniRef50_A0A1F5BXB9 Rubrerythrin (Fragment) n=1 Tax=Candidatus Aminicenantes bacterium RBG_19FT_COMBO_58_17 TaxID=1797275 RepID=A0A1F5BXB9_9BACT  ali  30  1..NADEIFEMALQIELNGEKFYRDSAGKVKDEAQDLLARLADMEVEHQRIFRGMKSALTAADDPNNEAGLYLASLANTKVFFEKDIETSK-LEGIFKSALTAEKDSIAFYLGMKDLVPGKDKIEDIIKEEMRHIRILGERLS 149
268 8.000e-15UniRef50_A0A1V5LCQ2 Putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein n=1 Tax=  ali  19  1MADALSALEMAISREKGAQEFYAGVAEVLGVEARNKFKYLAVTEQGHFDQLSELYARIAGKKPAAPLMATEISG---------KSVSPDITATEALDLAISAEQKAYEYYRQMALRARAREMFEFLAAEEMEHKRLLS.... 133
269 8.000e-15UniRef50_A0A0U9HH76 Rubrerythrin n=2 Tax=Bacteria TaxID=2 RepID=A0A0U9HH76_9THEO  ali  30  1...MDEYLQAALKFEEDGYQFYTKISKETNQPAKRLFESLAIQENEHAKRIMEIYESLEVKPASRPAFSLEPEVKKIFYELDKDKKAMPLDNIEGYRLAMEMEKKGYNMYREFAEKVEDKEFFRLLMEEEKEHLSSLDNVY. 146
270 9.000e-15UniRef50_S0G8A9 Rubrerythrin domain-containing protein n=9 Tax=Bacteria TaxID=2 RepID=S0G8A9_9DELT  ali  28  5.FNVNEVFEMAIQIEANGANFYRKAAGMQKDPNKAFLEKLARMEDKHKTTFESMQKEVSEGEKQEDELSMYLKAMADNHGGEGDPFTGEEPIEEIITTAIGLEKESILFYLGLKDLVPAKDKLDHIIKEEKLHIAQLT.... 156
271 9.000e-15UniRef50_H1XQM2 Rubrerythrin n=1 Tax=Caldithrix abyssi DSM 13497 TaxID=880073 RepID=H1XQM2_9BACT  ali  20  6.KTLEEILKKSIQLEEEGFKFYNESAQKIKNSVKRMLERLANDEKNHVARFKQLYEAVTNNSVDQVKFSEREPTTFEMEGAVEELGEKGVDDQEIIEMAMDLENTTRFFYKEAAQKAKDKNFYELLAKEEDAHYEVLQK... 156
272 9.000e-15UniRef50_A0A1J5E4L3 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1J5E4L3_9DELT  ali  35  4.YNPAELLQFAVSIEKNGERFYRKAKELTEDEVRKLFHWLALEEVKHDRVFSKVLERFESMEQFPAEYFEYLRAFVENVVFTPERMDEIADSRTAIEFAMQREKDTILFYFELREHVEDRYMVEQIIREERVHYSSLARL.. 152
273 9.000e-15UniRef50_A0A1G1HCQ0 Uncharacterized protein (Fragment) n=1 Tax=Nitrospirae bacterium RBG_13_43_8 TaxID=1801705 RepID=A0A1G1HCQ0_9BACT  ali  23  3......AIEIAIKMEKDAIKFYTEASEKTKNPVKKMFLTIVDDEKRHLDKFSCIIKGLNITVDDVSPMENIKTVFESMKSEMMQKVESTMDELEAFRIAMQMEKEGIDFYKKAASEAKEKLLFERLIKEEQE.......... 132
274 9.000e-15UniRef50_A0A1Y0HJK8 Uncharacterized protein n=3 Tax=Sulfurospirillum TaxID=57665 RepID=A0A1Y0HJK8_9PROT  ali  24  4...............KDGERYYRELASKTDNGVKSILTMLADEEAKHYVIFDKMNKNQVIPTQPTVDIFQHTQNIFQKMRKENTSPRFTQDQIEFYKSALRSEESSYKFYTEMLEEGEQKKAFLRIAEEERSHLVLLENL.. 132
275 9.000e-15UniRef50_A0A1F8U0L3 Uncharacterized protein n=1 Tax=Clostridiales bacterium GWB2_37_7 TaxID=1797677 RepID=A0A1F8U0L3_9FIRM  ali  19  1MSDALNILAYAIKREEQGEQFYLANISKVNSKARSILEALAEMEKEHAVLLKSRYESLSKNGQWLPVLEDIKGASFEVEKTTKADLQSDLSDITILRMAYLIENDLAEFYNKAAESIDNKKLFLALSEWEVEHKNALYKVY. 150
276 1.000e-14UniRef50_A0A2X1AAM8 Electron carrier protein n=1 Tax=Bacillus circulans TaxID=1397 RepID=A0A2X1AAM8_BACCI  ali  20  88......FIEKAIDGEYSAISCYQHLINLAPSEIKERITEIRNDEMRHFRTFSNLYTQLTGKNHQ-----------------PKMIGNCPKQFNAGIDFAFKDEQETVDFYLETASKTDNKEAFIRAAHDEQNHAVWF..... 205
277 1.000e-14UniRef50_UPI00034B9059 hypothetical protein n=1 Tax=Desulfocapsa sulfexigens TaxID=65555 RepID=UPI00034B9059  ali  21  29...FSDVFRMSYAMEEGLRQLYLTLKDLCEDEVKDLLARLARFEEGHKAKLKALFPEVDEKGG--ENDLNTLEGGYNKQQLLDHFKSRVVAQNDVIQLGMMLETQAYDLYSRLAKKAENKEFFEFMVGEEKQHLVFLSNEY. 168
278 1.000e-14UniRef50_A0A0F3GPW2 Rhodanese homology domain/ferritin-like domain-containing protein n=2 Tax=Candidatus Magnetobacterium TaxID=40118 RepID=A0A0F3GPW  ali  20  129..SFETIISLAWSLEEGLRIFYSSCKELTKPEVIALFTKLTEAEDMHKTNIEKQYADITGKYDVEKIGKGTPHLMALLNIEETIQWCQGKDAPDIIELSMTIEANSYDLYAYLQRKVEDRTFFRKMADEELLHLRQM..... 268
279 1.000e-14UniRef50_A0A2V3JJU9 Uncharacterized protein n=1 Tax=ANME-2 cluster archaeon TaxID=2056317 RepID=A0A2V3JJU9_9EURY  ali  24  127.....DVLIVALMLEKGALEFYTKAQRLVKDEAAHVFERLVTMEDTHLQRLYMRYSQLLWDMKSLLGAADELPSLRIQEELVKIEDPEFMDDLEALEIGLEKEYAAYDFYTRVVDTVDDKNLLHELAGEEKGHINLLLQE.. 281
280 1.000e-14UniRef50_A0A1V4I6C7 Putative trifunctional 2-polyprenylphenol hydroxylase domain-containing protein n=1 Tax=[Clostridium] thermoalcaliphilum TaxID=29  ali  26  5.LNELEVLKIAQGIEEEGLRFYTEAMKRENNPLKEIFKMLADEEKMHAELFSNMYKEADDEYIFDEATSAYLRALSDTAVFNNSRLIEVVDTKDALLIGIQAEKDAMLFYTKIYEVSKTKEYLKKLIQEESEHLSKLMELY. 159
281 1.000e-14UniRef50_A0A2N2KKT2 Uncharacterized protein n=14 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2N2KKT2_9DELT  ali  32  4.FEASDIVEIAIRIEENGSNFYKFAEQIAKQEAKKLFADLAKAEVAHKKFFEGIFAKMEKHNPTESYDGEYDNNIIFTKEAMDKELAKVKDTVTAIDFAIRRELDSILYYHEIKRLVPQHEAIEQIIDEERKHYSLLTEVK. 154
282 1.000e-14UniRef50_A0A1F8QT57 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_57_8 TaxID=1797652 RepID=A0A1F8QT57_9CHLR  ali  16  7..TVADILKIGIQREIESQRLYTDLGQKVSNPAAKAFSMLFKEEQRHQEILEKYLKGGIGEGA---LEISHVVNYHIAEHSKQSEPTLGMKLPAIFLIAANRERQANEFYVSLAAIHPTRMLLEKLAAEELGHKLKVETIY. 146
283 1.000e-14UniRef50_A0A0E3SPP6 Rubrerythrin n=3 Tax=Methanococcoides methylutens TaxID=2226 RepID=A0A0E3SPP6_METMT  ali  15  6..SVEEAVKLGISFEDQGRDFYLEFAESATDPAKDMFLYLAGEEKKHAQYLQSYMSGEELSIEEEADMPDFREAFSSEFTEDK------LGEVGVMLAAMRLERKTEDLYLMLSSVSSDREFFEKLAAVERGHYDLIDGLLA 143
284 1.000e-14UniRef50_A0A2M7PAJ8 Sulfurtransferase n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2M7PAJ8_9DELT  ali  21  126..SPTDVIKTAYAMEEGLRYFYEKISQSQHGEAGSLLKKLAGMEEGHKRKLRDSYLSITGLKDAEELERFASEAKIMEGGFNMEDSLKPKTFTDVITKAMMLEAQALDLYLRCSRTLLEPKILNTLADDEKTHLSLLGDM.. 269
285 1.000e-14UniRef50_A0A1G3C399 Uncharacterized protein n=1 Tax=Planctomycetes bacterium RIFCSPHIGHO2_12_39_6 TaxID=1801977 RepID=A0A1G3C399_9BACT  ali  29  5...LKDIKSSALQMELDGIKFYNDLAEKTFHPLKAMFKSFVEDEKLHVKRLKTILDKRTSQTDVNDIINPKERIFQKMGDELKKKVNPSTNDIDAIKLAIEIEENGIKFYEKYAKEAKEKETYRFLAGEEKTHLDILKN... 147
286 1.000e-14UniRef50_A0A0W0GHT8 Uncharacterized protein n=2 Tax=Dehalogenimonas alkenigignens TaxID=1217799 RepID=A0A0W0GHT8_9CHLR  ali  28  9...MIQAISAAIELETEGRECYLAAARNSANEARKLLKSLAEEEDDHRRRFESLYQSVSRDHGWPAAPLQIRQNLAAVCREIGVKVAGAAGELEMVNIAIEKEKKSHEFYREHAEKATEKEFYTVLADEEWEHARALLD... 154
287 1.000e-14UniRef50_A0A2N2HPD7 Uncharacterized protein n=6 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2N2HPD7_9DELT  ali  21  58..................HRFYLEHARKTDNPVRAMFEQIAAEEMEHYARLRELHGKWLKEEKWPETVPLKVRNTVVKDVLAKMIREADKGDLEALETAIEFEANGALYYARLRDQVADKAFFNLLADIEHEHFVSLKD... 188
288 1.000e-14UniRef50_A0A1F7FS09 Uncharacterized protein n=1 Tax=Candidatus Riflebacteria bacterium GWC2_50_8 TaxID=1817874 RepID=A0A1F7FS09_9BACT  ali  20  7...LSEILDTAIAREEGAYFFYLDLIERAESEAKETLGFIAEEEKKHRRFLVDYK---SGKKGNTELSMATPVDYKIAEHLDEVEPNKQLSSSDIYLIAAHREKRSNQFYTELAAMHADKNLLLKMASEELKHKEKMEYLYS 146
289 1.000e-14UniRef50_A0A1G1BWA0 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium RIFOXYB12_FULL_65_16 TaxID=1798581 RepID=A0A1G1BWA0_9BACT  ali  20  2.....DIYEFALNMEKDGEALYREAARQTQNKLAAIFTFLADAEVAHCKALMAMRQGQKPELTGTVALDNVKNVFAPAGPDALVDREHTDLCVALYRRALDFEKKSVDFYLGKAGEEGDPRLLRKLANEEERHCWVLDNI.. 143
290 1.000e-14UniRef50_A0A2T5RC43 Rubrerythrin n=1 Tax=Geobacter sp. DSM 2909 TaxID=2135459 RepID=A0A2T5RC43_9DELT  ali  23  4.......LEKALQKEREMKTNYETIAGETQPGVKKIFTLLAGDEQKHYDAVLAMIRRTDPGHVPDTTALETAKELLSALTGDSETAAHLKKDLEGYRIALKLETESVRFYESLASNAEEKKLLSTILKEERNHYAIVANLY. 141
291 1.000e-14UniRef50_Q2LUX5 Hypothetical cytosolic protein n=34 Tax=root TaxID=1 RepID=Q2LUX5_SYNAS  ali  22  1MEKRLNALNVALQNETNEREFYLQQAGRTGNPLKAMFEQIADEELEHYERLKQLHDRWVKEEKWPETLPLKVKETSVKDVLKKQMAAGNADDMEALRTAIDFEAKGTAFYARLRDEVTDKAFFDLLSRIEHEHFSSLKD... 149
292 1.000e-14UniRef50_A0A2N1QSV7 Ferritin n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2N1QSV7_9BACT  ali  19  3MKNYKEILKMAVGNEVEAFEFYRDAAAKMKDPAKKTFQELADEESGHKVLLEGYLSNEMKDMKFIDEKDYKVTETVEAP----QTLSTDMAFKDAIALAMKKEQEAMEMYQQFADASEEKETFLELAKMEKGHKVRLESIY. 143
293 1.000e-14UniRef50_UPI00041E239E hypothetical protein n=1 Tax=Desulfobulbus japonicus TaxID=231447 RepID=UPI00041E239E  ali  23  1MFTLTDIRDIAIQIERNGEQTYRQAAANIDDEISKILLWMADEEERHAAWFSKQLSEAERQVEEMGRKLLQDMVQGQTFSLEGQELQETSSIDQVVQQSIGFEQDTVLFYEFLLSLIEDKKHLEAIIGEEKRHHNELKKLQS 151
294 1.000e-14UniRef50_A0A1W1H845 Uncharacterized protein n=1 Tax=Desulfamplus magnetovallimortis TaxID=1246637 RepID=A0A1W1H845_9DELT  ali  32  5.FSADEIFEMAKQIEVNGAKFYKEAAEKVQGESKEFLTTLAHMEEKHEKTFAKMHEQFKAMFDPDGEAVRYLKSLADSKIFFKKD-PPGDTMENILHSAIRAEQDSVIFYLGMCELVSDKNRVDKIIKEELDHIRILSQ... 153
295 1.000e-14UniRef50_A0A2G6N4Q2 Rubrerythrin n=3 Tax=Bacteria TaxID=2 RepID=A0A2G6N4Q2_9DELT  ali  21  26...ALDILKHAILLEKRGKAFYRTAAAQSTNKVKAFFETMAAEEVQHVKILSDQYKKATGRFKTPEDQESGTISKNVLTPEIKSRIAAADFEAAAISAAMLMEERAIALYAKRAQDAEEKKLYQWLADWEKEHLEFLADIDA 170
296 1.000e-14UniRef50_A0A0S8IJW4 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A0S8IJW4_9BACT  ali  28  3IFHISEVVDLGIEKEKRRRDFYDLVAKSFQEEAKKLFLRLRDWEATHIKRFTEIKESLGEEESYPGELSAYMRSLVDDKVEPKEFSQNVKTVLDAIQYGLGFEKDAILFFSELKGYTSDKEVIQQLIDEEKQHIIYLLNLR. 153
297 1.000e-14UniRef50_A0A1F9A1Q2 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_43_22 TaxID=1797825 RepID=A0A1F9A1Q2_9DELT  ali  20  10.....DMLSTALEMEEKGKAFYQKARGSCRNPQQEIFSALMEDEVIHTARIKQIHNKLTSGKCWTGDWESIKGFSGDPDLLFRKKIKAKTTDLEAVDIGLDLESASVKFYQEHRARATDPAFLDQMILEESGHWKALKD... 154
298 2.000e-14UniRef50_D5XE39 Rubrerythrin n=2 Tax=Thermincola TaxID=278993 RepID=D5XE39_THEPJ  ali  31  6.LTEKEIAQMAIDIEERGVRFYTGVAEMFNEEVKLAFYKLAEEEKEHARTFRQLFASLEPESSLEDVTVEYLKAIIHSTVFPEGREEQIKTPAEALHVGIQAEKDAILFYQEMYNKSKVKEVLSRLLEEEKLHLVDLRN... 152
299 2.000e-14UniRef50_C8VW70 Rubrerythrin n=2 Tax=Desulfotomaculum TaxID=1562 RepID=C8VW70_DESAS  ali  26  19..SVETIIDMAVRIEKAGQKFYSTLAYEYNEKIKDLLIFLAGEEAKHVKVFENLKNDLLDADSYSNDYLDYLNCIARTHLLFNIDIEKVDTARETLELALKFERDSITVFQEMLEVVNGKEVLKKLIEQEREHVLKL..... 164
300 2.000e-14UniRef50_Q6AM32 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=Q6AM32_DESPS  ali  20  13...IMDVYEFAMQMEKDGEEHYLDLVKRSSSPLQKIFTLLAGEEVEHYKYIDQLRQQSAVPQVKNRKVLKNVRNIFIEMREQKEATQAETAIIDAYRHARDIEEKSKTFYLERAKETKDKLIFEQLAAEEEKHLHIMQNI.. 154
301 2.000e-14UniRef50_A0A1M6MFP0 Rubrerythrin n=2 Tax=Geosporobacter TaxID=390805 RepID=A0A1M6MFP0_9CLOT  ali  24  1MENALQILQYAMEMEKKGQQFYASFKDQINNKTKAIFENLVKAEEDHYNILAKEYEKISKGESWSDPDSLALQSAQEEEKFDGERLSSAVSDLAIMRMAYLIEHDFAEFYRKALEKTEDRKILQALITMEEDHERFFYQEY. 151
302 2.000e-14UniRef50_X1FMY7 Uncharacterized protein n=5 Tax=root TaxID=1 RepID=X1FMY7_9ZZZZ  ali  23  3......IYKYAMKLEKDSENYYRELVDKIEDGLKNILKMLANDEVKHYHIIEQMMKTDVSAELAETEILENAKNIFIKIKGKNLVFDFDLPQINFYRKAQEMEEKSYKFYMEMSDKAEQKKIFLKLAGEEKKHMFLLENL.. 140
303 2.000e-14UniRef50_A0A1G2XZP6 Uncharacterized protein n=4 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G2XZP6_9BACT  ali  31  5.FTALEVLEIAEQLERNAAKFYRDASMAAKSKIQKLFFTLAEMEDKHKKIFAEMLADYQQNVDPDNEMLFYMNAMAEGKAAPKMVFKGNETPAEVLNSALKAEQASIDFYLGIKEFVKDKEKVEQIIKEEMTHVVYLQK... 156
304 2.000e-14UniRef50_C0QER8 Rbr2 n=1 Tax=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) TaxID=177437 RepID=C0QER8_DESAH  ali  22  4MFSISEIIALAVEIEKNAEETYRRAMDQSRNEVKALLLWMANEEKDHATWFNTLKDEIDKHQDLPSDKTMEMDGDFIGDLMEKQSFFLGDTDLTIIEIFIEFENDTILFYEMIKTHAPTIKHLEKIIEEENTHIKQLDKI.. 154
305 2.000e-14UniRef50_A0A2H6IE67 Rubrerythrin n=11 Tax=Bacteria TaxID=2 RepID=A0A2H6IE67_9BACT  ali  28  6.FSVREVVEQAVRTEKLGYDFYSSMAERFKDELRDLFETLAKKEQIHEERFKKLEESVSDEEPEWEDVSEYMRAFVESGLFLGTDMKEIQSVQDAVEFALAFEKETLLYFLGLKKAVADKGIVDAIIDEEQSHIAWLNRFK. 155
306 2.000e-14UniRef50_A0A0F8Z0I2 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8Z0I2_9ZZZZ  ali  19  41..SPEETLVVAYSLEAGLHDFYVSMIPRVKNDAKNLFEKLSEIEIRHQNTIFKEYLEITGKSVNRKEFEEAIEGGLTSEEYANMFQPDWESTKDIVDIAMSIEAQALDLYLRVSNQSIDKKVLLQIASEERTHLTLLGKL.. 187
307 2.000e-14UniRef50_A0A2M7SDL2 Uncharacterized protein n=1 Tax=Candidatus Desantisbacteria bacterium CG_4_10_14_0_8_um_filter_48_22 TaxID=1974543 RepID=A0A2M7SD  ali  21  7....LEALKMAIGMERKGQKAYSDMAARSRNQLMKVFAYLAKDEIAHIEAIKEFSVKLAGGRILPDVEKLVTREFNRPLEELKDSAGIGAGDLKAYKTAMQTEKDGYEFYKECLEGATDKKLFTFLIEEESSHYQILQDTY. 155
308 2.000e-14UniRef50_B0VF05 Uncharacterized protein n=8 Tax=Candidatus Cloacimonetes TaxID=456828 RepID=B0VF05_CLOAI  ali  22  32IYSVNEVIEMAVQIERSGYAFYNEAAKRLDEKAKDFLIYLRDEELRHEKTFLSLRDEVDLQVLQWELIAEYLKTIVESRIFNSEFATKAKDIKEIVENAITFEKDTLLYFHTLSDNINEPNALRKIINEEVSHILKLSEMK. 186
309 2.000e-14UniRef50_A0A1H0SQE0 Rubrerythrin n=2 Tax=Desulfobacterales TaxID=213118 RepID=A0A1H0SQE0_9DELT  ali  31  4LFKANDVVTAAIEIEKRGEKFYLSLVDQAEDKIRKVYEHLAREEVKHKQLFEELAQRLSKVELPAWEYLSYLNALIDSHPLFDEINKGVLSRKDALHIAIQFEKESILFFMEMREFVPEKTFVTQCIDEERDHLRRLSEM.. 155
310 2.000e-14UniRef50_UPI000B599DB2 DUF835 domain-containing protein n=1 Tax=Thermococcus siculi TaxID=72803 RepID=UPI000B599DB2  ali  19  21.KSPKELLSYAVFNEEEEARYYAQLAERAKRSVKALFLKMSEESMSHHEWLYNLFKKL-----YPGEEPVKVEAPPVEVAPFLPEFETVEDYVSALEYCMKSELFAKKTYEMLARVSTDEDLALNLATMEERHYEEIRKLY. 159
311 2.000e-14UniRef50_UPI000BE30800 hypothetical protein n=1 Tax=Candidatus Methanoperedens sp. BLZ2 TaxID=2035255 RepID=UPI000BE30800  ali  22  6.MEILNILKEAISIEIYGREYYSIFSDLIEDEAKLLFKGLSRDEGEHRQLLEKQFLKITGKSFDISTVDEVNREKARRIFPESLEPLNVQETRDILKLGIRTEERSIELYSKSADRTDNKDLFARLVLFETEHKKTLED... 147
312 2.000e-14UniRef50_A0A1G9GZN2 Rubrerythrin n=2 Tax=Halarsenatibacter silvermanii TaxID=321763 RepID=A0A1G9GZN2_9FIRM  ali  41  24.FSFNEVLEMAKDIEEKGENFYQNQAELTDNEAEKLFLRLAADENDHYRRFQKLQEDFQQETGREDEYSAYLEALVEFSVFPADEEEKVEDLEEVLGMAIQAEKDSILLYTEMKEDNTGAEALDKLIEEEKEHLVDLLRLDA 175
313 2.000e-14UniRef50_A0A1V4XL78 Rubrerythrin n=1 Tax=Syntrophaceae bacterium PtaB.Bin038 TaxID=1811716 RepID=A0A1V4XL78_9DELT  ali  27  4..TEISVIDYAVRQEELGVSFYTKAAEKFRGELAGLFMKLAKEEAKHLRDLMDVLRKGVEECFRDVEVDDYLDAVIREGLMPEERLDQVKTVEDACRIAMQAEKNAILLYTELAKRSKDKRILEAMIREEKAHMAKIAGMRA 156
314 2.000e-14UniRef50_A0A2N1UCS0 Uncharacterized protein n=1 Tax=Candidatus Riflebacteria bacterium HGW-Riflebacteria-2 TaxID=2013830 RepID=A0A2N1UCS0_9BACT  ali  22  7....LEIIRQALLLEKRGKTFYSKVAEHTHSAVSEFFSVMAAEEQEHIELLLKHYKSLKEAGNFVAEVNEDPLKTASEVVNTEIVAQITGADYEAISAAIHMEERAIKVYSERAESAEEKKLYTWLAGWERSHLHQLLEI.. 148
315 2.000e-14UniRef50_A0A1V4MYK7 Uncharacterized protein n=1 Tax=Candidatus Aegiribacteria bacterium MLS_C TaxID=1775674 RepID=A0A1V4MYK7_9BACT  ali  15  6..STEEILDFAIGEEQSASDFYTALAAQVKSPVRRMFMEFSEEELQHRNKLENIKL-----GSVEYLPRDRVMDLGLEEVLVDVAPTDHMDYQDALILAMKKEKAAYMMYMRLAEAASDRELLKGLASQEANHRLRFEIEY. 143
316 2.000e-14UniRef50_A0A1F5RI01 Uncharacterized protein n=1 Tax=Candidatus Edwardsbacteria bacterium GWF2_54_11 TaxID=1817851 RepID=A0A1F5RI01_9BACT  ali  20  13......ALNKAIKGEKTGLESYLKFARSTRSQGKDMFIRLAQDEFGHMELLEKERNRLQQGKRWPSDIEEVVPKLSSQQTRIKAE-QGTSDDLTALNIALDLERKAADFYMRQGNKETDKQIFFRLVEMEESHYNLIQAE.. 155
317 2.000e-14UniRef50_A0A0S8D3Q5 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A0S8D3Q5_9BACT  ali  31  1MFSLREVFDLAIQIEKNGEQYYRDALEKVSNPLKSLLQWLAEQEEKHQSWFSERKEKLDEDLEMAEMGSSILQGILGDQSFKEADLSEIEGVEALIELAVEFEKDSILFYEMIGSIIEDSEKLNEIIAEENRHIELLED... 148
318 2.000e-14UniRef50_A0A021XFD1 Uncharacterized protein n=2 Tax=Rhizobiaceae TaxID=82115 RepID=A0A021XFD1_9RHIZ  ali  18  14..TMEELFAIAAAMEQEAIAGYASLADRMRPDLAAVFEKLVEEESGHLGNVGYWSQRTTGKEPDPSAVRWSLDPTFDDEG-ASLVAPELISAYRVFSIAVRNEERAFTFWTYLASRSPSREAAEQMAREELSHIATLRQER. 158
319 2.000e-14UniRef50_A0A1F5U4S7 Uncharacterized protein n=3 Tax=Candidatus Firestonebacteria TaxID=1817802 RepID=A0A1F5U4S7_9BACT  ali  29  5.FTGSDIAEMGIQIEKNGKEYYDEVLRCSKSEAKQIFKFLGQEEVNHVVFFEKLLSSLEKEEAYSGEYYEYMKNLSALHVFTKKGKGKIKSDKEALKTAVDFEKDSILFYYEMKNFTKDKKVLDEIIKEEQAHLSKL..... 151
320 2.000e-14UniRef50_C7HSD6 Rubrerythrin n=10 Tax=Terrabacteria group TaxID=1783272 RepID=C7HSD6_9FIRM  ali  21  1MYDPIKIISLAMEMELYGHNFYKDNAEKSQNQTQAVFKKLSKIEWGHYEYLKNLLSKYKGEDVDEKDLEEFFDQRKESENLDQNLEQSMIPDMNVLRMAYLIEEDFRDYYKSMAKKVDDKEILENFSSWEDEHANIFKKEY. 152
321 2.000e-14UniRef50_A0A2G6M9M6 Uncharacterized protein n=1 Tax=Desulfobulbus propionicus TaxID=894 RepID=A0A2G6M9M6_9DELT  ali  17  41..SVEETIVVGFALEQGLQEFYLEMARVTGQKPADLFGVLARVETLHQQRLVALYEEVTGNSLSLEEMAAKVEGGLSTEDYLKLHAPDLESVLDILSLAMSIEAQALDLYQRAADRATDREALTQMANEEREHLVHLGR... 186
322 2.000e-14UniRef50_A0A1F9Y4X9 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium RIFOXYB2_FULL_49_7 TaxID=1797968 RepID=A0A1F9Y4X9_9BACT  ali  18  76.KNIQELIDFAISEEQQAVELYTAMAGRMSDKAAQMLLDMADMERGHEKRLRDF----NAGQLSTLNSTPQTRDLKIGDYLMTVKLRSSSTVQEALIFAIKAEMKSCALYTDLARIFQEPEFMKKLADEELKHKNDLEILY. 215
323 2.000e-14UniRef50_F0GXW3 Uncharacterized protein n=7 Tax=Anaerococcus TaxID=165779 RepID=F0GXW3_9FIRM  ali  27  5.FQPKDLLETLVKLEQNGQKFYEEMAKKFSDKNREFFEFLAEQETHHEVLYKNLSEKLDNNQSIDKEYDDEYKAYIQSMIFNFDSSNVGDDPIDIYRFSIGIEKDTILFIKEVRTIVPDPELIDRVEAEERGHIKLIHQWY. 151
324 2.000e-14UniRef50_A0A2N2GSS7 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-22 TaxID=2013750 RepID=A0A2N2GSS7_9DELT  ali  22  45..TLEQAIRNAVETERGANRFYTFIAQNTDPEAKKFLREMAEEEKGHAELIEKLGKKLVEGELPLHADA----FVALQETAPGWKFAEGISLVEALQIAAEAEQGAMMYYEMLADYFPEKQFFSGLVKAEEKHL........ 175
325 2.000e-14UniRef50_A0A1G1PP42 Uncharacterized protein n=3 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1PP42_9BACT  ali  21  6....LKILQGAIKMEEDGRRFYLKAGKTAKNAVKKLLASLADQELIHIKRIKEISYILKEDMDWNDLAKTISKDAKKKLALEKKKLKADPSNLEAITIAMKKETKSYDYYDKQSRETDAKVFYDRLKKEEERHYELLEEAYS 155
326 2.000e-14UniRef50_A0A2D3W046 Rubrerythrin n=2 Tax=Sulfurospirillum TaxID=57665 RepID=A0A2D3W046_9PROT  ali  23  3......AYEYAMQMEKEGELFYKDLAQEAEQELRKIFTMLANEEVKHYKMFEKMAKNSDSITVPKMEVYKEAKEIFADMKKLSVAYDIGDQQIDFYRRAMETEDKAYELYMQKAQEISDRKIFETIAAEELKHKELLENI.. 140
327 2.000e-14UniRef50_Q89XJ8 Bll0313 protein n=5 Tax=Bradyrhizobiaceae TaxID=41294 RepID=Q89XJ8_BRADU  ali  17  91..SLDELFALANAMEEEAAKRYSALAEEMKDALAEVFANLAAAEREHVDSVARWSQSRRGKAPDPALVRWEAPETFDAETAREIETSRLTTPYRALAMAVRNEERAFAFWSYVAAYSRDKQAAEAMAREELGHISTLRKER. 236
328 2.000e-14UniRef50_A0A101HPV5 Uncharacterized protein n=9 Tax=Mesotoga TaxID=1184396 RepID=A0A101HPV5_9BACT  ali  34  1MLSPHEVLEVALRIETEGENFYRELAESAHNDRQSVFRFLSSQERSHADTFRTLLRRFEEEAINWDDARQYMAALTEASVFSDELKDAMSDYKKAIEHAIEVEKKSIAFYESLLKKADTVEALEKVISEEKNHVELLEGLR. 149
329 2.000e-14UniRef50_A0A0S8I6Q6 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium SM23_61 TaxID=1703399 RepID=A0A0S8I6Q6_9DELT  ali  22  48.KSPEELIALAWMLEEGSRKFYTEMKEERSPETAALLRDLADDEKKHQSSLFKIYQKRSGKDSDPGFPQSLLSLEPGVDYLEALEWAQGKGPKDILEFSLSLEVNSIDLYIKMERRVEGKEVFQALSNQERNHLKRLT.... 195
330 2.000e-14UniRef50_E6U2Z0 Rubrerythrin n=6 Tax=Bacteria TaxID=2 RepID=E6U2Z0_ETHHY  ali  21  56...ALSLIGQAVAGESEDAQFYEWLLQRAPPEDRQIITGIRNDELHHNGWFRQLYLELTGRPVPS---------------MPGETFMPPANYCDGLRRAIQGEQHAVQNYRKILFALQNRNVLTEIITDELRHAVLYNYLYA 183
331 2.000e-14UniRef50_A0A1V5KPM1 Rubrerythrin n=1 Tax=bacterium ADurb.Bin478 TaxID=1866932 RepID=A0A1V5KPM1_9BACT  ali  25  4LFLASEILEMNVQEERNGAAFYSRLAEKAHPLVIKHAAEIAEQERHHEALFTRMLREVEPNEAYPGEYDAYRQALLKNKMFDAMEKAEQWTDKEALSFALKTEQATLNLLKELTKHIDPREFIQITVDEEANHVNVLNEL.. 153
332 3.000e-14UniRef50_A0A151EEB3 Uncharacterized protein n=1 Tax=Euryarchaeota archaeon SG8-5 TaxID=1803822 RepID=A0A151EEB3_9EURY  ali  24  3IDTSLAIIKQAIDIEQFGYEFYNNMRSFVRNRAQKMISHLVNMEVDHIRWLEEEYDRQLDRLDEFDDTEQIDVSIEGKSEMFVVDELPDSDPEKALEYAIMVEKRSMAFYANNLKITDDRQLFHRLADFEKEHIELL..... 147
333 3.000e-14UniRef50_A0A1W9RIJ6 Uncharacterized protein n=1 Tax=Candidatus Latescibacteria bacterium 4484_7 TaxID=1970771 RepID=A0A1W9RIJ6_9BACT  ali  20  7....LEALNLALTNEKKEKEFYLMHAGRTKNKIKDMFLSIAADEDVHYNKLLELYGKLEERGKWPEDFEATMSSSKLGVIIDRVINEAANSDERAVEIAIDFEREAEDFYKKLAGKAEERDFFDMLASFEREHRLSLED... 151
334 3.000e-14UniRef50_A0A1T5MBU5 Rubrerythrin n=1 Tax=Maledivibacter halophilus TaxID=36842 RepID=A0A1T5MBU5_9CLOT  ali  23  3......IYEFAMKMELDGKKYYEKLMNSAEDELKKIFKMLAQDEEEHHRIIKNMKDMNTKHIK--SETLKNANNIFSKMLCTDQKFNLSSTAIKAYEHALNLEDESIRLYEDKYEKSEEKKVFRSLADEEKRHKLIIENI.. 138
335 3.000e-14UniRef50_UPI00029A28DD DUF835 domain-containing protein n=1 Tax=Thermococcus zilligii TaxID=54076 RepID=UPI00029A28DD  ali  17  24...VKEVLSYAIFNEKEEVEYYRKLAERARESVRVLFTQMADESQGHHDELYSLFKKL-----YPGEEPVKVDAPPVEVAPFYPKFEAVDDYLEALEYCMQSELFAEETYAILAQKATHEEFFAQLASIENSHYKRLKKAY. 160
336 3.000e-14UniRef50_A0A085HMI9 Rubrerythrin n=1582 Tax=root TaxID=1 RepID=A0A085HMI9_9GAMM  ali  15  7.LSEREILALAISLEEEDNKIYREFAEETYPDSARIFSLMAQEEDGHRHRLLKLYKETFGDHI----PLIRRQDVKGFVERKAIWLSRPLSIDKVRRQSEVMEMETQRFYAQAAQRATSRQLLGDLAAEEFRHQQRAEQL.. 147
337 3.000e-14UniRef50_A0A2G6N818 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2G6N818_9DELT  ali  30  1MYTIADIYNIAIQIERNGEAEYRQAAQQTTDEMKKLYLDMARQEAEHAVWFTRLLEKTPDRQINEDELDELGAELLQNIIIDGKGLDEIDNMQEALMFSIALEEDTITFYQFLSDLLEDKEAIEQIIREEKRHIEKLREVSA 152
338 3.000e-14UniRef50_A0A0S7XV55 Uncharacterized protein n=5 Tax=root TaxID=1 RepID=A0A0S7XV55_9COXI  ali  23  3......IFDFAMEKEKLSEDYYRKLAGKTSNKLKNIFSMLADQEARHYETVSKMKEN-TPVQVSQTTVLSDAKKVFIKMRETAEEFKFDINQLDLYKKAQDIEEKSRDFYLGKAKEVKEKEAFRKLAEQEKKHYFLLDNI.. 139
339 3.000e-14UniRef50_A0A1Q8B740 Uncharacterized protein n=10 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q8B740_9BACT  ali  24  150...VRDALELTLAIERRGYTFYTNASQKTKSSGRRMFQRLAAEESDHXXXXXXXXXXXXXXXXXXXXXPARLPEIFPQKELLKIEVKDETSDIDALNIAMNLERRSHQFFKDFADHIADRKVFMDFAKDEESHLKALVAEY. 298
340 3.000e-14UniRef50_UPI00036BB1DD hypothetical protein n=1 Tax=Arhodomonas aquaeolei TaxID=2369 RepID=UPI00036BB1DD  ali  21  17..SVPALFALATAMEREAACRYDALAARMNAALARVFADLAEQEREHEHGIAEWGRRQGVDTDSLPGFRWQSPESLSEDAVADAGGEALMTPLRALELAVHNEERAFAFYVRIASEAEEREYAERMADEELGHV........ 155
341 3.000e-14UniRef50_A0A1G1F7U5 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1G1F7U5_9BACT  ali  19  55................GSRRFYAELSGSVDDEAQKLFGDLATAEKHHEESLANLYTKLSGKEAKADFHRALIPNGTSEDIMEGGMWAKGKGVRDVLELAISLEANAYDLYRNMGENAKARDVFSMLMLEEKQHLSRLASL.. 190
342 3.000e-14UniRef50_A0A2G6P5X3 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2G6P5X3_9BACT  ali  19  3IKDLKTAVNFAIEQEQNAADIYNSLLERSSNSGRKLFEELRNTEYDHKKKLQEL----DLDNVESFNEDDNIPNIKATDYLVEPDRNGDLDYEDILVLAAKREQKSYEMYKKFSEIFKDKQLFEILANEEKSHKYEIEKMY. 144
343 3.000e-14UniRef50_Q2YZU1 Uncharacterized protein n=1 Tax=uncultured delta proteobacterium TaxID=34034 RepID=Q2YZU1_9DELT  ali  21  5INKALEMLSKALDMEKEGKKFYKKILSQCQNDLVEIFTMLIKDESMHIKKIIDIYDTIKDEKKWPTELKKIKTENNDVHHIINSMLSKSMNDMEAIDIALDLENKSITFYKAQLKNASDKIFIEKMIEEEKSHHLALADMK. 156
344 3.000e-14UniRef50_A0A151FCQ6 Uncharacterized protein n=1 Tax=Theionarchaea archaeon DG-70 TaxID=1803813 RepID=A0A151FCQ6_9EURY  ali  18  13...LKEILGYAIESEEAAREYYTELAKNAPELVATRFHNLAREEEIHKKTVQKIYQEHFGDE-------GYTVPGNLPPLESSVEISTVTSLIRALDTAMWNEYNAYRVYKYLAKQEKHRNLFEYLAAMEKGHYEVVRMEK. 144
345 3.000e-14UniRef50_A0A2N2GYT8 Rubrerythrin n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2N2GYT8_9DELT  ali  19  1MMNIRDLIEFAIEKEQEAVDFYTKLATRVKDSVAAELHRLADMERMHKAKLQKI------DSTDPFWQRKHITDLKIADYVVESAPSEGMSFQDVLSISMKRELAAQRLYVDLARAVDDPEMMLVLAEEESAHKHYFETL.. 140
346 3.000e-14UniRef50_A0A0S8K0S5 Uncharacterized protein n=1 Tax=candidate division WOR_3 bacterium SM1_77 TaxID=1703778 RepID=A0A0S8K0S5_9BACT  ali  22  6...AIEGLKIALQTELNGIEFYRVAAEKTEDKGKQSFQMLAADEVKHFNALQQQYTSLIEENEWQSMDLGKAPDSPIFSEELRDRVKGRHFEVTALSIGALLETNSINFYRKMKEGTDERELFDQLEKWEQTHLHAITK... 149
347 3.000e-14UniRef50_A0A1F5FH40 Uncharacterized protein n=1 Tax=Candidatus Coatesbacteria bacterium RBG_13_66_14 TaxID=1817816 RepID=A0A1F5FH40_9BACT  ali  25  4LFTLGEALAIAQRIELAGEAFYGEALERAKPEAQELFHFLRDQERVHYTVFGEMLRTTPGGEQPLDEMDAAVRDHTLTTAEAAKGLAATGDTAALVEVALGFERETIRFFSTVKDVARDRNRLERILEEERRHVERLE.... 149
348 3.000e-14UniRef50_A0A1M5X6Q1 Rubrerythrin n=1 Tax=Desulfofustis glycolicus DSM 9705 TaxID=1121409 RepID=A0A1M5X6Q1_9DELT  ali  25  1MFTIDDIREIAIQIEKNGEQAYRRAAAAADPEIAALFTRMADDEREHAEWFSSIRSNSGDELELEQMGRRLLQEMVANQTFSQQELRQVRDVEDSLEQSRIFEEDTALFYEFLHSMIEDKSHLEVIIAEERRHAEQIAEL.. 149
349 4.000e-14UniRef50_A0A1I3VVC4 Rubrerythrin n=2 Tax=Bradyrhizobium TaxID=374 RepID=A0A1I3VVC4_9BRAD  ali  17  19..SLDELFALANAMEEEAANRYTALAEDMKSALAEVFAQLAAAEREHVDSVTRWSQSRRGKAPDPALVRWEAPETFDAETVREIGASRLTTPYRALAMAVRNEERAFAFWSYVAAYSQDKQAAEAMAREELGHVSILRKER. 164
350 4.000e-14UniRef50_UPI000D657471 rubrerythrin family protein n=1 Tax=Azospirillum sp. TSO35-2 TaxID=716796 RepID=UPI000D657471  ali  19  14..TADELLGIALALEEEAVRRYTQLAALMDTGVAATFRALILEEEGHAVAVRHWGASLGLPEADPSRFVWRLPPD-IAASWDELTDRTSLSPYQALSLAVLNEQRAFAFYSYIAAHAEARRNAESLAGEELRHAALL..... 154
351 4.000e-14UniRef50_I3INS1 Uncharacterized protein n=4 Tax=Planctomycetes TaxID=203682 RepID=I3INS1_9BACT  ali  17  1.MDVKEIIKQAAEQEDKAYKFYTNALKLVKDAASKVIKELAEEELKHKEMLENF-----DASKIKKFKPEKIQDLHITEYLVDKDITEVKDFQDVLIVAMKKEQKSYNFYVSMAKSADNKKLCKILAQEELKHKHRLELYY. 139
352 4.000e-14UniRef50_A0A2N2IMN4 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2N2IMN4_9DELT  ali  18  8...LMEGLREAMQAERHGHTFYKTAAMTTQDPGKEVFEQLAREELEHFEFLAAHYKSMLANQTLAKDVAQVDPQSPIFSDQLRERIKDAHFEMSAIAIAVQLELNAINRYRELAAKAEVKRFFEDLANWESSHYKAF..... 150
353 4.000e-14UniRef50_I5AZK2 Uncharacterized protein n=1 Tax=Desulfobacter postgatei 2ac9 TaxID=879212 RepID=I5AZK2_9DELT  ali  24  1MFTLNDLFDIAIKMEENGRSVYLNALKQTHNEIESLVQWMADEEKRHKSWFQEQKGRLSAGSRDLDVMLPGVIKEMNSLSLSELDFSKITTPVKMLETFIMFENDTILFYQFLEAFVEVKDGLHEIIAEETAHVDKISEM.. 147
354 4.000e-14UniRef50_A0A1M6EYQ6 Rubrerythrin n=14 Tax=Firmicutes TaxID=1239 RepID=A0A1M6EYQ6_9FIRM  ali  24  2.....DVLEFAIKMELEGEKYYTEQAKINKDSLSTVFLLLAKEENIHAKILENKVSKLSFDLEQ-SERLSEVKNVFNDLGTLKNELKQVPNQLDVYRSALENEKESINLYRKYLSEATDKKVFEYLIKQEEDHYAIIDQI.. 139
355 4.000e-14UniRef50_A0A1G3BM34 Uncharacterized protein n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G3BM34_9BACT  ali  12  10......IIELAILQEIKARDFYRSIASQLPDKGANLLNIMSDTEEEHRKILCNWYKRLTGNEPVIPESRKKEAKKLIA------TPPKNATIKDVVKIICEAEQKAFQFYTEAGEKAGDKNVFKKLAQMEKSHEDFFRGEY. 142
356 4.000e-14UniRef50_A0A101V637 Uncharacterized protein n=2 Tax=Desulfitibacter TaxID=293136 RepID=A0A101V637_9FIRM  ali  27  4VFKAEEVIDFAVEIEKNGQLFYQTLAEKLENELSLVFADLADQESKHIVDFQKLLGSLKDNESFPGEYQEYVKGLAENHVFTKGIDEAIGSPIDGINMAIKFEQESILFFHELKELVS........................ 128
357 4.000e-14UniRef50_A0A1V5KF60 Putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein n=1 Tax=  ali  22  6.LSQAQAVALAVNLEINGRAFYLQAAEKAHPTGKALFLKLAEEEKVHLAAFQAMLKREFDGWPESDETRAKPVPPLFDEKAAASFRRATADEMSALRIALKQENEAITFFEKAIALAEDRRIFTFVKDQENFHYALLQAE.. 151
358 4.000e-14UniRef50_A0A1G1J1Y9 Uncharacterized protein n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1J1Y9_9BACT  ali  32  5.FAGSEIVELGVQIEINGRDFYGYLFTKSKNKAKEVFANLRDAEEKHIAKFREILDKYDPKEAYPEEYFAHMNSMAQNIVFTKEIAKNVRDEIEAVDLGIAAEKDSIAFYTDMKKIVPQKDIVDEVIEQEKDHLNHLTDLK. 155
359 4.000e-14UniRef50_A0A2G6NP12 Uncharacterized protein n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2G6NP12_9DELT  ali  18  1MFRITDIITLAVQIEKNGEQAYRKAASQVKDKIKEMLLWMAAEEQRHRKWFEQLGETDKTVPDDPELEAMEEMVSKEPFSLEQKTLSEAQNVAELLEQSRGFEQDTALFYEFLSGLLDDPLAIEAIIAEEQHHAAQLDQL.. 149
360 4.000e-14UniRef50_A0A0Q3I5L4 Uncharacterized protein n=3 Tax=Rhizobiales TaxID=356 RepID=A0A0Q3I5L4_9BRAD  ali  17  12VKTLEELFAIAHAMEHEAAERYADIAGRMKDELAAIFERLSADEKGHLGQVAHWSKQTRGKAPDPALIRWKIPETFDDEGASTID-PRLLNAYRALAMAVRNEERAFAFWSYVAAQATVPEIAEAMAREELGHVATLRRER. 158
361 4.000e-14UniRef50_A0A192IJK8 Uncharacterized protein n=1 Tax=Rhizobiales bacterium NRL2 TaxID=1862950 RepID=A0A192IJK8_9RHIZ  ali  19  14..TLAELVGIANALEHEAEGRYRWLAEQMEPETAEAFGAMAREEGRHIADVSRWAENLGQAVPAAEPFFWRLPSDL-AESWDDAVDSALLTPYRAFAIAVDNEERAFAFYAYVSAWADDPKIAENLAQEELRHAAKLRTLR. 158
362 4.000e-14UniRef50_A0A0U5APW1 Uncharacterized protein n=1 Tax=Caldimicrobium thiodismutans TaxID=1653476 RepID=A0A0U5APW1_9BACT  ali  24  4.KNLLEAFLKAEELEIQGKEFYLDASEKAHPSVKDLFKQLAEAEEFHRIKIREIYQTFQAKKNIPAYVTKISQKQISPVFDPKEIEKVASTDLAALEEALRLEEKSIQYYQSLSDKSKDKRFLLALIQEEWGHYLSI..... 145
363 4.000e-14UniRef50_A0A1G3BJZ9 Uncharacterized protein n=1 Tax=Planctomycetes bacterium RIFCSPLOWO2_02_FULL_50_16 TaxID=1801981 RepID=A0A1G3BJZ9_9BACT  ali  21  4..TVDDIIRLAIEKEENAYKLYSGILNKISDPARAMISQLAQEELEHKE-----ALKKLDKKKLKKVEPKKIEDLKIAEFLKDRDITETSNLQDVLVFAMKREKEAYEFYSKFAQEVTDKKVLESFAQQELKHKRDIETFY. 141
364 4.000e-14UniRef50_A0A1G3R752 Uncharacterized protein n=1 Tax=Spirochaetes bacterium RBG_16_67_19 TaxID=1802196 RepID=A0A1G3R752_9SPIR  ali  21  6...AIEVLKMALLLERQGMAFYAQVAGQTRSPVRELFRTLAEEEKKHAEMLAERGGPAAAARGAVPDTLAKLVLSGD----IRKQIGAASYEAAAISAAIDMENKAVALYSQRAGQAADRDLYQWLADWERGHQRFLARI.. 142
365 4.000e-14UniRef50_A0A1M6NCJ1 Rubrerythrin n=2 Tax=Desulfotomaculum aeronauticum TaxID=53343 RepID=A0A1M6NCJ1_9FIRM  ali  22  8....LQAIKTAILNEHEGHQFYLLAAEKGSDEVRNVFLYLAEEEQRHEYYLRRLYDAVENNIDMKKEENCNLVKAPNIFKEEDLKREKPSLIVSALSMAVKMEKESLEFYREASAKTKDRKVYLELAEMEGEHLDTLNLAY. 149
366 5.000e-14UniRef50_A0A062V045 Rubrerythrin n=3 Tax=Candidatus Methanoperedens nitroreducens TaxID=1392998 RepID=A0A062V045_9EURY  ali  20  2...LLDILKEAISIEIYGKEYYSIFSDIVEDDNKALFRELSKYEAKHQELIEKEYKRISGRSIDIKVLDEENTERARRIFPEPLRPLNIEETKDVLKLGIKVEERSIELYSGSAQKTEDRDLFLRLVHFEEGHKETL..... 139
367 5.000e-14UniRef50_A0A0S8KSV8 Uncharacterized protein n=1 Tax=Anaerolineae bacterium SM23_84 TaxID=1703388 RepID=A0A0S8KSV8_9CHLR  ali  17  7..SALKALEDAKCLEQEGQDFYQRAAQRTGSETKEVFLSLLRDEVMHQRLIQRQIDQLSSEGTWAELPESGMETFPQGRQGLEKAVHADITEAEALIVAMEFETKGYDLYRREAKAATDRATYEFLATQERMHFDLL..... 152
368 5.000e-14UniRef50_A0A1F9P5Y2 Uncharacterized protein (Fragment) n=1 Tax=Desulfobacca sp. RBG_16_60_12 TaxID=1797909 RepID=A0A1F9P5Y2_9DELT  ali  22  7...MLKALKDAVQMEVEGRQFYLEAAKKAKSPVREIMEYLAESEKYHIAKFNEVYRSLEKDPSWTETIAAFKPPQHEPYVCKDEQGSGGDDDLQALKTGIKMEECSIDYYTKLAKEATNP...................... 129
369 5.000e-14UniRef50_A0A1J5C0M6 Uncharacterized protein n=4 Tax=Caldiserica TaxID=67814 RepID=A0A1J5C0M6_9BACT  ali  24  1MDKRQSILVEAMEIELNGIELYKSASEKTDDQARKAFMFLSNEELKHYNTLKKIFDSISKGNGFKIELPIFEVPSFDKIFSDDANLKGKNFEFSAISTGMLLEKASINFYRKQKENSKEKELFETLEKWEEEHLRILERDY. 147
370 5.000e-14UniRef50_A0A1J4UMR7 Uncharacterized protein n=1 Tax=Candidatus Micrarchaeota archaeon CG1_02_51_15 TaxID=1805249 RepID=A0A1J4UMR7_9ARCH  ali  17  22...VDSAIESAIKAEEKEEMVYAQAATRSTNRVKELLTWLATEENKHARALSGLKSCLQSQGRWDNHAKSLGSGPALTRIPSDERQRVSKDELRVLLEAMKAEKKSIAHYAKLAAKADSKKFFEGLAEYEREHYEKLDEL.. 162
371 5.000e-14UniRef50_A0A0M0BU24 Uncharacterized protein n=3 Tax=Candidatus Bathyarchaeota TaxID=928852 RepID=A0A0M0BU24_9ARCH  ali  17  4.LNWKSIIEAAVKVEEQSIALYTKALENAKYPASKVFKQLVDEEKGHKNKLEAIMKDET-KISELGSHGGPVQDLKIVDMMDDTPLSSEADYEAILVYAAKREKTSYDYYKTLLKGTKIGELFSKLAQEELSHKNKLEKEY. 146
372 5.000e-14UniRef50_A0A2N2AZW0 Uncharacterized protein n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A2N2AZW0_9FIRM  ali  29  5..TLYEVLQLAIHLEEEGQAFYEKYAEKAKGNVKETFLRLALDEVKHCKYFQSLYYDAKEKPGLDYLFEEEVTAYFKEYAALNREVIEINTVEEAVEEAILTEKKSIEYYKYLDKYADTKETIHTIIIEEEKHLEVLEKLK. 148
373 5.000e-14UniRef50_A0A2N1P909 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium HGW-Zixibacteria-1 TaxID=2013855 RepID=A0A2N1P909_9BACT  ali  22  12......LLKSAIKSEIDGFTFYDLLSKQAANEAKRRLENLRNDEARHRATLIDIYKKEVGGEIGALPDTGI---SPLQKAFVGGKLKKFNSEVEYINLAIEAELDAVEFYKKGSAIISDKNIMKEMAEEESGHYEILMAER. 147
374 5.000e-14UniRef50_A0A1F3YW50 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=A0A1F3YW50_9PROT  ali  29  4VFTAREIAESAVEKEMKRRDFYANVTKLTDPEMAKLFEFLTAEEDRHVATFKKLRDQVPVEEVRPEEYDADMQAYMDSVVEEKDFVQNAIEAKDVFRLAIALEKDAILFFWEFLPYVKDKKLVRTLIDEEKGHIRLLWKMK. 155
375 5.000e-14UniRef50_A0A143B9B4 Uncharacterized protein n=1 Tax=Desulfuromonas sp. DDH964 TaxID=1823759 RepID=A0A143B9B4_9DELT  ali  23  132........ALAWCLEEGTRRFYAAAAEQAEPELGTLFGELVNAEEGHKKMLRGVYEALRGALAPDDFPACELGAGAADDYMEAIAWARQQPARAILELAMAVETSALDRYLYLQRRLPDENVFELLADEERRHLKQL..... 271
376 5.000e-14UniRef50_A0A1F8N2T3 Uncharacterized protein n=6 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8N2T3_9CHLR  ali  18  5.LTLKEVLERAINREIESRLLYVALSQKVGDKAKEAFQELAQQEQGHQNLLEKYQRGELKEGALNS---GQAIDYRIAERLDQPQSSPDMKLKDTFLLAANREKASHEFYLGLAEVHPVRRLLGGLAAQELEHKQRVESLY. 145
377 5.000e-14UniRef50_A0A2N2GG03 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2N2GG03_9DELT  ali  30  5VFAASDIVEVAIRIEENGINFYKFAEQIAKQEAKKLFAHLADAEAAHKKTFEKFFEKYNPPEQYAGEYSAYLRNYVDTKEIMDKQLAGIKDTVAAFDFAMQRELDSVLYYHEIKNLVPAHEAIEKIIDEERKHYALLCDMK. 156
378 5.000e-14UniRef50_Q24Y88 Uncharacterized protein n=18 Tax=Firmicutes TaxID=1239 RepID=Q24Y88_DESHY  ali  23  3......ALEFAIKMELDGERYYREQAVINQNSLRAIFLMLADDEKMHAQILEKKTKNLNYTLE-PNETLATAKNVFSDKDRIKNEIKEIPSQIDVYRAALDNEKESILLYQKCSSEAADKALFDYLILQEKEHYAILEQLTA 141
379 5.000e-14UniRef50_A0A1W9T5I6 Uncharacterized protein n=1 Tax=Planctomycetales bacterium 4572_13 TaxID=1971638 RepID=A0A1W9T5I6_9BACT  ali  22  5.FNADEIFEIAEQIERNGAKFYREAAAATDADVKKMLLSMAVMEDSHEQTFSDMRKELSAEFDPDNEVAQYLQTMADFHGIEGKERKQTD.................................................... 100
380 6.000e-14UniRef50_A0A2N2EEA9 Uncharacterized protein n=1 Tax=Firmicutes bacterium HGW-Firmicutes-1 TaxID=2013770 RepID=A0A2N2EEA9_9FIRM  ali  19  195......FIKNAVEGEKEDELFYNDLIGLAPDEQKDIIASIRDDEIKHNSFFSEIYEELTGEVVKP---------------LVDVPYEKPTSYIDGIEKALFGELGAVERYRMIYNAMPNKDLLFEVITDELKHGSKYNYLY. 318
381 6.000e-14UniRef50_A0A1W2DHF9 Rubrerythrin n=2 Tax=Desulfobacterales TaxID=213118 RepID=A0A1W2DHF9_9DELT  ali  31  5.FSADEIFEMAKQIEVNGAAFYRKAAAKVSGEAEQAFNTLADMEDQHEKTFADMQADLKKEEDPQGEAVLYLKSMADTKIFFKKE-EPGNEMKEILSAAIKAEQDSIVFYLGMKELAAGKQRVEDIIKEEMSHIRLL..... 148
382 6.000e-14UniRef50_A0A0F2QZH8 Uncharacterized protein n=1 Tax=Desulfatitalea sp. BRH_c12 TaxID=1629708 RepID=A0A0F2QZH8_9DELT  ali  21  5...IVDGLKEAILLERRGRAFYKQVAAGTQNTVREFFETMADEEHRHMLVLEDQFRNYHQNQRLADFDSRANVEKPLADFLLKAQITAASFEAAAISAAMLMEEQTITLYADRARLSTDKELFRWLANWEHGHLTFL..... 146
383 6.000e-14UniRef50_A0A1F8MYB2 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_54_9 TaxID=1797631 RepID=A0A1F8MYB2_9CHLR  ali  20  6.FDALTVLEIGKEVERRGQAFYQEAAKIADNKVKNMFLVLADDEAKHLQILETMGKRLQEEEDVNKLATRFKEVLFPDEPVIKMSATGKTSEIQALERGIQLEEESIKLYEGAAERDPSPNAFRRLVMEERIHWYILTR... 154
384 6.000e-14UniRef50_A0A2V5W232 Rubrerythrin n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5W232_9BACT  ali  14  7.LSEQEILALAIALEEEDARIYDDFADGLKDEQAEKFKELRREEDGHRHRLLDVYRSRFGD----HVPLIRRQDVRGFVQRRPVWLVRPLGLKAVQKAAETMELETKRFYEAAARRATDRQLLGDLAEEERNHAHAAEQI.. 147
385 6.000e-14UniRef50_A0A1W1HGX5 Rubrerythrin n=2 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A1W1HGX5_9DELT  ali  17  7....KEIIQYAINLEIEAEIFYTKVAEKVSDSLKEMFKAFAGEENKHREILTNLMVKGDAGG-----FFGKSKDYGISSTVEKPRITEKMTLADAFAIAMKNEENAMKMYHKMAKDDKIKKVFIDLAEMEKGHKHKMETSY. 142
386 6.000e-14UniRef50_A0A0S7BWC2 Rubrerythrin n=1 Tax=Flexilinea flocculi TaxID=1678840 RepID=A0A0S7BWC2_9CHLR  ali  22  4.......LQFAIEMEHEGEKFYMEQAELNKNDLKFVCELLAADEKEHAKMLTD-KMNHEESQFPETNTLADAKNIFTEMTPIQSGNEELKSQISFYRNALEIEQQSVDFYMKYQKETTDKKLFDFLIQQEKTHLAVLGELY. 140
387 6.000e-14UniRef50_Q5JF77 Rubrerythrin-related protein n=38 Tax=Thermococcales TaxID=2258 RepID=Q5JF77_THEKO  ali  21  18.FSLEELLGMAIKAEIGARKFYESLAERIDQELKEKIEWLAGEEKKHEELLRKIYANMFPGK----EVVFPKEHIGPELQPVARKLNGVQDIIDLIRWAMKAEEIAAQFYAKLEEMVDTKRLMRYLSDMEWGHYYNLKAEY. 157
388 6.000e-14UniRef50_A0A1G2YF18 Uncharacterized protein n=1 Tax=Planctomycetes bacterium GWF2_50_10 TaxID=1801959 RepID=A0A1G2YF18_9BACT  ali  34  4.YNADEVLAMAEQIERNGSTYYAQAAGIVESEIRLLLEELARWETTHEAIFRELRVQFQRQEDPEDEVALYLQAIADGHVFDADMISAQKDAYGLISYAMKMEKDSIIFYLGLKNLVPGKEKVGEIIAEEMKHLAFLSRELS 159
389 7.000e-14UniRef50_A0A2G6FPB0 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2G6FPB0_9DELT  ali  16  3MNDFAEVVNFAIEREVEARKFYLDAANSQQDLVKKMFLEFAEEEKKHEKILKEVLNNKEEQ-----LHFAKSDDYGIAETVEFPAVSTEMPLADIFALAMKNEEQAVLMYQKMAADASSRELFENLANMEQGHKYLLEEAY. 142
390 7.000e-14UniRef50_A0A0M4D5R4 Rubrerythrin n=13 Tax=Desulfuromonadales TaxID=69541 RepID=A0A0M4D5R4_9DELT  ali  15  5.FNVQQALKLAIQTEKNVMDFYTMAAEITKNPGKKVFTLLAGEEREHAGHFFDLYKG-KDLGTFDEFMATPPGKDTAMLHDLKKAIDDKVHERKAMEIALREEEDLAKNLRLTAAKIVDRSIFEKMAKETSDHYALIESEYA 148
391 7.000e-14UniRef50_A0A256ZE79 Uncharacterized protein n=1 Tax=Thermoplasmatales archaeon ex4484_36 TaxID=2012523 RepID=A0A256ZE79_9EURY  ali  28  1MFTVKTLFEMAAEIERRGVVYYERLAEKVEDPGSSLFKYLAEQEREHERLFMEGRNKFGGVEFTEPLPVIRADDIFVADILD------NTDEVGATEYAIEVERRTADLYRTAAEAATDKEFLTNLARIEEGHEKLLKD... 140
392 7.000e-14UniRef50_A0A235HDX1 Rubrerythrin family protein n=9 Tax=Rhodospirillaceae TaxID=41295 RepID=A0A235HDX1_AZOBR  ali  21  14..SLDELLGIALALEQEAVRRYTQLAALMDQDTATTFRALIAEEQDHVQAVDGWAHSLGRPTPDAPAFLWRLPPELAS-SWEELTERTRLTPYQALSLAVVNEQRAFAFYSYIAASATDRTHAEALAREELRHAALL..... 154
393 7.000e-14UniRef50_A0A151F0M8 Uncharacterized protein n=1 Tax=Theionarchaea archaeon DG-70 TaxID=1803813 RepID=A0A151F0M8_9EURY  ali  29  1MEDDAHVLATALELERKGFTFYSEAAKKTENETKKMFSQLAKEEEEHIGKIKKMFSNLYPQNNHKEIP------------LFNAEISEYSGEIDAIRIGIDMEKKSIEFYKNRAKG-NLKSLFNELIEFEKEHLELLQAE.. 128
394 7.000e-14UniRef50_A0A2T3N812 Rubrerythrin n=1 Tax=Photobacterium rosenbergii TaxID=294936 RepID=A0A2T3N812_9GAMM  ali  29  5.FNANEIFIMAEQIEIEAYKFYLKAAEETKDEDKAFLKKLASFEVEHQNLFSEMREKLSVQEKTENEAEDYCRSFARMQNIVKKNVD-FTNMKEILLNAIMIEKDTIVFYSGMKKFVSEKGRIDELIHEELRHIDILTKQY. 153
395 7.000e-14UniRef50_A0A0F9I4C1 Uncharacterized protein n=8 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9I4C1_9ZZZZ  ali  31  5.FSMREVIEMAVTTERSGQAFYQNASKLARNNLKELFQYLAEEEEKHLKTFQGFYNALKEKPYNWEEAKLYLEALVDSEFFASPEAKEAKDELEVIYAAIEFEKDTLLFFYQILEKSQEQELVKKIIEQEKKHIQRLSTVKS 157
396 7.000e-14UniRef50_A0A0F3GSV0 Rubrerythrin (Fragment) n=1 Tax=Candidatus Magnetobacterium bavaricum TaxID=29290 RepID=A0A0F3GSV0_9BACT  ali  31  5.VSIHEIIEMAIRTEKLGFSYYSELAQKFKDELHALFNKLSENEVAHAARFTKLKESLQQDLENWPEVSQYMRSYVESAFFMGANKATP..................................................... 95
397 8.000e-14UniRef50_A0A0Q0W061 Uncharacterized protein n=1 Tax=Candidatus Cloacimonas sp. SDB TaxID=1732214 RepID=A0A0Q0W061_9BACT  ali  25  4.FSSDEIIELAVQIERNGFLFYDQALKRKDENSRKILEHLRQEEINHENTFKAMRTEQLGDLVNWQEAAAYLKTIAATHIFNKKNAAEAENEQDIIRNAIQFEKDTLLFFYSLCRNTDDKKIIDRIIDEEVGHVTELCKM.. 155
398 8.000e-14UniRef50_A0A2H0P6C0 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_49_13 TaxID=1973976 RepID=A0A2H0P6C0_  ali  21  8...ALKMLKTALDMEEKGRVFYEKAARTCSNTGRDMFATLIQDEIAHTQRIKKIFAGIEANKSWTDEWKQFEEMFYKFTEKNGKMIKADTKDIEALDIALDMEEKSISFYDGYLKDAKDRAFIEKMVVEERSHFTILKD... 154
399 8.000e-14UniRef50_A0A1F9MEX5 Sulfurtransferase (Fragment) n=1 Tax=Deltaproteobacteria bacterium RIFOXYD12_FULL_50_9 TaxID=1797902 RepID=A0A1F9MEX5_9DELT  ali  23  89..SAEKTLTIAYSLEQGLRDFYLTMVDKVRNPAASLFKKLADIELLHQDQIFAEYLKLSQEEFESTIVSNVLEGGLTTEEYINLFHPDLESPTDIVAIAISIEGQALDLYLRAAARTQEPAFLNQLAVEEKNHLKALGEL.. 235
400 8.000e-14UniRef50_A0A101IZ57 Rubrerythrin family protein n=2 Tax=Bacteria TaxID=2 RepID=A0A101IZ57_9BACT  ali  26  1.MNLVDVLQMAVNAEIEGRELYKTASEKTSDEAKKVFKMLADEEQTHIDNIVQMAKKAGKELTMPDLPAPASFEDAESPIFTREFKEKVSDDMTALNIGIKLELESEKFYAAEASEKAVKDLFNHLAEWEHGHYEFLKN... 145
401 8.000e-14UniRef50_A0A1V4XKW7 Aldehyde decarbonylase n=14 Tax=Bacteria TaxID=2 RepID=A0A1V4XKW7_9DELT  ali  19  4.MTLESLIALAIKNEEEAYESYMELCSLVEDEAKDTLKFLAQEEKQHKAYLVKYRDGGFRGAALPMDAP---VDYKIAEQEAKPEIKKDVRTREVYLIAANKELNAANFYQDLAKMHPVKEILLGMARQEMRHKEKVEYLYS 145
402 9.000e-14UniRef50_A0A2T3DCJ0 Rubrerythrin family protein n=3 Tax=Sinorhizobium/Ensifer group TaxID=227292 RepID=A0A2T3DCJ0_9RHIZ  ali  20  13..TLGELLELAVRLEREAIDGYVMLAKRMRRELADLFEGLAADERGHLDMVSAWIEEANPPVGPARIFAATDNAGMFDDGDALIVAPELLNAYRAFSVAVRNEEQAFMLWSYVAASTEIRQAAERMALEELGHVRILRK... 156
403 9.000e-14UniRef50_A0A1F7FLF9 Uncharacterized protein n=2 Tax=Candidatus Riflebacteria TaxID=1817810 RepID=A0A1F7FLF9_9BACT  ali  26  5.LNAGDVFKAAIMLEERAVKFYVAAAEAADGRSRKLLENLAEMERGHARQFSTLLAKLAVAEPPDQDADDFLQALTSDRIITRECQVVASDTYDILEKAMLIEKNSVFFYTTVKEIMQSRMAVDRIIHEEVSHFSMLSE... 151
404 9.000e-14UniRef50_A0A1F9AKI8 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_61_14 TaxID=1797834 RepID=A0A1F9AKI8_9DELT  ali  16  9......ALLEAIEIELKGKAFYVQARDQAKHQLKQIFAHLVKEEDGHLERIRDVFQALQEKRPWPEPIEAPGKVFARLVQEQAKHLKGDSDDIQALETALVLEEKNEKFYRDLIPKSRDQEFFERLAGEERGHYQLVSD... 151
405 9.000e-14UniRef50_UPI000A02B0DC hypothetical protein n=1 Tax=Methanococcoides burtonii TaxID=29291 RepID=UPI000A02B0DC  ali  20  25IDSIEDAVKLGISFEDQGREFYLEFSRKTKDAAKELFLYLADEEKKHSQYLMNYLEGEVLLLESDPDVHNFKSA------FSSEFASGDLGEVGILLAAMRLERKTEDLYSMLARNASDEEFFERLSSVERGHYDLI..... 159
406 9.000e-14UniRef50_Q3A9X4 Uncharacterized protein n=4 Tax=Carboxydothermus TaxID=129957 RepID=Q3A9X4_CARHZ  ali  27  6.LSLGEVLEFAVSVERNGLAMYRQFAVTAGTELEKLFDELADEEVKHEEDFKRMFGDVKAEETYFDEYREYIESIVNLHLFQDKKVEEITDANEALKFALEFEKDSLLFFLELKNLVDDKDMVDKLINEERGHVLKLSK... 153
407 9.000e-14UniRef50_A0A2H6GL47 Putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein n=1 Tax=  ali  20  11......ALQIALETEKKGCRFYRIAAASSKDPAKKVFEQLAKDEMEHMAIFAALFKSITNNEPWMTYDQAVARFGKIDQEKLHVDAQDDFDDMKALQEALGFEKKAVEFYIEQAAGAEERSFYQSIQAIEEGHVKIIQAE.. 153
408 9.000e-14UniRef50_S7TC72 Rubrerythrin n=1 Tax=Desulfococcus multivorans DSM 2059 TaxID=1121405 RepID=S7TC72_DESML  ali  22  9......ILKSAMLLEMRGKAFYENVAAQSENPIKQFFEAMAEEESLHIRMLSDQYQSYKQSGKFKAATYDAASGSVASTVLLKEKIQGAGYESAAIQAAADMEERAVKLYTERARNTSDKRLYEWLSDWESGHLKVLLDM.. 149
409 1.000e-13UniRef50_Q9WXV0 Uncharacterized protein n=14 Tax=Thermotogaceae TaxID=188709 RepID=Q9WXV0_THEMA  ali  33  3MFSAKELLNIAVRVEKEGEEFYRKIAERTQPDIKEFFSYMSRQEAEHARTFEKIGEEVGAKEEDMEDTEEYLKSFVEGKFFPSPEVMEEKSVEEAIDFSISVEKETIIFYLELLKNEKARSLVKGIIEQEKQHVVKLLRIK. 154
410 1.000e-13UniRef50_S0FNW7 Uncharacterized protein n=2 Tax=Ruminiclostridium TaxID=1508657 RepID=S0FNW7_9FIRM  ali  22  1MSKLKEIIEYAMRMENDAEEFYSYNMERVQSEHKKLFEELAEMEKTHYAVLSSIYDLLKVTPPPVDDTSREKNVAIIPDNSELISDKNALSDLAIIRMAYLMESDFALFYFNAAGQVEDKRFLLELADWEKKHEVMFKVRY. 151
411 1.000e-13UniRef50_A0A1V5JXP5 Rubrerythrin n=1 Tax=Candidatus Aminicenantes bacterium ADurb.Bin508 TaxID=1852832 RepID=A0A1V5JXP5_9BACT  ali  34  3LLEVGELIGFAIRIEENGETFYRHWAKQMKGDQRDLFERLADEEVEHKRTFQAFMKKVEHYEPTYEEYFGYLQAFADGVLFNEKKLAEVKDFASAIDFAVRRELDSILFYSDLLRFVPQEEQVEAIVREERRHYMKL..... 150
412 1.000e-13UniRef50_A0A1F3G6W4 Uncharacterized protein n=10 Tax=Bacteroidetes TaxID=976 RepID=A0A1F3G6W4_9BACT  ali  20  7....LDILKTAILLEKRGKEFYSKVASQTNESVKKIFELMSAEEDIHIEELSKQYLFYDKNKSFTKNSYISLNNNNVANFVLSEEMKHQISEAAAISAAIDMENKAIEAYTKFANESTDKELFLWLANWEKDHHHLLHEL.. 150
413 1.000e-13UniRef50_A0A1G1AFV1 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium RIFOXYA12_FULL_48_11 TaxID=1798578 RepID=A0A1G1AFV1_9BACT  ali  26  3.FTIDDILEIAEQIEKNGAAFYSKAACLVPGWARNILLGLATEEIKHQKVFSIMRVDLALTRRNRAVPDEYLIALAGECLFRRADDSAAKSLQSIIQTAITKEKDSILLYIGLSAKPVDKKKVRNILHQEQKHLSTF..... 151
414 1.000e-13UniRef50_UPI000C08456A rubrerythrin n=1 Tax=Anaerococcus sp. Marseille-P3625 TaxID=1977277 RepID=UPI000C08456A  ali  23  1MYDPIKIINLAMGMELYGHNFYKDNAEKSQNQTQSVFKKLSEIEWGHYEYLKKLLAKYQGEEVSDEEAHEFFNQRKESENLDETLEQSMIPDMNVLRMAYLIEEDFREYYKMMAGKVEDKEILTNFAAWEDGHAKIFKDEY. 150
415 1.000e-13UniRef50_W8TEP4 Putative rubrerythrin n=3 Tax=Peptoclostridium TaxID=1481960 RepID=W8TEP4_PEPAC  ali  21  1MKKTLDILKFAMEMEQKGQEFYISNMGKVKNPVKAIFENLAGVEEKHYKLLEQYHKTLLETGDWEELDLDLCEPCAEKLYTDSVNLEYDISDITILRMAYLIENDFAQFYHSASKSVTNKKLLANLESWEIQHREAFYEEY. 149
416 1.000e-13UniRef50_I4C316 Uncharacterized protein n=2 Tax=Desulfomonile tiedjei TaxID=2358 RepID=I4C316_DESTA  ali  23  12.......LAAALEKEEQGRNFYREAAEKCSAPGKELFSTLVIEEEIHIKRIRQISESLQAGNPWTEDWKALKGTMQDRIRLLGPEARAAKGDLDVVEIGIQMEQGSILFYEDELKKASDPEFIKKMIAEEHTHFASLEDLK. 156
417 1.000e-13UniRef50_F4HJU4 Uncharacterized protein n=22 Tax=Thermococcales TaxID=2258 RepID=F4HJU4_PYRSN  ali  20  12.FSPKEILGYAIASEDDSKKLYEALAPNFRGLLRDFFMDLAKAEEEHKKILLELHEKLFGDRN-------YIVPKGVRFAETSINVKTVANLIEALKIALTNEATAERIYRHLADRISERKLLLFLATQERSHYESIK.... 142
418 1.000e-13UniRef50_A0A1F5CPF9 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon RBG_16_57_9 TaxID=1797382 RepID=A0A1F5CPF9_9ARCH  ali  18  7..TIEEVLKVGAEMELESYTLYTEAAKTTYPGAKKMLSELATDEKRHREYFLNGLK--DPGKLKMRTLKENIPDLKITDQLVKVPLDPMADYPAILVFSAQREKATHDFYVEVARRFKGTELLGNFAKEELHHKYLLEKEY. 147
419 1.000e-13UniRef50_A0A0S8CBP3 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=A0A0S8CBP3_9CHLR  ali  25  5...LSEVLDSAIYKEIASQAVYEAAQQKTDDPAKELLKELASQETKHAEKLKVLKEKGLGKQQWSQE---EMTDLKISNYLTGGETLEGAGLQDTLIFAMKREEESMDFYRRIAGMIEAKELCINLANEELGHKKRLETLY. 143
420 1.000e-13UniRef50_A0A286GWS7 Rubrerythrin n=2 Tax=Caenispirillum bisanense TaxID=414052 RepID=A0A286GWS7_9PROT  ali  19  20...PEDLFAVATAMEHEATVRYRQLAARMEPQLAALFRRLEAMESEHEAGIDAWAARETITPAEHLTFRWDLPEGISPAALADVGGVEALTPWKALDLAVHNEERAFAFYVQIAARTDHARVAERMAAEELEHVALLR.... 161
421 1.000e-13UniRef50_C6A454 Rubrerythrin subfamily, putative n=1 Tax=Thermococcus sibiricus (strain MM 739 / DSM 12597) TaxID=604354 RepID=C6A454_THESM  ali  16  23...PKEVLSYAIFNEDEETKYYEELARRVKDSIKVLFIQMSDESKEHRDRLYRLFKKL-----YTDEEPVKVDAPPVEVFPYYSEFEKANDYLEALEYCMKSELFAKKVYEMLAENEDSRGIFSQLALMERDHYLRIRKAY. 159
422 1.000e-13UniRef50_A1HM54 Rubrerythrin n=10 Tax=Sporomusaceae TaxID=1843490 RepID=A1HM54_9FIRM  ali  28  5LFSDLEGLRIAMEIEDRGREFYRQAYEAVKPEHKELFMFLMTEEKHHHATFAKLFETLQGDYLFDADTSRYLTVLAEGHIFPHEKIAQLTTIEAILATALQAEKDSVLFYDELAANADARKVFAALKEEEKKHILKLREM.. 160
423 1.000e-13UniRef50_A0A1I4T6M2 Rubrerythrin n=2 Tax=Thermodesulforhabdus norvegica TaxID=39841 RepID=A0A1I4T6M2_9DELT  ali  28  1.........MALRLEENGEAYYRQAAEHARSKVADLWKKLAEDEREHRKMFMEMKKSFLQGTDIDIKEKWYIVEAIGNFSFDPACAFSASEPKDIIGIARGVEEDSIRFYEFLRKLVDNETVLKRIIDEERGHVEHLDRLLA 146
424 1.000e-13UniRef50_S0G3T9 Rubrerythrin Rbr2 n=5 Tax=Desulfobacteraceae TaxID=213119 RepID=S0G3T9_9DELT  ali  20  1MFTVNDLIDIAVRMEKNGEARYLAAKKQVKEKLQSFLQWMADEEADHCQWFENKKHHWVPETHQTDLETMLPDVIKEMMSLDDVNFSQVGSARALLEIFVSFENDTILFYEFLQTFIQEPDVLEKIVAQEKKHVAEIQKM.. 149
425 1.000e-13UniRef50_A0A0H5SGV9 Uncharacterized protein n=1 Tax=Herbinix hemicellulosilytica TaxID=1564487 RepID=A0A0H5SGV9_HERHM  ali  22  5.......LELAIQLEIEGQKYYLEQANKNKDELFKVFNLLADAEKEHEKLLRKRLN--DEDYVLDNSNIDKIKEVFNGLKNFDVKNTFKTTQLDVYRLAVDIEEKSIKLYQDMLKEADDKELLKFLINEENQHLILFEE... 138
426 1.000e-13UniRef50_A0A2M7SG96 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A2M7SG96_9DELT  ali  15  6...LQDIVDFAIEKEQEAFDFYNLLSGRVKKPITEELRKIAAVEESHRDRLKKM-----DVSGYFQKVAKPVQNLKIADYLVDKEPSPDMKWQDLLQIAMRRELASMHLYTDLAKLITDRQLFENLAAEEVAHKLFFEKL.. 141
427 1.000e-13UniRef50_C8X2E9 Rhodanese domain protein n=2 Tax=Desulfohalobium TaxID=45662 RepID=C8X2E9_DESRD  ali  18  120...AGELLRRAAAMEKGAQRFYTVLAESNSARLRQTAAELADLEGRHAQSVYTLLTRQEAIPDFDPFFASLDDTILEGEALAQWTQQGDLTCLDFLELALDLENKAYDLYKTLAENTQERSHFLTLAEQEKAHLRVL..... 263
428 1.000e-13UniRef50_A0A1F8MG72 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_51_36 TaxID=1797625 RepID=A0A1F8MG72_9CHLR  ali  25  126..DVKDILMLAIKLEKGSWDFYVAAKEKAASQAKEKFQMLADAENGHMRRLWERAITLLGKGALPPLEKAHMEGGIEISPALAKMAEKFSDEMQALEIALEKEYMSYDFYKRTSALVGDKTLLHELALEERNHADILLRRLS 276
429 1.000e-13UniRef50_A0A1H7QEA7 Rubrerythrin n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1H7QEA7_9RHOB  ali  17  14.LSEQEILALAISSEEDDGRIYRSYAEMLRPDTAAVFDGMAIEEDGHRQRLIDLHRARFGEVI----PLIRREHVAGFYSRRPVWLIENLGLERIRDEAEAMERDAEAFYLKAAQRISDRKLLGDLAAAEAGHQSRAEDLEA 156
430 1.000e-13UniRef50_A0A1T4W7E4 Rhodanese-related sulfurtransferase n=1 Tax=Desulfovibrio bizertensis DSM 18034 TaxID=1121442 RepID=A0A1T4W7E4_9DELT  ali  20  121..TEAEIITVACRMEEQLSRFYSQLAENTDAELVGTLTRLASFEQKHKSWLLITYRQLMGHELDSIPPTEALEGGLTAEEFIEYNRPALSDSLSIIETGMMFETQALDLYLRCSKRQESKMLFYKLAEEEKRHLKALATL.. 268
431 1.000e-13UniRef50_G7V7W9 Rubrerythrin n=4 Tax=Synergistetes TaxID=508458 RepID=G7V7W9_THELD  ali  17  1MEQAVKVLDFAMKMELQARDFYLESLDEVKLETKQLLAYLAEWEKGHYDFLKKQKESVEGNSRWDEKEGEKIVSSKKEGTPVEPPIDELTGDMAILRIALVMETDFHNFYKNAAKNMKDRKVLEMLAEWESGHQQMINEQYS 154
432 1.000e-13UniRef50_B0VJ22 Uncharacterized protein n=8 Tax=Candidatus Cloacimonetes TaxID=456828 RepID=B0VJ22_CLOAI  ali  17  8.KDFEEILDFAIAREREAIKFYQNLQNQAQQDQKEMLKELEAMEQNHITIIEKLRQTGVKDEDIHKT-----PNLKISEYITADPETLDLSYQNILIKGMKREETSFLLYSEMSVKFPDPEIFRHLAADEAQHKKYFENLY. 146
433 1.000e-13UniRef50_A0A1F4TJ68 Uncharacterized protein n=7 Tax=Candidatus Saganbacteria TaxID=1703751 RepID=A0A1F4TJ68_9BACT  ali  24  1MNDLIADVKLSIELEKNGYDFYTKTAEKTNNPLAVLLKSLAERELVHLEKIKQFYKNLTGEQKLASDWLKGVEVSPTKQELLKIIINKLKDINEAYSIAEIMERDSFNLYDKIAKESSDKKFYAALAEEEKEHYTILEE... 154
434 1.000e-13UniRef50_A0A151EDH3 Uncharacterized protein n=1 Tax=Euryarchaeota archaeon SM23-78 TaxID=1803821 RepID=A0A151EDH3_9EURY  ali  17  7LKNELEALQLAIKTELEIRKFYLDNAEKMKNEAKKTFIFLADEELRHIDAIHAFNKSIKEGTEPEIDAGTEDEAINRGKEFFATSMKASEDDIKVYEMGLQMEQNGYNFYQKAANKAKHKKLFEFLMKEENAHYALISN... 156
435 1.000e-13UniRef50_A0A0B4XHB2 Ferritin-like protein n=3 Tax=Rhizobium TaxID=379 RepID=A0A0B4XHB2_9RHIZ  ali  19  11IQSMLDLLTTARSMEQEAVAGYQALSERMKAELASVFDRLAAEEQGHLGMIEQWSAQ---TGIPFETAPLPDQHGLFDDEGAGIVAPQMLSAYRAFSIAVRNEERAFVFWTYVAAHAPTPEMAERMAREELGHVATLRQER. 155
436 1.000e-13UniRef50_UPI000C0898B8 hypothetical protein n=1 Tax=Tepidibacter mesophilus TaxID=655607 RepID=UPI000C0898B8  ali  29  12........KVARDIEEEGFRFYTQAMKDAENEIKKIFKLLAEEERAHANLFSKIYSYAKEENLNDDDYAAYLKAISDTAIFNNNKIKDVKDSKDALIIGMQAEKDAILFYTNLLKVAKSKKYLKQLIEEENGHLENLINIY. 159
437 1.000e-13UniRef50_A0A1F3ZW01 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_64_12 TaxID=1797487 RepID=A0A1F3ZW01_9PROT  ali  17  43..TPADFFAHAIAIEREAVARYTEFAQAMSDHTASLFQRLARFEYEHLDSILKKTGNMAVPELSPGEYAWLDKGSPEAAA--REFVFRLLTPHDALKIALQGERRARDYFAAIRESTADPAIAREYAREEDVHIAWIERM.. 185
438 1.000e-13UniRef50_A0A2M7WGQ3 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium CG_4_9_14_3_um_filter_46_8 TaxID=1975520 RepID=A0A2M7WG  ali  20  5IQTQEEALAASIEMEKKGQDFYKKTAVKASTKLRDLFEFLAREELKHIEAIKTFYKREFDDVVSGVDPAKARKAIGKLFEGLDKKAPVDKSDLETYKFARDFELNSEKFYREAALKAEVKKLFEFLAEEEKRHFKMLDD... 154
439 1.000e-13UniRef50_Q8R811 Uncharacterized protein n=9 Tax=Clostridia TaxID=186801 RepID=Q8R811_CALS4  ali  26  3......ALEFAIKMEKDGEKFYTEQAEKHKGHLEKLFLDLARDEKKHAEIIEKWAQKMDYQLERTDISEKY-KNVFETGKEFKSDIRPVPTQLEVYELAMKKEIESIELYEKMLKDAKEKKLFEFLIEEEQKHKELFDNL.. 139
440 1.000e-13UniRef50_Q312Y1 Rubrerythrin n=8 Tax=Desulfovibrio TaxID=872 RepID=Q312Y1_DESAG  ali  30  4LFKAGDIVRAAEEIEIRGEDFYRRLAAASEDEARRLFHWLMEEEMAHRAIFKAMGERIAPAWADEADYLMYMRSLLDSHALFRPDAVPAEQLETALRIAMQFEKDTMLFFTEMRDFVPEAEHIDACIAEERKHLKQLMAM.. 152
441 1.000e-13UniRef50_A0A0S8KGY1 Uncharacterized protein n=2 Tax=Anaerolineae TaxID=292625 RepID=A0A0S8KGY1_9CHLR  ali  30  6...AADIVDLAMQLEKNGEAFYRAAKKAASSEIQSLFEDLADQEVKHYAVFSKLREDTRMSNEEWDWYVGYLNATVDSALFKGPDKAQVADEKEAVRMAIGFEKETLLFFYDMRDMVPDRSFVDKVVAEEKSHIRRL..... 151
442 2.000e-13UniRef50_A0A2M7F816 Uncharacterized protein n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A2M7F816_9BACT  ali  17  38..DIAEGLLNAFRLEKGAHAFYEAASERVQDSAVEMFRKLADVEERHMHDVYDLYHAFIGDRGPVPFPEFKEKMPAEEAALSDVQGRFFMDAKEVLRVALQEESSALDLYTRMAERSEDPALYRQLSGEEEEHKSMIEK... 186
443 2.000e-13UniRef50_V4J689 Uncharacterized protein n=2 Tax=Desulfobacterales TaxID=213118 RepID=V4J689_9DELT  ali  22  1MFTITDIRDIAIQIERNGEEAYRKAARAADPELAKMFDWMADEEASHRLWFESIVSEKILSEDELLLEEMGRQLLQQMFSLEQSQLEDTTDFIHMLDQSAQFEQDTIDFYDFLKAIIDDKEQLSSIIEEERAHKDKLAEL.. 149
444 2.000e-13UniRef50_A0A212PGQ7 Rubrerythrin n=1 Tax=Geobacter sp. DSM 9736 TaxID=1277350 RepID=A0A212PGQ7_9DELT  ali  25  2.....DLFEFALKMEMDGKAYYEKLAASTSGGFKAIFSRLAADEQKHYDVVKDI-QAGTGAVMADTTVLEDARNVF-ADLKGDQFLREIKEDLNAYEHAKEIEAESVRLYEGLAEKEDNRSLLLKLAEEEKKHFNIMENLY. 139
445 2.000e-13UniRef50_A0A202DBN1 Uncharacterized protein n=1 Tax=bacterium B17 TaxID=1932704 RepID=A0A202DBN1_9BACT  ali  29  4VFHADEVLQMAAQIERNGGKFYRKAAE-INDEGKDLLIEIAEQEDEHLALFEGMREEYAERADQLEEAAAYLATMADTHVFPDKLLKGDETLDDILNIAIQAEKDSIAFFGAMREMVPERKKIDALLKEEMKHILWL..... 154
446 2.000e-13UniRef50_Q6ANP4 Uncharacterized protein n=1 Tax=Desulfotalea psychrophila (strain LSv54 / DSM 12343) TaxID=177439 RepID=Q6ANP4_DESPS  ali  16  43..TAEDAIITGFGLEMGLRDFYLSMKSKVKSEAAKLFQKLADVELLHEKQLLELYNGLVGEKVSLDEFQKKIVEPSMEGGLTTDQYLQMESELDILSLAMAIEVQALDLYLRAADGSEARETLLHIAAEERTHIAMLSQ... 188
447 2.000e-13UniRef50_A0A2M7WGS5 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium CG_4_9_14_3_um_filter_46_8 TaxID=1975520 RepID=A0A2M7WG  ali  18  8...VLDGLSKGIQQELAAYVFYKRGIKITKSEVRELLIKLAGEEKDHYRILEGQYDNLVRSEMWNTYLPDIDEKITDFQSVLIDEVSEPATPMRILEIGLTLEIAARDLYVELAENIDDKETYIYLSKFEQGHINKIKRM.. 156
448 2.000e-13UniRef50_A0A2N2CNH6 Rubrerythrin n=1 Tax=Firmicutes bacterium HGW-Firmicutes-16 TaxID=2013777 RepID=A0A2N2CNH6_9FIRM  ali  22  3......VLGYAISMEMEGNKYYLNQAENNSNGLHKIFLMLAQDEKNHEMILRNKMIE-SPYKLIFTDTLPNVKHILNEIGNLKSELRKNPWQLKLYKMALDKKKKSINLYSDMAHEADEKELFEYLINQELQHYEILDNL.. 139
449 2.000e-13UniRef50_E0HXU0 Uncharacterized protein n=8 Tax=Kosmotogaceae TaxID=1643948 RepID=E0HXU0_9BACT  ali  22  1MSDFKSILEVALSFEKSGREFYKNNMQKVNQSVKKTFEYLMEMEDSHVKFIEGMIEALEDNKEVDFALQEEAEEIFESQALSNNSYSSDLADLSILRMAYLIERDFVDYYENASKNVEDKKLMVKLMNWEKGHVTLVKDL.. 148
450 2.000e-13UniRef50_I4BTZ4 Uncharacterized protein n=4 Tax=Acetomicrobium TaxID=49894 RepID=I4BTZ4_ACEMN  ali  20  1MELERKILEFALKMEKEARDFYLSAKNRVSNPTKLLIDYLADWELSHCKFIEDQLNKIKSTGKWDTYAATEMDEETAQEILRKPWVEEELSDISVLRMALSLERDFNNFYTKASQKIDGKKVLNKLAGWEAEHMRIIDE... 151
451 2.000e-13UniRef50_A0A2N5RK11 Ferritin n=2 Tax=Thermotoga sp. KOL6 TaxID=126741 RepID=A0A2N5RK11_9THEM  ali  28  1MFSAKELLSVAIRVEKEGEEFYRKLSDRFKDKIKEFFSYMSRQESEHARTFEKIGEELKVSEDAEEYLKSFVEGRFFPDTETMEKYLKEKSVEEAIDFSISVEKETIIFYLELLKNEKAKSLVKGIIEQEKQHVVKLLRVK. 153
452 2.000e-13UniRef50_B5EHJ7 Ferritin-like domain protein n=5 Tax=Geobacteraceae TaxID=213422 RepID=B5EHJ7_GEOBB  ali  20  3......VFDCAIKREEDTRTYFEGLVEKADPELKTLFSMLADCEDEHRKRLLDLKKGMESKTTVLADLDVSVCSYRPFLTQSELLEEKDKDP-DLYLFTVKKEEQDITFYQELAARARDRKSLLMLADEERRHLERMEEIYA 141
453 2.000e-13UniRef50_A0A1F9CJ48 Uncharacterized protein n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1F9CJ48_9DELT  ali  20  18..SLNDVLTFAIRREHDAQELYLMFREMVKDPAKALLEDLANQELGHKRLLEA---ALKGGKIERIGGKKEVKDLHLGDYMVTEDIGPDSSPQNVMLFAMKKEQEAYNIYHMLLGNTELEELFSRLAQAELRHKEILEREY. 157
454 2.000e-13UniRef50_A0A1U6TRL7 Uncharacterized conserved protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1U6TRL7_9MYCO  ali  19  82..NIVTLIEKAIDGEYSAISCYQHLINLASTQIKDKINEIRKDEIRHFNSFSNLYTQLTGEKHK-----------------PKISEECPKKYKQGLDFAFKDEQETVDFYLEIVSKTDNPKIFQRAAHDEQNHAVWF..... 203
455 2.000e-13UniRef50_A0A218PE51 Rubrerythrin n=2 Tax=Thermococcus sp. P6 TaxID=122420 RepID=A0A218PE51_9EURY  ali  25  16.FSLEELLGMAIKAEIGAREFYRSLAERVEEELKKKIQWLAGEEGKHEALLRRIYENMFPGK----EVVFPKEHIGPELKPVAEELKEAQDLIELIRWAMKAEEIAAHFYEELEKIVETKRLMRYLSDMEKGHYYTLRAEY. 155
456 2.000e-13UniRef50_A0A1F3F3D6 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1F3F3D6_9BACT  ali  24  6....LEILKMAILMERRGRAFYAKVAEQAQSEVKEIFNIMAEEEYTHEQILATEFKNYSKAQNFTAIQLPEDNYNQIVSLILNKDLKNKISEAAAISAAIDMETKSIEVYAERAKNATDKKLYQWLSEWEKGHHKILLDL.. 149
457 2.000e-13UniRef50_A0A1V5NV74 Rubrerythrin n=1 Tax=bacterium ADurb.Bin374 TaxID=1866937 RepID=A0A1V5NV74_9BACT  ali  33  5.LSVDDLFAMAIEFERNGVAFYTRAAASAAGPHAALLLRLAAMEQMHEKRFAALRRTLSEETEPPEEKALYLKAMADTRVFPPEELANANGLADALRYAIDREKDSVVFYSTMQEFVPGREQIQAIIAEELGHVHLLTAELA 160
458 2.000e-13UniRef50_A0A091FAP4 Uncharacterized protein n=11 Tax=root TaxID=1 RepID=A0A091FAP4_9DELT  ali  30  3VFAASDIVEVAIRIEENGVNFYKFAEQIAKKEAKKLFAELAEAEVNHKRTFEKLLVNVEKSNLTESYEGEYDNNLIFTKEIMDKQLSKIKDTSAALDFAIQRELDSILYYHEIKKLVPAHDAIEKIIEEERKHFLSLTAMK. 154
459 2.000e-13UniRef50_UPI00036A8865 hypothetical protein n=1 Tax=Orenia marismortui TaxID=46469 RepID=UPI00036A8865  ali  29  7.FDARELIDVAVKLEEEGYGFYKNLANLVSKDVQKLFDFLASEEKVHKSKFKEMGKELDKHESYDGEYEDYIKSLINTHVINDEKIKDNLQERKVIELAIRFEKDSIIAFNEFRKVMSDKKTIDQLIKEEKKHLVKLIQIK. 157
460 2.000e-13UniRef50_A0A0S7YU69 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium SG8_13 TaxID=1703398 RepID=A0A0S7YU69_9DELT  ali  24  1MFTAEEILDMAIRIERNGEQTYRDAIDKAANPMASLLGWMADEEKQHADFFLNMKENIDAAVSNPVADAFGHEILDKSFSLEEVDFGKIEQVRELIAVFIEFEEDTILFYQMLLQNDEARRELRRVIDEENRHIRKLKD... 148
461 2.000e-13UniRef50_A0A1G1Q4V1 Uncharacterized protein n=1 Tax=Omnitrophica WOR_2 bacterium RIFOXYA2_FULL_38_17 TaxID=1801873 RepID=A0A1G1Q4V1_9BACT  ali  21  3......ILDHAMQIEKEGEQIYREFATASPSELSTVFNWLADAELRHFELFRSMKDQQFPALE-ESPLLENVVNVFQKIKENKDHNSFKSNKGDVYKRALSIEEKMAAFYNEKAEESDDKEIFKKIALEEKRHQHIIENI.. 139
462 2.000e-13UniRef50_X1DMQ4 Uncharacterized protein n=3 Tax=marine sediment metagenome TaxID=412755 RepID=X1DMQ4_9ZZZZ  ali  23  8...ALELFDKAMDTEREGIKVYEEAAAKAQDKAREIFQMIAEAERRHLSIIERTYSSYTFKGDFVSEVGKEIEAIGRQYIPKSTDEIVSASALDAINMGIKLEQDSIDFYSDAKTKVTNPNLFNILLLSERAHLLLFE.... 153
463 2.000e-13UniRef50_A0A1G0ZUQ4 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium RIFOXYC12_FULL_60_16 TaxID=1798582 RepID=A0A1G0ZUQ4_9BACT  ali  25  3......IVEYAIQMEKDGEVFYRKLQAKTRPGLKAILGRLADAEAQHQAVLVRLAANRKAVLPKSRLRVQ-ARNLFRKLLDKKPMAVDKLSQLKLYRQARSLEKKSIDFYTKKARKSDGEALFTAIIAEEKLHFALLDTL.. 139
464 2.000e-13UniRef50_B5EF43 Ferritin-like domain protein n=13 Tax=Desulfuromonadales TaxID=69541 RepID=B5EF43_GEOBB  ali  17  1MKDTQEAIRQAIQTEKNAMNFYEIGAKQMKDEAKRLFEQLAREEKEHALQFFRAYTG-TDLGSFDEFIASPPQNEALWVNSIQKVIGPDFTEQKALEYAMEKETHLEKALRETAARITDKEIFILNANETHNHYLTIESEYS 145
465 2.000e-13UniRef50_A0A1Q2MCQ3 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium SM-Chi-D1 TaxID=1851148 RepID=A0A1Q2MCQ3_9BACT  ali  31  5.LSFEELFTIARSMEKDGYDFYTQASGKTSDQLSECFARLANWESRHIDVINAIAMEQTQVRDPMSEVSAYIHAVVKGSIFDNEQVEKISTERELFSYACELEKKSILFYTGLRMSLPQKDIVEKLIKEETKHLTFLNEKLS 158
466 2.000e-13UniRef50_A0A1W9VSW3 Uncharacterized protein n=2 Tax=unclassified Candidatus Cloacimonetes TaxID=1047068 RepID=A0A1W9VSW3_9BACT  ali  23  4.LSVNEVIEFALNIERNGKEFYESALQRKDSKTTEILTMLRDEEIAHESYFKSIRDSEDLNNLFWEVASSYLNTIVQAHIFNDKNAAEADKPINIIEYAIQFEKDTLLYFHSINNQTKDKKAITSILQEEMKHLAKLQTLK. 157
467 2.000e-13UniRef50_A0A0S7X8P9 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium DG_8 TaxID=1703397 RepID=A0A0S7X8P9_9DELT  ali  31  15.FNAQEAFKVARKLESEGISFYKKLLRTVKDPVKEVLNYLLEEEKDHLQLFEEMLEGENAEALDNSGEDILDILDTGVFILPKDEEEIAADIDKALQLGINIEKRSLAFYLEMVKYTESEEALKKIIDEEKKHWEELKKL.. 157
468 2.000e-13UniRef50_A0A143PVC4 Ferric uptake regulation protein n=39 Tax=Bacteria TaxID=2 RepID=A0A143PVC4_9BACT  ali  24  160...ARDALRIAIATERSGREFYTRAAAMTRDRARSVFERLSTAEDDHXXXXXXXXXXXXXXXXXXXXXPQFLFFRGAANGLFSAGVDALRNDKDALMIGIRCERGSHRFFKRYGEKFEDKRVFLEFADEERDHLELLIREY. 304
469 2.000e-13UniRef50_D9TPM7 Rubrerythrin n=10 Tax=Thermoanaerobacterium TaxID=28895 RepID=D9TPM7_THETC  ali  29  10.LTDLEVVSLAIDIEDRGYEFYTMASEKFSNKIKEFFDEMAREELIHKSKFEELYRKLLDEKKGDDLTMLYKTSVFPSENLVEEVLKNVDTIYDAIELAIRAEKDSILFYDEIVKEAKTKRIVITLLNEEIKHFIDLSN... 163
470 2.000e-13UniRef50_T2G8L2 Putative Rubrerythrin n=19 Tax=Deltaproteobacteria TaxID=28221 RepID=T2G8L2_DESGG  ali  33  5.FSASEIAKAAVEIEKKGQEFYRRVASNAKTELKALFEHLAKEEMRHERIFSDLLARLGPAWSNAEEYAMYVNALIESHALFEKYMAEATDDKTAIRMAMAFEKDTLLFFMEMRELVPEQEFVQQCIDEERLHLRQLKAM.. 155
471 2.000e-13UniRef50_A0A0M4D481 Uncharacterized protein n=1 Tax=Desulfuromonas soudanensis TaxID=1603606 RepID=A0A0M4D481_9DELT  ali  20  126..TPEEHVALAWVLEEGTRRFYAEVAGRVQDEAANLFRELARAEEKHKASLVAVYEGLAGRPAAADFPRGILAGEAGARIEEVLSWTRGKQVCDLLELAVAIEAVAYDHYLILRRELADRRVFELLSDEERRHLVKLTALMA 276
472 2.000e-13UniRef50_A0A117KNT9 Rubrerythrin n=1 Tax=Desulfonauticus sp. 38_4375 TaxID=1635258 RepID=A0A117KNT9_9DELT  ali  27  1MQELQKWFCKALEMEERGYNFYASMLEKCNDPTREVFTLLRDEELKHIKRIKEIVAKLEKGIEVEVVCRECPFEPTPNEVFQKDKKSVCAQKLEALDMGIEFELNLVDFYSQKLQEAQVKEFLTKMVQEEKMHYILLSDL.. 150
473 2.000e-13UniRef50_A0A0Q0VHG5 Uncharacterized protein n=1 Tax=Candidatus Cloacimonas sp. SDB TaxID=1732214 RepID=A0A0Q0VHG5_9BACT  ali  16  5..SFNEVIEFAIEREEEAVKFYHELQSEVKFQAKEMLNELEQMEKGHITVLENIRKKGYEKIEIPEMV-----DLHISNYIVDVEPSENMTYQDILIIAMKREEKAKELYLDLASRFPGTDLFKKIAAEEAGHKLKFEILY. 142
474 2.000e-13UniRef50_A0A2E0UGA1 Uncharacterized protein n=1 Tax=Ectothiorhodospiraceae bacterium TaxID=2026737 RepID=A0A2E0UGA1_9GAMM  ali  19  10.MTVDELLDIAIQHEVSSQNLYAGMLEKTNNEMQNFLKSLVEEEKGHEDLLTTMKEMEIYDGSIVVEDTSLIKGVEQSHTTAKEPEAPPESIEQILELALTRETKAQNLFLTLAKSSKNKTMFENLAEEEMNHHHDIQKKFA 154
475 3.000e-13UniRef50_B0UIC4 Rubrerythrin n=1 Tax=Methylobacterium sp. (strain 4-46) TaxID=426117 RepID=B0UIC4_METS4  ali  13  12IENLKSFFALAHLMESEAARSYAEFADLMRPDLADTFARIAGEESGHAAHISHWSQAAEGRGPDSQDLRWPPPPTFEREDAAEIAGSRLLTPYRVLTIAVRNEERAFAFWAYVAAQTEVRRAAEAMAREELEHVTTFRRER. 159
476 3.000e-13UniRef50_A0A2W5ZNS5 Rubrerythrin family protein n=1 Tax=Pseudomonas stutzeri TaxID=316 RepID=A0A2W5ZNS5_PSEST  ali  17  15VKTLEELFAIAHAMEHEAAERYAGIARRMSAQLAAVFERLSADEKGHLDQVAHWSEGARGKAPDPALIRWELPETFDDEGAYTMD-SQLLSAYRALAMAVRNEERAFAFWSYVAAQARKPEIAEAMAREELGHVATLRRER. 161
477 3.000e-13UniRef50_I3IHW2 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=I3IHW2_9BACT  ali  19  4..DIKSILETALSEEKKAHQFYLNLALQMKDKGARLFEIMSAIELKHYEFLQSWYQEKFQHMP-------VLPETTELKIVRPEIPAKTALFAEAIKIIMDTERRAYEFYREVSTHASDREVFRTLANMELSHYEQFRTEY. 139
478 3.000e-13UniRef50_A0A2N7Q7S9 Rubrerythrin n=3 Tax=Bacteria TaxID=2 RepID=A0A2N7Q7S9_9BACT  ali  22  6.YSLKDLLLTALKSEIEARDFYKTLAEPVENYLKDRILFLSAEEEKHRRVFEQMYQQQFPGEKLVLPEKSPVPLPGL------KIEKETVPISEVFFVAMQAEKAAHDFYLEFAKHFPPEKLLVYIASMEMGHYHLL..... 140
479 3.000e-13UniRef50_A0A1G3LR65 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWB1_27_13 TaxID=1802173 RepID=A0A1G3LR65_9SPIR  ali  24  4.YSPSEIYQFAVKIEENGKIAYEYFEKKFSDPLKKIFNFLASEEVKHKETFEKILTKIEDDDQYFLYIRAFADNVIFTKEKFEKEIDKITDALSALDFAMKKELDTINYYYALKAFVKEQNLIDDIIKQERNHFLTLSKIK. 152
480 3.000e-13UniRef50_D3P9N2 Rubrerythrin n=3 Tax=Deferribacteraceae TaxID=191394 RepID=D3P9N2_DEFDS  ali  20  5..TLKEALEDALHKEQMAYEFYMQLHDMLKDGAKAIIKELASEEVKHKEMIEEAIKTGKIEHIGM-ETKYYSSDLGISKMVLPQVITDDMSVQDVLRIAMKHEDNSRVFYEKLAEKSEAEEFFRRMAVEEATHRNKIQNIY. 146
481 3.000e-13UniRef50_A0A1F9SN54 Uncharacterized protein n=5 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9SN54_9BACT  ali  24  50...LRDLFRLAVLMEEQGKKFYIKMAVTAKDETRKLCALLAEEEAAHGQLFQGHLDRWRPIGLNMRTWPAFLEKVKQEGFFADP-PPADASEDEMAAYAIRQEIKTAEFYALFEQAFPEKDHLRRLVEQEKRHERLLRAAY. 190
482 3.000e-13UniRef50_A0A257V4I2 Uncharacterized protein n=2 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A257V4I2_9BACT  ali  20  7...MLDILRKAYQIEVDGYTFYSMTADHAKDAVRDLFGKLAADEVQHQAFLKGVAGQLNEKGAAAFQPGQRAINQALFTARFREQAAASEFELGVLSVGMTLESNAIRYFSSAAQQASEAEVYQFLADWEKQHYDALESL.. 152
483 3.000e-13UniRef50_A0A2N5ZFN5 Rubrerythrin n=1 Tax=bacterium BM706 TaxID=2053465 RepID=A0A2N5ZFN5_9BACT  ali  31  3.YNAYEIIEMAKKIEDNGSAFYRMAAEKTESKAKTLFEDLANMEDVHKMVFEDFKSYFSDEEDSDNQMFTYLKEMADTVVFNERDLNEINTIDDIFRYAIEKEKESVLFYLGIKEIVPEKDKVADIISEEMKHIAVLSD... 154
484 3.000e-13UniRef50_A0A2D3VZ94 Uncharacterized protein n=2 Tax=Sulfurospirillum TaxID=57665 RepID=A0A2D3VZ94_9PROT  ali  24  4.......FEQAMRMELEAEKLYKNMAEKTSDKLKGLLIMLADEETKHYKTFEKMSKNLALGDVASFDIQEVVRKVFSSIKEEKKRYNFSDEQVALYKKAAIAEDRAYEFYLQKAQEIEDKQAFLAIAKEEKKHQELLENL.. 140
485 3.000e-13UniRef50_A0A1F4Y8I6 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F4Y8I6_9BACT  ali  24  11......ALRQAMQAEWDGHNYYRMVAEKTSDPGRETFNMLASEELLHFEFLKAQYKAVMEEGLVLEEKRSPNDAGPIFSADFKKRLAGAHFEMSALSIAAQLELSAIHFYKGESEKSSVKKFFQELANWESIHYRSLLQ... 152
486 3.000e-13UniRef50_A0A0C1RLT5 Uncharacterized protein n=15 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A0C1RLT5_9DELT  ali  20  1MNKRMNALKFALENEQKERDFYLVNARRTKNAGKNMFKQIADEEKEHYEVLKKLHEQWEKKKKWPATVPLKVKKSLAGSILKAARIKGNEDDLKAIRTAIDFEARGVALYTKLEHGSTDKDFFNLLAGIERQHFLSLRD... 149
487 3.000e-13UniRef50_A0A0S8E3D3 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A0S8E3D3_9BACT  ali  23  4IFNVFEVLQIAERIEHNGAKFYLKRAELFDDEVRDTCYKLASWKAKHEKTLAQRRKRFSEKSDPDNYVLSNPRVMAGLAVFATEPGSRLEDRPKIFKDAIRRAKEAVVFYRGLKDFTRDKDMIDAIIKEETRHIRLLTEE.. 158
488 3.000e-13UniRef50_A0A1J5R420 Rubrerythrin n=2 Tax=root TaxID=1 RepID=A0A1J5R420_9ZZZZ  ali  20  10.LSLQDALDLAVLIEKEAEERYTQLGERYRGDAADFFAMMARNEHRHGMELAERRRLLFGDTPSRITADMIEDIEAPGTGKPRPY----MSPRHALEVAMESEVKAYEFFDQALPGIQDRKLFLELGHEEAEHQRLLREQMA 153
489 3.000e-13UniRef50_M8DAD2 Rubrerythrin n=4 Tax=Bacilli TaxID=91061 RepID=M8DAD2_9BACL  ali  17  32...AAEILQ-AVHREERAGNFYTRLAELAPTENVKVLITIIKDERKHLQNFSQLYSRLTGREPQ----------------LLREPVPAPESFQRGVELAIRDELEAVDSYRDIVERATDPRIFQRAAEDEQRH----STWYA 153
490 3.000e-13UniRef50_A0A2G6G5A0 Uncharacterized protein n=3 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2G6G5A0_9BACT  ali  18  19.....EILDKAILFEEEGMAFFLDRAENAPSAMRNLFTSLAKDEAGHKAELVRMREDILAQETLDALPEVDEDHVADMRQIFESSLEGVKDPLEILQGAMEVERNGFHLYNNAAKEVTNPKIFEHLAEEEQSHYTLLKNTY. 165
491 3.000e-13UniRef50_A0A0G0PQG1 Rubrerythrin n=10 Tax=Bacteria TaxID=2 RepID=A0A0G0PQG1_9BACT  ali  25  5...AIENLKIAVRTEMEGYDFYIAASNTIKDEGQNVFRHLAKEELEHITVLTAISRSINTGGRWLSYKDAVAQGIFLEENELTKRLKKNPTAIGAVTIAVEVEDKAVQFYSGLLKVADEKTVLTKILDMEKGHLKLLR.... 151
492 3.000e-13UniRef50_A0A1F4YEJ4 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium RBG_16_53_22 TaxID=1802787 RepID=A0A1F4YEJ4_9BACT  ali  23  35.MTIEEILGIAAATELQGHRFYSNLSEKVHPAVKQKIHSLAEDEKRHLKTVEDIYRKVLGREPQEPPAKGVPD---IIRAIAALQINNKTQVLQVLDMAIEAETISAKFYHRGAALASDRKI.................... 153
493 3.000e-13UniRef50_C6C0P4 Rubrerythrin n=9 Tax=Desulfovibrio TaxID=872 RepID=C6C0P4_DESAD  ali  28  5.FSANEVAELAMRIEQKGQAFYLLAADEAKDPAKEFFEFFAEEESRHELFFRDMRDRIGSIEVPPEEYTQYVMALVDSHDYTEAFKDEAFNFEQAVRAAMRFEKDTILLFTELKRMVPDRKFVEECIDEERKHLRMLAE... 154
494 4.000e-13UniRef50_A0A1M6H6N4 Rubrerythrin n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1M6H6N4_9FIRM  ali  22  8......IIKQAILNEIEGCEFYKMAEKQADNEAKESFLILASEEMKHAEYLKELFDKMEKDDEDLKLAYLLEPPSPHIFDWTKNKFKRSAMNVSIYGMAVNLEKESVEFYEDARDKTENRKLFDILVKWEKVHLEQFLKAY. 146
495 4.000e-13UniRef50_F7Z5Z8 Rubrerythrin n=17 Tax=Bacillales TaxID=1385 RepID=F7Z5Z8_BACC6  ali  16  33..........AINGEYSAIACYEQIARRAPSEARNIIMEIRDDEIRHFQTFSQFYTNLTGRRPQP-----------------QISEACPSTYKGGLEFAVEDEQNTVDFYRELARSANSPAMFLEAAKDEQHHAVWFLYL.. 149
496 4.000e-13UniRef50_A0A0S8JM28 Uncharacterized protein n=2 Tax=candidate division TA06 TaxID=1156500 RepID=A0A0S8JM28_9BACT  ali  28  7..SGAEALKIAIGIEQDGLEFYTHAERAASREARELFRGLAKDERQHLETLERELESGDWGWSDNELIEAYLRSIERPEIFPGERAERVEDDLEAIQIGIEAEKNSIKYYTTMAEQTAHRQAFARLVQEEKAHLEML..... 153
497 4.000e-13UniRef50_UPI0009FE7B36 hypothetical protein n=1 Tax=Clostridiisalibacter paucivorans TaxID=408753 RepID=UPI0009FE7B36  ali  28  13.FDGKKLIKTIILTEKKISDLYESLSEKTKDKAANLFKTLAKDEKRHQKIYQSLLNKLPNQGIIDDNDADYIDLLIETNIFKNEELKKSYSKLDALEIAEKVERDGILFINELKNLYPDKDQIKIILTEEKKHLKLVKKLYS 160
498 4.000e-13UniRef50_A0A1V5VGU5 Rubrerythrin n=1 Tax=bacterium ADurb.Bin236 TaxID=1866925 RepID=A0A1V5VGU5_9BACT  ali  23  15.............FEKEGMDYYRMAAERALNPARALFEMLVEDEKKHVDYLSGLHDRLSAGGEWPDEIKDFKAIFVEASRSLAKDISVTATETEALERAIEMENKGRAMYLELSEKATEKRLYAMLAEWELGHANYIQDYY. 151
499 4.000e-13UniRef50_A0A117MBC3 Rubrerythrin n=1 Tax=Thermotogales bacterium 46_20 TaxID=1635293 RepID=A0A117MBC3_9BACT  ali  25  30..SIIAILKYALMREREGVSFYEKLKNAVIPEVKEVLAGLVDMERQHVQFIMELLEKGTRGDEISLESEESNDIYKQREILSRFSLESIARDLSLVRMAYLIEKDFEEFYSKAAQDSHEEDVFLELARWENGHKKVLMDLY. 174
500 4.000e-13UniRef50_A0A1G3MDT1 Uncharacterized protein n=2 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A1G3MDT1_9SPIR  ali  21  6.FRIDEVYQFAVAIEQGGFDFYEKLIQASDNRVKNELKFLRDEEAQHKAFFQELRKKGQSEAALGPGLDKVLQEEFVRPMEEFYRGAKVGKTAEALRFGIAVEQKTIDFYGDLRKQSQDEAFLKDLIAEEKKHKQKLNIILA 151
501 4.000e-13UniRef50_A0A1G3PJ79 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWF1_51_8 TaxID=1802190 RepID=A0A1G3PJ79_9SPIR  ali  19  1.MKVIDIFRVALEMELRGMEFYTSQCSIVKPLIKEIFEHLALMEKGHAEYIRAQIDKIGLGERIETPFADNSDNLFLERLASQKSLKSDLGDYSVVRMAYLIEKDFASFYEKSAEGQNDKKTLEMLAAWERGHAEMLK.... 145
502 4.000e-13UniRef50_G2DDN0 Rubrerythrin n=8 Tax=unclassified Gammaproteobacteria TaxID=118884 RepID=G2DDN0_9GAMM  ali  20  9IESLVEFLAHALELEEASVEHYEELADSMEPQVAELFRRMAGFSQEHANQVRVRAEGLELPEISPWEFKWTCPGSPESSCMEEAHY--LMNTAQALQIALFNEIRGRDFYLQVAETSPDVNVAQEMVEEEALHVKMLEEW.. 153
503 4.000e-13UniRef50_A0A2I0MZV9 Rubrerythrin n=1 Tax=Clostridiaceae bacterium JG1575 TaxID=1658742 RepID=A0A2I0MZV9_9CLOT  ali  20  8......ILRYALQMERSGQEFFREKAERFKDPTRTLFLHLADIEEEHYRLIESELKKYQDGPSGYEAGEEVLRRDESGFFAQRETSEALETDLTVLRMAYLIERDFKEFYEEAMDDVENPQLLGRLSRWESGHEALFKKEY. 154
504 4.000e-13UniRef50_A0A1P8FPR9 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium GR16-43 TaxID=1904640 RepID=A0A1P8FPR9_9PROT  ali  21  13..SPGEFFAHALAIEREAAIRYMQFADQMNRETAELFERLAQYETAHHGKLQERTRELALPALNPWEYRWIDPHSPEAAPLEPVHYS--LTPWHAVRIALVNELRAKDFFEAVAASAEVRRLATEFAAEEHEHAGYLEAM.. 156
505 4.000e-13UniRef50_A0A1F3FPI7 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3FPI7_9BACT  ali  27  2IYNASDIILTALRIEKNGFNFYNHAQKKIEENIKNLLIELAKEEQRHADYFQTIEAELKKKQIISYEFDTEINYLADSHVFNKENMGEKNNAKEALDIALTFEKDTISFFTELGHNLEARNVINKIIDEERNHIKKIVLMK. 152
506 4.000e-13UniRef50_A0A212KHK5 Rubrerythrin n=1 Tax=uncultured delta proteobacterium TaxID=34034 RepID=A0A212KHK5_9DELT  ali  24  6..NAADVIASAVEIERRGFAFYEQAAETSKPEDKEFFTFMAKEEKRHEKVFEAMLKRVGGAGSDEAEYLEYVDLLLNSHTLFMPGQQQDAHD-NPLRQAMAFEKDTILFFTAMRRFVDERPHIEACIEEEQRHLRLIAE... 148
507 4.000e-13UniRef50_A0A1F5DJA4 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon RBG_13_52_12 TaxID=1797379 RepID=A0A1F5DJA4_9ARCH  ali  15  7..TVEKALHVGLTMEQGAMKLYTDAQKMVKNPGKQLLKELAGDETKHAEYFEKALKDPKKDSSKASDLTRVVQDLGVSDPLKGEPLSKDATYQDILIFAAKSEKTANEFYMALAKQYKGHRMWEEFAKMEAGHKLKLEKEY. 151
508 4.000e-13UniRef50_D3TCI4 Rubrerythrin n=3 Tax=Aciduliprofundum TaxID=379546 RepID=D3TCI4_ACIB4  ali  20  6.YSLEDLILLGIKSEEVAKEVYSKVAEEAKNPLKTRLEALAKEEDRHREILVELYKDLFGKEPKPPENPDFIPEFPEISIF--KELGGTTDIRKILEGAMRAELSAKDYYESIAEKMKDKTIMKYMAKIEEGHYKILKQQY. 148
509 4.000e-13UniRef50_A0A0C2HSN2 Uncharacterized protein n=3 Tax=Desulfuromonadales TaxID=69541 RepID=A0A0C2HSN2_9DELT  ali  14  5.FNMKEAIKTAVQTEKDVMDFYSRAAQITQNEGRKVFEQLAKEEKEHCSHFFKIYPG-NDLGSFEQYIQSPPRKESAMLRNLEKALDENVHERRAMEIALKEEEDLARVLEGTATNIIDRTVFDRMAKETRDHFAVIESEYA 148
510 4.000e-13UniRef50_A0A2N7PRE5 Uncharacterized protein n=2 Tax=Mesoaciditoga TaxID=1495038 RepID=A0A2N7PRE5_9BACT  ali  20  2LKSVEEVLETAKRIEESSYAFYAQAQDVVTPYLKKELQYLAEQEIDHRKKIEAMMAE-GPSKIAKDLKIERIQDMKLGDYLMPSHFDPNSTIQDILIAAIKREDLTHQFYQNLLKGAKDRKVLEYLSIEELKHKNKVQFLY. 145
511 4.000e-13UniRef50_A0A1F9KCN1 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9KCN1_9DELT  ali  26  36..SLRSALELAVATEERGGKYYVEMAEKFAGEVAEIFTKLAKDEANHEAQFKTLLSQVEGAGGKAKDDESYAAALSRFFDKDQKATDDIQSPRDALAQALDLEKSTLFYYQSIKDAIGGSPELDALIAAEKGHVVALTR... 178
512 4.000e-13UniRef50_A0A0S7YQL2 Uncharacterized protein n=5 Tax=root TaxID=1 RepID=A0A0S7YQL2_9DELT  ali  18  6...VSEIIDIAIRREEEAYEFYMDIAKVADTAVKDTLEFIAGEEKKHRDFLVTYRDGGFG---VDSLRMNDPIDYKIAEHLEEPEVKSDMRSEEVYLVAAHREERSYHFYSDLARLHTGNEMLLKIASEELKHKEKMEYLYA 145
513 4.000e-13UniRef50_A0A0S8AN28 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A0S8AN28_9BACT  ali  16  3......AVEMAITMKEDAIKYYREAADKCDHPAKQMFLVILEDEKHHLASLNQMVKDMEIDMKKLAPIENIKTSLETLQDEMRTSTACSLDEMEVFKIAMDMEQECVDFYKKHVAEANDEKLFEKLAREEEEHFRVFSN... 139
514 4.000e-13UniRef50_K2D703 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2D703_9ZZZZ  ali  25  5.LNAGDVFKAAIMLEERAVRFYVAAAEAADGRARKLLENLADMERGHARQFEAVDSRLAAVESPDQEADDFLQALTSDRIITRECQVVAGDTYDILEKAMLIEKNSVFFYTTVKEIMQSQMAVERIIHEEVSHFSMLSE... 151
515 5.000e-13UniRef50_A0A101WID0 Uncharacterized protein n=1 Tax=Clostridia bacterium BRH_c25 TaxID=1734399 RepID=A0A101WID0_9FIRM  ali  31  4.YNNLEITKIAMDMEKEGQEFYGKAAALAKDELRSIFILLEEQEKRHAELFSNLHKNLSDDYLYDENVSLYMKALVENKIFKEKELDSIKSMKDALNIGINSEKNSILFYNEIISNTKSAEILSMILNEEKKHLIDLTSL.. 155
516 5.000e-13UniRef50_A0A2H6JZE5 Rubrerythrin n=1 Tax=archaeon BMS3Bbin16 TaxID=2005739 RepID=A0A2H6JZE5_9ARCH  ali  19  8MEKILAVFKKGIELESFGIKFYREAAEVTDPKGRQTLQFLANEERDHWSFIVDLKHSFEKKIINKRSETKAHSTVFPKMEDFSEKIAESKGDEKILEEAEDIEKRSIEFYTSAMADVKDRDIFNILIREENGHLQFVQQMR. 159
517 5.000e-13UniRef50_A0A1G0JPC5 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium RIFCSPLOWO2_02_FULL_56_15 TaxID=1798298 RepID=A0A1G0JPC5_9GAMM  ali  17  13..NIPQLLAHAIALENEASERYADLADLMEADVASLFKKMSGIEQLHVNHIQEMVKRHRIKALPTVTYHWLSPEGPETT--DTTDLHYLMNPRQALKLAMYNEQRACDYYANIAAHTQDRRLAQELSAEEAEHVGMVR.... 153
518 5.000e-13UniRef50_UPI000B5987A8 hypothetical protein n=1 Tax=Thermococcus radiotolerans TaxID=187880 RepID=UPI000B5987A8  ali  20  69.LNGYELLSYAICNEECGAETYEWLAGRVEGILVDEFRYLAKEKRKHAAELRKLFEELYPGMKPLEFNAPPLDTLPVCRELMK-----TKELENALAIAMLSETIGRDIYRKLQRMSGDEELFKRLAEMKEAAYEKLLKLY. 206
519 5.000e-13UniRef50_UPI00031EDE26 ferritin-like domain-containing protein n=1 Tax=Brevibacillus massiliensis TaxID=1118054 RepID=UPI00031EDE26  ali  14  9.YNLLQQLQKAIQGEYEAIRYYEQLAKLAPPDHRRYIEQIGGDEREHIVSFSNLYRRLTGQEPQVVPGALPTE------------------YVSGLKKAFDDEQEAADFYQKVYLGTNDRNIFFEAMTDEMRHATTIAFLYS 135
520 5.000e-13UniRef50_A0A1F8NFE3 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1F8NFE3_9CHLR  ali  28  5.MTPRKAIEFAVKTEELGAKFYKQLAARFSDELKEMFELLARDEVVHGSQFRTLLEKTPPDEVSTGPEFQYLHAMSLSQFFMKKKCSEIKDKNDAMSIAFELEKATLHYYQAMREVLGENDILEAVIKAEKAHLMKVMQ... 150
521 5.000e-13UniRef50_A0A0H2SL14 Uncharacterized protein n=4 Tax=Thermotogae TaxID=200918 RepID=A0A0H2SL14_9BACT  ali  25  8......ILNYALAKEIEGKNFYKSKLDNISNQLKEIFSMLVEMEQGHAEYIKKLIKKYEDEKNLDVEFEEDDENLFEKKEITGGKIEEMTLDLSVVKMAYLIEDDFMNFYKNAAEKVENKKLFEKLSKWEETHRDILYNIY. 149
522 5.000e-13UniRef50_A0A2J6JBS7 Ferritin n=6 Tax=Desulfuromonadales TaxID=69541 RepID=A0A2J6JBS7_9DELT  ali  16  5.FNLQEALKLAIQTEKDVMDFYLKAASMTKNEGKKVFELLSREEREHASHFFHHYKG-TDLGTFEEFMAQPPKVDTAMLKNLEKTLCESTHERQAMEIALKEEEDLARNLEMTASHVIDRGVFEKMAKETRDHHALIESEYA 148
523 5.000e-13UniRef50_A0A1J4VGC9 Uncharacterized protein n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1J4VGC9_9BACT  ali  27  16.FSPVQAYKIAVKMERDGIVFYQGLLETIKDEAKRELGFLIKEEEDHLATFQTLLREEAGDAFEEDDVVDYIKSRVSDASLKKAKLSEMEHRHTALEEAMNMERRSIVFYEACVNESKDERAFSAIIEEEKKHLSKFAQL.. 161
524 6.000e-13UniRef50_A0A2H0XWR6 Uncharacterized protein n=1 Tax=Candidatus Saganbacteria bacterium CG08_land_8_20_14_0_20_45_16 TaxID=2014293 RepID=A0A2H0XWR6_9B  ali  19  20........KLSIELEKKGYDFYVTAANTTNPLAAATLNSLADRELEHLVRIKEFYLDITGAKKLQADWLKGIDLFPSKKELLDKKFETQEDINDLYIIAEGLERDSYNLYTKIASESSDKKLYSALAKEEQEHFDILDE... 165
525 6.000e-13UniRef50_A0A285SHK8 Rubrerythrin n=3 Tax=Stappia indica TaxID=538381 RepID=A0A285SHK8_9RHOB  ali  17  11VKTMEELLAIAYHMEQEACDNYADLAKRMQREGRAVFEQLAQEEAQHLHNVVNWSERINGARPDLADLQWEPADTFDDEGASSI-APELMGAYRSFSMAVRNEERAFLFWTYIAAQTDRDDLAEQMAREELGHLTTLRAER. 157
526 6.000e-13UniRef50_A0A0S8KJI3 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium SM1_79 TaxID=1703410 RepID=A0A0S8KJI3_9BACT  ali  18  4LKSVDELLDVVIMQEIRAQKLYIEMATMVENSMRKVLECFAKEELRHKQKLEAVKANKTSLEQIDTD------NLEIGDTFEDTKPHTNMDYPELLAYAIKKEKSSNQLYTSIATTFSEKDVFLKLAQQEANHMQRLEFEY. 142
527 6.000e-13UniRef50_A0A1F9AVT3 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A1F9AVT3_9DELT  ali  21  8.....EILKNAILLEKRGKAFYGKVAQQTKNPTREFFQMMADEEEQHIRLLSDQFKTFNDNGKCSIEKPGERIASSVFTDDITKKINAASFEAAAVSAAMSMEERAIRLYSERGKTAKDKALYRWLAQWETEHLEMLSKI.. 150
528 6.000e-13UniRef50_A0A257A5J5 Rubrerythrin n=1 Tax=Euryarchaeota archaeon ex4484_178 TaxID=1978126 RepID=A0A257A5J5_9EURY  ali  18  9.YSLEDLILLGIKSEEVAKEVYEKIAREAKNPLKTRLGALAEEEDRHRIILVELYKDLFGKEPVPPENPDFIPEFPEIRIFME--LGGTTDIRKILEGAMQAELSAKDYYESIADMIEDKRIMRYMAKIEEGHYKILKQQY. 151
529 6.000e-13UniRef50_A0A2U1YJI0 Uncharacterized protein n=6 Tax=Rhodospirillaceae TaxID=41295 RepID=A0A2U1YJI0_9PROT  ali  21  1.......MDVAVGMEHEAALRYEQLAAMVKPELATLFRRLAELEKGHEDQLSRWAERDGLRAPRSAGVSWRMP-----ETFDPADGGPSFGPYEALAVAVRNEERAFAFYTYVAASAEVRRRAEGLAREELEHVGLLRRWR. 136
530 6.000e-13UniRef50_A0A1Z2TMS2 Rubrerythrin n=3 Tax=Thermococcus TaxID=2263 RepID=A0A1Z2TMS2_9EURY  ali  20  21.KSPKELLSYAIFNEEEEAKYYAKLAEKAKASIKALFIKMSEDSKGHHDWLYGLFKKM-----YPDEEPVKVEAPPVEVAPFYPEFESVEDYISALKYCMESELFAKKTYELLARVAKDRAFALNLAAMEEDHYNSIRKMY. 159
531 6.000e-13UniRef50_A0A1M5W8M6 Rhodanese-related sulfurtransferase n=1 Tax=Desulfofustis glycolicus DSM 9705 TaxID=1121409 RepID=A0A1M5W8M6_9DELT  ali  20  130.......FELAYQMEDGLRRFYLALAEKTEAEEREMLHQLAGFEDSHMDRLKAKYSQDGGTQP-----LRVMEGGLDIEQAIEIFKSQLGSIELVLQLGMKLEAQAFDLYQRLAWKHQGEEFYQQMADDEQQHLLQLSRE.. 261
532 6.000e-13UniRef50_A0A1Q2HQW4 Uncharacterized protein n=2 Tax=unclassified Phycisphaerae TaxID=1546154 RepID=A0A1Q2HQW4_9BACT  ali  22  1.MNALEVLEVAKTMETDGIEFYSRAAESADSKAAKLLEELAGWEKNHFEHFEKLQEAVKPDNEAMKYLDYFVKYAVFSPDKDLARKARSLDTSGVLSYAIGMEKDSVCYYLGVKASLKAKETVEEIINEEMSHITILSEELS 151
533 7.000e-13UniRef50_A0A2G6P111 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2G6P111_9BACT  ali  19  10.......LKQGILLEKRGMEFFRTIACQVKDPVKEFFNEMAEEEVVHLKFLTDLYNSLSKTGEFDSSVLERAKTTEIADHVLDEDMEAASFESAAIDAAINFEKKAIELYSKRAAECEDKEFYTYLANWEGDHLKDLEDI.. 150
534 7.000e-13UniRef50_A0A2A5G007 Uncharacterized protein n=1 Tax=Thiotrichaceae bacterium TaxID=2030882 RepID=A0A2A5G007_9GAMM  ali  19  8VKTTSDLMSIALQAEREAIRRYSILAATMRDTAAALFERMVLEEQEHERLLLAWMLHEGIDENSTVAAITWRDPHISTTYNDEARDPYQSSPYRALAFAVHNEEIAFRFYTHVAANSENKSVRKYLAREELGHAALLRAER. 155
535 7.000e-13UniRef50_A0A1F3YEF1 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A1F3YEF1_9PROT  ali  20  10.LNLMDALDLAILIEAEARERYKFFSERYPVDAAAIFDLMARNEEKHGRQLGDRRQKLFGDKP----LRVSSSAIFDVEAPEFGAPRWNMSPLKALQLSLASEEKAYWFYDEAMKHVTDRKLFAELRDEETEHVRMVKE... 150
536 7.000e-13UniRef50_A0A1B7LF79 Uncharacterized protein n=1 Tax=Desulfotomaculum copahuensis TaxID=1838280 RepID=A0A1B7LF79_9FIRM  ali  30  18.FDVKKFIGIMAAIEVKGVKFYEALAERATPEVKDLFLLLAGEEKQHIKDFKTLARELTPGESCSLEEKEFLRGIVSSHSFFQKNLAQVNTAREALELALRFERDSIMVFQEIENYVCDKEILKDLIAQEKGHVRKL..... 175
537 7.000e-13UniRef50_A0A1G0ZBV5 Uncharacterized protein n=2 Tax=unclassified Lentisphaerae (miscellaneous) TaxID=641407 RepID=A0A1G0ZBV5_9BACT  ali  24  3VFNAYEVFEIAEQIERNGFMFYSHAAQSFSPKAKELLSRLARMESEHEKLFKTLKEKFSLKGDDEFPDSEYIRAIAGGKVFVSKKLRADVSYNEIIDTALDFEKNSIVYFTALKTLLSDKNKIDALIEQELSHISMLLEEK. 157
538 7.000e-13UniRef50_A0A1F8ZVG6 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_43_22 TaxID=1797825 RepID=A0A1F8ZVG6_9DELT  ali  23  1...MGEIIDLAIRIETNGQKAYRKAQKEVSDPLAAMLGWLADEEAEHEKWFPRLKETMEEDAKMEEMGKSILQGVLGEQTFDGADFSRIEDMDSLLTLSVEFEKDTILFYEMLSAFIEDEKILKQIIEEENRHVRFLED... 145
539 7.000e-13UniRef50_L0HJ12 Uncharacterized protein n=3 Tax=Euryarchaeota TaxID=28890 RepID=L0HJ12_ACIS0  ali  17  6.YNLKTLLLAAIKSEIDSGELYRTLASRVKNALKDRLNFLAGEEDKHRAYLEAFYRQKFPDEEIEVPEKTPVP-------LPEVDPSEERLLSEIIEDAMNAELAAKDFYESLKNKVEDRKMLQILANMEQGHYDILAKE.. 141
540 7.000e-13UniRef50_A0A2N1W8E3 Uncharacterized protein n=1 Tax=Candidatus Goldbacteria bacterium HGW-Goldbacteria-1 TaxID=2013807 RepID=A0A2N1W8E3_9BACT  ali  25  5..NIKDVFKVAIKIEENGRRFYEYAASMAGNDIKGVMLTLAKEEEKHKKTFEKMMAQLKGRYSMSEFSEQYMENFKKDKFNSAAAEKKMDNIIHAVDFAMDREQDSITLYEGIKNIVEHADIVQRIITEEQNHFLKLS.... 153
541 7.000e-13UniRef50_E4RJM5 Rubrerythrin n=9 Tax=Halanaerobium TaxID=2330 RepID=E4RJM5_HALHG  ali  34  5.FNALEVMEMAKDIEKKGKKFYLTHAKATDNELKELFNKLADAQEEHYKKFVELTEELKGDYLYDEEVSAYFEYLVELTIFPEKSKEALNDAKKALDLAIRAEKDAILFYREMCANNSGEEAVEKLIKEKKRHLRELGK... 154
542 8.000e-13UniRef50_A0A2N1P9I6 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium HGW-Zixibacteria-1 TaxID=2013855 RepID=A0A2N1P9I6_9BACT  ali  23  3......VFEFAMKMEQDGKAYYEKMAQNAGNSIKKILLDLANDELKHYNIFKKFFSGVAELKTTGTKVLETAQNVFQQIATSGKKFEFTSDIRSAWEEAQKVEKKSEDFYRIKAEEETNKKTLKVIADEEHKHWALIE.... 142
543 8.000e-13UniRef50_A0A1V4ZK64 Rubrerythrin n=1 Tax=Methanomassiliicoccales archaeon PtaU1.Bin124 TaxID=1811730 RepID=A0A1V4ZK64_9EURY  ali  23  15......ILQAAVEIEEFGIKFYGKLSCVAEEEGKALMRALARDEATHRELLLKEIDRLMKNGGKVEPDNRYIDIVPEKAVLPKDRCLTVKEEVEILEVGMGVERKSIEMYTKAANNAADKRLLVDLSHIEEGHLKLLQE... 153
544 8.000e-13UniRef50_A0A1V5CSQ4 Rubrerythrin n=3 Tax=Bacteria TaxID=2 RepID=A0A1V5CSQ4_9DELT  ali  24  2.....DIYEYAMQMEKESEKYYRELVEKTMNKLRAILTILADADVEHYNIFQKMKKDESIQM-TQTDVLSNVKKVFARMKEKDDTAGVDMSEIELYRKAQEIEKRTETFYREKAGIATDKRILHKIADEENKHYLTLENI.. 139
545 8.000e-13UniRef50_A0A0S8KU96 Uncharacterized protein n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A0S8KU96_9CHLR  ali  18  9...ALAVLEEAMEVERQGEAFYEEAAEHVQDPAKAVFQTLARDEVQHLRLLQAEHDAIRSHRDWIDLDEAKAYELSSPLKLFPDKIPADATDEHALELAMKFEDKGYTMYVGAAADATDAELFEFLAKQENSHYAFLLKTY. 156
546 8.000e-13UniRef50_A0A1F5A368 Uncharacterized protein n=1 Tax=Candidatus Aminicenantes bacterium RBG_16_66_30 TaxID=1797274 RepID=A0A1F5A368_9BACT  ali  14  8..SAAEVITFAIGREIEAAEAYARWADMARPGLRELLLYLRDQEVSHRRLLEGL-----TDEAIRALEPAFVPDLGIVDALADETLAGDMSLQEVLIFAARKEKQAAELYESLARTAAHQQLFLFLAGQEREHKLKLEAEY. 145
547 8.000e-13UniRef50_A0A1G5KYD2 Rubrerythrin n=1 Tax=Alkaliphilus peptidifermentans DSM 18978 TaxID=1120976 RepID=A0A1G5KYD2_9CLOT  ali  23  1MENYKGILKYAMEMEKQGFTFYKENAVKFSSPARDLFEKLAAVEMEHYEFLKEQLSYYESKNEIKDVTVDIDKERFEREQLGETMMESLTPELTILRMAYLIEKDFAEFYRSMSDRATEKKLFYVLATWEEGHEELFKAEY. 151
548 8.000e-13UniRef50_V7IAL5 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=V7IAL5_9CLOT  ali  26  6..NGTKLVKLIADNEIKVAELYRTMAKEVKGIGVQFFENLAKDEERHNMIYAALLGKVPDDVELDEDDAKYLDLLIDNNFLNDSEAVIAKDKSQVFDIAERVETDSVMFVTELARVYPDKGDLATILKEEKKHLRTILEKK. 154
549 9.000e-13UniRef50_A0A291GEK7 Rubrerythrin family protein n=72 Tax=Bacteria TaxID=2 RepID=A0A291GEK7_9RHOB  ali  15  14.LSEQEIIALAISSEEDDARIYRQYAEKLRPDSAKIFDGMAVEEDGHREALISLHKRRFGDVI----PLIRREHVSGYYARNPVWLIENLGLERMRDEAQAMEQSAEAFYRKAAERTQDRALLGRLAAAEAGHERRAEEL.. 154
550 9.000e-13UniRef50_M1MNB8 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=M1MNB8_9CLOT  ali  25  5.FNELEILKVAMLMEEEGRAFYTNGAKYADGRLKDFLIAAAGQEILHKELFSKLYDELSSKINFDPEVTSYFKDLIENKVFDKKTPQEDKDLKSAIEYSIKSEELTVEVYTKMYEGIEVKDVLAKIIEEEKTHIEEFKKL.. 154
551 9.000e-13UniRef50_UPI000B98B39B rubrerythrin family protein n=1 Tax=Clostridiales bacterium SK-Y3 TaxID=1792311 RepID=UPI000B98B39B  ali  25  5.FNDLEIIKIAISMEEEGMNFYTSGAKYTSGKLRDFLLHAAGQEMAHKEKFTRLYNEFLEKKNFEPDVAAYLKSMVENQVFSKKPKTDDKDLKTAVADAVQAEETTAALYTQMAKYQEVKNVLAILIEEEKEHAKYFKGI.. 155
552 9.000e-13UniRef50_A0A098FHK1 YrkC n=1 Tax=Bacillus simplex TaxID=1478 RepID=A0A098FHK1_9BACI  ali  18  30.......IQKAINAEFSAIACYEKLANNAPQDERNKILEIQKDERRHLEEFSGIYTNLTGRQPTY-----------------KITEECPEKYRAGIEFAFKDEQEAVDFYLDIADKAQDKERFRRAAADEQNHAVWF..... 146
553 9.000e-13UniRef50_A0A257A5R2 Uncharacterized protein n=1 Tax=Thermoplasmatales archaeon ex4484_30 TaxID=2012522 RepID=A0A257A5R2_9EURY  ali  28  2.....EEIKIALQLEKDGYKYYKKAAESCKNEGKKMFEKLAEDEIRHLEKFREIAKKIFGEI--------EEGEGKHLDIFEKIDFSTRSGEYASLDHAIKFEERAYEYFKNAADKARDKKLFEEIAEEE............ 122
554 9.000e-13UniRef50_A0A1J4VUL9 Uncharacterized protein n=1 Tax=Candidatus Omnitrophica bacterium CG1_02_49_10 TaxID=1805289 RepID=A0A1J4VUL9_9BACT  ali  27  14.....EIFQVGMNVEKKGEAFYRNLSKMTKNPTRRIADGLLESEKEHYALLLRLKAGLASKKNKDSEVSKYINSLIKTNIFPESKFVKKISDKDALNIGIQAEKDSILFYTEMSTNTSGKRALARLIKEEKEHLIILT.... 158
555 9.000e-13UniRef50_X0TYF3 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0TYF3_9ZZZZ  ali  28  24............................ADEQARDKLLELAEMEDCHEQTFAQVREALRVEESQS--------STFDPEGGP-VDLICDKPIGELLRIAIELEKESIVFYLGLRDLVPAKDKVERILKEEMS.......... 121
556 1.000e-12UniRef50_A0A1F9AV75 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_49_15 TaxID=1797827 RepID=A0A1F9AV75_9DELT  ali  34  6ILSALEIAKMVCNIEEDGIGFYKAAGESSEPDVESLFSGLALKELEHLTTFRNIYAKLDAEVLFDDQITAYLKVLAEGVIFPKKWFSVHKDIKEAVHFAINVEKHSILLYSEIATFANSQTIIRNIMEEEKSHLVILNNM.. 163
557 1.000e-12UniRef50_A0A1F5B6G8 Uncharacterized protein n=7 Tax=root TaxID=1 RepID=A0A1F5B6G8_9BACT  ali  18  5..NLRAVLDFAIQREEEAANNYGKLCRIATDQAKRLLADLQQEEQNHKRILQGL-----NQGKIRASAAKDVKDLMISDYIVEEPLTPEMNFQDLLIFAAKKEKKAVDLYSDLAKKAEQKALFEYLAKQEKAHKLRLELEY. 142
558 1.000e-12UniRef50_A0A2H6HXK6 Rubrerythrin n=1 Tax=bacterium BMS3Bbin04 TaxID=2005727 RepID=A0A2H6HXK6_9BACT  ali  24  3......VFEYAMQMEKDGETYYRELAEKTQNELKTILIMVADEEVKHYNLFKSLIKNVRAQSLPPSDLLKNTVNVFQKMAESGEKFPEDGEAKAQYAKAKKIEDDAAAFYTEKANETSEKDLLLQIAEEEKRHSRLFQE... 140
559 1.000e-12UniRef50_I4CD14 Rhodanese-related sulfurtransferase n=3 Tax=Desulfomonile tiedjei TaxID=2358 RepID=I4CD14_DESTA  ali  21  128..TPAQIIKLAYSMEESLGTFYRIAKTKTEDEIIGILDNLASIEEKHKDYLIDLLQEAEPELTAQRPESQILEGGFRMDDFLKQNERFLTQVSSLLDMAMMLETQALDLYLRFADKAEDKDVLFKIGQQEKQHVAALGR... 272
560 1.000e-12UniRef50_A0A2I0N0D2 Uncharacterized protein n=1 Tax=Clostridiaceae bacterium JG1575 TaxID=1658742 RepID=A0A2I0N0D2_9CLOT  ali  22  6....LEVIKEAILNEVEGYQFYRLYAEKVQSEVKKAFLAIAQEELDHIEFLKKLKDNTREESLKMAEMDVPAPGIF---KFSALTPDELSLALAAFSIAMKMEDDSQRFYDEAAQKAEEKALYEKLRDWERMHRDSFEVKY. 143
561 1.000e-12UniRef50_A0A162MH60 Uncharacterized protein n=5 Tax=Firmicutes TaxID=1239 RepID=A0A162MH60_9FIRM  ali  27  1...MNEIYKKAIEFERKGFEFYKEIAEKMNQPAKRLFESLAEQEKEHIHFIEDIYEKGNFEIGIAELKQINKMEEDIKKVFDKEKRKAPLDHIEGYKLAMELEKKGYEMYKDFAKNSKEKEFFETLMEQEKQHFESLNNVY. 144
562 1.000e-12UniRef50_A0A1G3PJ02 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWF1_51_8 TaxID=1802190 RepID=A0A1G3PJ02_9SPIR  ali  23  1.MEALDALVLAFQMEVNGKDFYLALSESAEPEISKLLEGLAEMEDEHTLYISGKISEIRSKYPELPEPPKITVDLYDRRYFDKGGYDEKLTAVLILRMAYYIERDFMDFYQKAANVNDVKKVFEDLMTWEVKHLMQIKE... 145
563 1.000e-12UniRef50_M7T8W7 Rubrerythrin n=12 Tax=Euryarchaeota TaxID=28890 RepID=M7T8W7_9EURY  ali  18  12.FDLEELLLAAIKSEVDSKQLYSKMAKKTKNGLQDKLEFLANEEENHRNFIEEIYKNHFPENEIVLPKTTPVP-------LPEVEFSEDTPLSKLLTKAMKAEQSACDFYKSLAGRFEEHNTLLYFSDMEIGHYKILEMEK. 149
564 1.000e-12UniRef50_A0A1L5PF06 Ferritin-like protein n=1 Tax=Rhizobium etli 8C-3 TaxID=538025 RepID=A0A1L5PF06_RHIET  ali  17  11IQSMQDLLTTARSMEQEAVAGYQALSERMRAELASVFDRLVAEEQDHLAMVEQWSAQ---TGIACETEALPDQVSLFDDEGAGVVAPQMLSACRTFSIAVRNEERAFVFWTYVAAHAPTPEMAERMAREELGHVATLRQER. 155
565 1.000e-12UniRef50_UPI0004284BB4 hypothetical protein n=1 Tax=Desulfatiglans anilini TaxID=90728 RepID=UPI0004284BB4  ali  23  35MISGEEMIGIAYGMEEGLARFYGRAVERTDPEAAGLLKRLAAFEEKHKQALVELYDEILPENGGEEGLRANVEGGFHLDDFLKENERAFASPGECLQLAMMVEAQALDLYLRFTDKVTDEKVLFKTAEEEKGHLAALGEL.. 187
566 1.000e-12UniRef50_G8QSW1 Uncharacterized protein n=3 Tax=Spirochaetes TaxID=203691 RepID=G8QSW1_SPHPG  ali  28  2.....DIFEIAIQMEKEGAVFYYDLADKAPTKGKTIFKMLAEDEEKHQEVFTKLKNK---SESVMVPTKVADKAMSIIRGFKKEDFEKEKAQMQVYERALNVEKMSIEFYEAQMGNLETEEMVEEILNEEKRHYSMLEEL.. 137
567 1.000e-12UniRef50_H0FVA5 Uncharacterized protein n=19 Tax=root TaxID=1 RepID=H0FVA5_RHIML  ali  19  15MASMTELLSFARAMEQEAVDGYVALAARIRPDLAAVFDGLVAEEEGHLGKVDQWLGERAPQPVS-------LPEPFFDDEGAGVVAPELLTSYRAFSMAVRNEERAFVFWTYAAAHAPSEEIAERMAREELGHVSTLRRER. 155
568 1.000e-12UniRef50_A0A076W407 Rubrerythrin family protein n=39 Tax=Bacillales TaxID=1385 RepID=A0A076W407_BACMY  ali  18  22.......IENAINGEYSAINCYAKLANLAPDNERNQILEIRQDEIKHFQQFVQIYIHLTGKQPQ-----------------PKIIEQCPDSYVNGLEYALQDEQRTVDFYLKIADDTTDKETFRRTAADEQNHAVWF..... 138
569 1.000e-12UniRef50_A0A133N0F0 Rubrerythrin n=15 Tax=Finegoldia magna TaxID=1260 RepID=A0A133N0F0_FINMA  ali  25  9......IIDDAVNREDDSYTFYKDAAEKAEDPTKSLFERLSKEELKHKDYLQKFLETKAETIKIDDS-----EDYNLSQDIDRPRMTTEMNFTDAIKLAIKREEEAMQLYADIANSCAEKDIFAGLSKMEKMHKTELEEI.. 141
570 1.000e-12UniRef50_D6SQJ8 Rubrerythrin n=3 Tax=Desulfohalobiaceae TaxID=213117 RepID=D6SQJ8_9DELT  ali  20  5..NFKNWVCKAVEMEEKGKAFYEQAAKECTTQMQKIFSMLRDDEIQHIQRIREIEKALDEQACCMDDMGSDAGQAFKELAEKVKSEKPCDSTAKALNAGIDFELALVKFYEEALEKASERDFLKRMIQEEKGHYVLLSDM.. 151
571 1.000e-12UniRef50_A0A1I5UXU3 Rubrerythrin n=1 Tax=Caldicoprobacter faecalis TaxID=937334 RepID=A0A1I5UXU3_9FIRM  ali  24  1MEKIRKILKFAMRMEKNAKDFYEFYAEKVSEETKRIFEELIEIEKQHFDTLKKEYDKLGFTEAPDDNFKARDPHILADNSDMLQEADVGVSDVSVMRMAYLIETDFWHFYNKAAQAVDEKKLLTDLAEWEKQHSDMFYKKY. 152
572 1.000e-12UniRef50_A0A1V4M1N9 Rubrerythrin n=1 Tax=delta proteobacterium ML8_F1 TaxID=1775671 RepID=A0A1V4M1N9_9DELT  ali  20  8......LIKQAIVNEVEGYEFYQLAAEKASKEARETLLNLAKEEMTHIEYLQDLFNKVKDDRADDYNLATLEPPKTQKIFKVATLDKADLSMMSVFSIGIQMEKASVAFYTEAKASTEARELYDILIDWETLHMHQFTEEY. 147
573 1.000e-12UniRef50_A0A0S8KBW6 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium SM23_81 TaxID=1703428 RepID=A0A0S8KBW6_9BACT  ali  18  8....LESLSTAIKTEQDGGAFYKAAARRSANPAKSVFETLADEELVHIETIKAFYCALQEKGTCQELGGLLEDKPHAKTRLENVFKKACQDMLEAYEAAMELEQKAYNMYQRLIKDTSDRKLYQFMLEQENEHYAFLKE... 156
574 1.000e-12UniRef50_K0NBW5 Rbr7: putative rubrerythrin n=8 Tax=Desulfobacterales TaxID=213118 RepID=K0NBW5_DESTT  ali  20  5..NTLTILKNAFLIERKGKSLYEKAMDHADDSVKAFFKDLADDEQEHMNILEKQFKAYMKNGKFMAGGFENDGGAVTPPDILDDTLKNRINEATAITAAIGFEDKAVKMYAQRAREATDKKMYKQLSAWEKTHLKKLMALEA 152
575 1.000e-12UniRef50_A0A2M7WIJ3 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium CG_4_9_14_3_um_filter_46_8 TaxID=1975520 RepID=A0A2M7WI  ali  20  8...IKEILKIGIVTEINGERFYRNFAQMVTSETKGKIEHLAHDEVIHRQVLEKIYSE---QFHSRPEDLPDKGIGVFEKVLHGHRLSKEATVPGLLDIAIEAESATRDYYADGEKIIPDKAVFRRLALEEDGHFNLLTAEK. 146
576 1.000e-12UniRef50_A0A1M5S4K6 Rubrerythrin n=1 Tax=Thermosipho atlanticus DSM 15807 TaxID=1123380 RepID=A0A1M5S4K6_9BACT  ali  26  6......IVNMAINVEKQGEFFYKELAKVVNKKFTDTLLELAEQEKQHAEVFIKLADTKEWDEI-DSYISSYASVYIIPDLERIVESFDKRNLNSIFELAIEIEKDSIILYYELKEQVNDKNLIKKIIEQEKSHIKKIIEMK. 142
577 1.000e-12UniRef50_A0A2N2GYK6 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2N2GYK6_9DELT  ali  28  5...LLNILEIALTMEEKGYSFYNKVVNTTQNPLRAMFGRLRDDELVHMERIKTIIAGIQGGSEWKINYDSTAEMFRELARSHAQELTPDADDVEAINVGLDFEAKAVTFYEEHLKDAQDPEFIRKMIVEEKDHHDTLKRFYA 157
578 1.000e-12UniRef50_A0A081BPH4 Uncharacterized protein n=1 Tax=Candidatus Moduliflexus flocculans TaxID=1499966 RepID=A0A081BPH4_9BACT  ali  27  4.FTADEMYALAEEIETRGNRFYAAASERADAETRGLLQELAKWENEHFRFFHELREQLEESEEADEDHAAYLQAMVQDRMFPADVNAAFAAMPDALEYALQREKDVIVFFLTMRDLIPGREKLDAILTEEARHVRIITQ... 157
579 2.000e-12UniRef50_A0A0S8K0J3 Uncharacterized protein n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A0S8K0J3_9CHLR  ali  13  7.LTALEVLGVAIKSEIEAAALYARMADQVGNSLVAKLNFLRQEEEKHRAILEDVYARQFPDVELQLPAKSLVPVV-------DATALEGLTIPELFQLAMKAEQISADFYAQEADRSRDRTVLRYLSNVEHSHYKMLETE.. 142
580 2.000e-12UniRef50_UPI0009B97486 rubrerythrin n=1 Tax=Varibaculum timonense TaxID=1964383 RepID=UPI0009B97486  ali  24  2.....DYLEFAIKMELDGEKYYLEQAEKNKGSLASIFQLLAKDERKHAEIIRNKSKELPYELKEDEALKEY-KNVFEGVEDFSSKLKTAPGQIDAYRLALEKEKESIDLYEKMGGEASDKKLFAFLVEQEKAHYKIFDEL.. 139
581 2.000e-12UniRef50_A0A1T4QY03 Rubrerythrin n=2 Tax=Geobacter thiogenes TaxID=115783 RepID=A0A1T4QY03_9DELT  ali  20  3......ILECAIQMELETKNHYCRLAQRVSQELKQMFTLLAAAEEEHGNVMSNI-KNIPDLASIHFKALKEAICIFRPFPDLHNISAELAYDMDAYHYVIHEEIKSISYYEDLITKTEDKDIFTHLLEEEQKHLSLLENIY. 140
582 2.000e-12UniRef50_A0A1V6A374 Rubrerythrin n=1 Tax=bacterium ADurb.Bin157 TaxID=1866935 RepID=A0A1V6A374_9BACT  ali  25  7...LGDLFNTMIALEKCGAGFYESAALAADDNVRETFKRLALQEKTHEKTYREMSLKIGDLPEIDGEYADYTADLIDSFALTANMPSKTATVGEAFEYAKKLEEDSIKFLEVLEKLLGSKEIFGEIKQEEIKHLKIVENLIA 149
583 2.000e-12UniRef50_A0A0S8JPN4 Rubrerythrin n=3 Tax=Bacteria TaxID=2 RepID=A0A0S8JPN4_9BACE  ali  17  6..SVDEILEFAIKDEQRAANLYIDLAKRSRNEMRRTFLQFSQEELGHKKKLERIR-----TGGQIVVSDTKVQDLKIGDYLVEVSTSRDDSYQEALIIAMKEEKAAFKLYSDLTDDAAAREVLLMLAQEEARHKLRFEIEY. 144
584 2.000e-12UniRef50_A0A0S8KIA7 Uncharacterized protein n=3 Tax=Planctomycetes TaxID=203682 RepID=A0A0S8KIA7_9BACT  ali  17  6..SIDEVLDFAIGREVEAHEFYVKLAGMVKPEMVKVLSDLASEELEHKAKLEAVKAGE------ITIDEEEIGNLGIADYVEKVEPHAKMSYVELLVVGMKKEEKSRKLYSDLASIAELKDMFLKLAQEEAEHKLRFELEY. 142
585 2.000e-12UniRef50_A0A2G2E1G8 Uncharacterized protein n=1 Tax=Desulfotalea sp. TaxID=2030813 RepID=A0A2G2E1G8_9DELT  ali  18  130.......FEIAYHLEKGLQQFYLLLAKEASSQITDLLQKMAQMEEGHMALLIAQSKNAGLQIKTSSHSSGIIEGGLSLTQLQTAFGDNIKTREAVLQLAMMLEAQAWDLYSRLARISTEQEFYQQMSVEEQKHLDKLTAE.. 266
586 2.000e-12UniRef50_A0A1X7BP10 Rubrerythrin n=19 Tax=Proteobacteria TaxID=1224 RepID=A0A1X7BP10_9RHOB  ali  15  14.LSEQEILALAISSEEDDARIYRSYGEMLRPDSAKVFDGMAVEEDGHRQQLIDLHRSRFGEVI----PLIRREHVAGFYARRPVWLVENLGLERIRDEAAAMERDAERFYLKAAARTSDRKLLGDLAAAEAGHEVRAGELEA 156
587 2.000e-12UniRef50_Q92Z51 Uncharacterized protein n=16 Tax=Rhizobiales TaxID=356 RepID=Q92Z51_RHIME  ali  21  11MASMTELLSFARAMEQEAVDGYVALAARMRPDLAAVFERLIAEEEGHLGKVDQWLGERAPQPVSLLEPFFDDEG-------AGVVAPELLTSYRAFSMAVRNEERAFVFWTYAAAHAPSEEIAERLAREELGHVATLRRER. 151
588 2.000e-12UniRef50_A0A1M4TL31 Rubrerythrin n=17 Tax=Bacteria TaxID=2 RepID=A0A1M4TL31_9FIRM  ali  19  5..DIKAIIKFAVENEIEAYEFYIGATNKVKDNLKETFQELAEEELKHKKFLEEFLVS-----DINEIRLHQTNDYKIAETIDKPKLTVEMKFADAIGLAIKNEEEAMDMYKNLADICIDRKLFLGLMEMEKMHKAKLEEIY. 142
589 2.000e-12UniRef50_A0A1G2YSG3 Uncharacterized protein n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G2YSG3_9BACT  ali  21  2.....DIFEFAKEKEKISEENYRKLSEETENELHKIFVMLANEETSHYTAIEAMHNN-EIAEIPPSDILNDAKKIFDSMRKKTGEFNFKMDEVTVYKKARQLEIESEMFYRQKAQEVGDKDTFLKLAEMEHRHYIMLENIYS 141
590 2.000e-12UniRef50_A0A1F9WPV0 Uncharacterized protein n=2 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9WPV0_9BACT  ali  23  50...LRDFYRLAVLIEEEGRDFYLRLAAQANPDTRKLCSSLAEEEAVHKNLFQDQLNRWRSLPANPAQWHVFLEQAKQAGIFEDFPGDKAA-EEEMARFAIRQERKTAEFYGHFETAFPDAARMRELVEEERSHENRLRAAY. 190
591 2.000e-12UniRef50_A0A0D5N5Y1 Ferritin n=14 Tax=Desulfuromonadales TaxID=69541 RepID=A0A0D5N5Y1_GEOSN  ali  20  5..TLEDIIRFAVQREETAYRLYKTAAEKATSAARKMFEEMANEEAGHKHAFENLNIEGAEH-----YTFAERPDMKLAEYMVDLPFREDMDYPEILRYAMKTEESAYKLYMAASEMTDDKRMLMVLADVEKGHKLKVEALY. 142
592 2.000e-12UniRef50_A0A2N1PK95 Uncharacterized protein n=1 Tax=Candidatus Wallbacteria bacterium HGW-Wallbacteria-1 TaxID=2013854 RepID=A0A2N1PK95_9BACT  ali  23  41.....EVFNLAMAMEHEAGSFYDAAAGMAQDEMRDIFRKLAIMEEAHRQRFESLGMEALRISEDSDSGDHSVNAFLRSLVWSREELINSGNMVKVLQRAIENEKEAILVYLGISGSLSAREAVDVVITEEMSHIVILSDMLA 192
593 2.000e-12UniRef50_A0A1G3NZJ1 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWF1_31_7 TaxID=1802187 RepID=A0A1G3NZJ1_9SPIR  ali  18  1MMN---IFDFALDMVKESENLYRELMNETDNGMKNILNMLADDEVKHYKAIQNAVKNLDNTSFADTKVLESGINIIKKFSINNDDIGISQKQLTIYKKAQQIELKSKNFYQEKADEAEHKSLLQWLALEEEKHYNLLDNI.. 141
594 2.000e-12UniRef50_A0A1G1KN75 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A1G1KN75_9BACT  ali  26  4IFTAAEIIDMGIVKEKKRRDFYGYAADDFKEEMKDLFSRLRDWEDEHIKRFTEIRDSTKDYEVSESYSGEVVDDMLYKQVSPEWFAKNVRDSLTAIQYGIGFEKDAILFFSELLKYMPNKEKVEELIGEEKKHLIYLSQAK. 154
595 2.000e-12UniRef50_A0A1F3ZS22 Rubrerythrin n=4 Tax=unclassified Betaproteobacteria (miscellaneous) TaxID=33809 RepID=A0A1F3ZS22_9PROT  ali  14  3.YTLPEFLAHALALEKEAAERYLELADMMEDAVSKVFRDMHGFSLLHHDEIRKRAGGIDLPELRSWQYRWRTPPETGG----EEAFDNTLEPYHALRYARDNELRAMRYYQSVAAEAQNTDLAREFADEETEHVTALDNWIA 146
596 2.000e-12UniRef50_A0A2M7YQT5 Uncharacterized protein n=3 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2M7YQT5_9BACT  ali  18  10...MIKVVKDAVMVEVKGQQLYSHAAEAVDPAAKAMFEMLAKDEDDHVRILMTQYKSLMSDGKLDLSEVHPAAVDHGSQDEFKKSIKGGKFEMAVIGIGCDLENKAIAYYKKHAAETDDKQLFTWLVEWEDGHLEQLMEL.. 154
597 2.000e-12UniRef50_A0A1M4S4R4 Rubrerythrin n=1 Tax=Alkalibacter saccharofermentans DSM 14828 TaxID=1120975 RepID=A0A1M4S4R4_9FIRM  ali  23  3......LYDMALKLEVDSKEYYIKQAEEAENELKKIFHKLADDEQKHYEYVQKLASGNL--EFKETDVLNDVKNVFTELLEKDIKFEMNLSTIEAYEFAKKMEQESIDYYQKLQKDNTDPDLLKKLENEEKKHLLTLEDI.. 138
598 2.000e-12UniRef50_A0A1I0MAW9 Rubrerythrin n=11 Tax=Thermococcaceae TaxID=2259 RepID=A0A1I0MAW9_9EURY  ali  19  21.KSPKELLSYAIFNEEEEVKYYSKLAQKAKASIKALFIKMSEESKDHHDWLYNLFKKL-----YPEEEPVKVDAPPVEVAPFYPEFESVEDYLSVLEYCMESELFAKKTYEVLAKAAKDRVFALNLAVMEEEHYEEIRKLY. 159
599 2.000e-12UniRef50_UPI000C1C2949 rubrerythrin n=2 Tax=Peptoniphilaceae TaxID=1570339 RepID=UPI000C1C2949  ali  20  6...FEKIMDYAINEEVLSYEFYTDAANKVTDALKDTFTDLAKEELEHKKFLEEFKSTHSQTIN-----LEESVDYKIADTLDKPELTVTMSFQDAIALAIKKEEEAMEMYQSLADASVEKSVFIGLKNMELMHKSRLEDIY. 142
600 2.000e-12UniRef50_A0A0F2N913 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c4a TaxID=1629716 RepID=A0A0F2N913_9FIRM  ali  26  5..TLESIIKIAISIEEKGSKFYALMARSVNDKIKSIFERLSREELEHKAAFEKLLRENSNEGNITEKEAKLLDSFVKTGVFHQVEDSPVEGPMEALALGILAEKDAILLYQGIYNQASVKDMMSRLLEEEKMHLVELRE... 151
601 2.000e-12UniRef50_A0A1F5YB74 Uncharacterized protein n=1 Tax=Candidatus Glassbacteria bacterium RBG_16_58_8 TaxID=1817866 RepID=A0A1F5YB74_9BACT  ali  20  39......LIKIAMSSEDETRAFYLKCLEREPDRVRELFRRLADEEVRHKGRLEALLATRLREVLEVEEGKLP-RVIVPSEEEMATGSGPAMGALEVLKRALDHEVSSHNFYALLGKRSALRKTFVFLASEEEGHIRRIRQM.. 175
602 2.000e-12UniRef50_K2D7E8 Rubrerythrin n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2D7E8_9ZZZZ  ali  30  4LFYLSEIVKFAIEKEKESIALYKELSEKVNNNMKDLFHQLMLDEEKHEDFYVNLLKEQSPGVKENEEYDAYMQELFTSRAVPHLRLENLTDIKSALDYAAAREKDSIVFYVGLKNYLPEKEKIDPIINEESRHMAKLLFLK. 152
603 2.000e-12UniRef50_A0A1F3TAP0 Uncharacterized protein n=3 Tax=unclassified Bdellovibrionales TaxID=404130 RepID=A0A1F3TAP0_9PROT  ali  20  26..DFYDIMDFAILKEEEAYNVLLGLCKKMENEAKKALNRLASEELEHIKVLQKLIAGGPGNFKATKVTFEKYQDQEFSDVL-----KEDATVKEVLEFTIAKEKDSYLFYNDMARAYKDKETLINLANLEKAHQTRLEKIY. 163
604 2.000e-12UniRef50_A0A0F2NQB5 Uncharacterized protein n=1 Tax=Desulfobulbaceae bacterium BRH_c16a TaxID=1629713 RepID=A0A0F2NQB5_9DELT  ali  29  10.FRADEVLDMAIRIENQGVIFYEALAADPATGVKLVFQYLLDQEHEHISTFEEMRQHLSDPESYAGETESYMKSFVNEKVFITAEAEHVADPFEAIDYGLEFENRSIIFYQEMKKLVPEREAIEKVIDQERDHKRKLESL.. 159
605 2.000e-12UniRef50_A0A109JXG3 Uncharacterized protein n=16 Tax=Rhizobiales TaxID=356 RepID=A0A109JXG3_9RHIZ  ali  20  13..SMPELLATAKAMETEAIAGYETLADHMKPDLVAVFERLAAEERGHLASVEDW----SGQMGMASVAAGEEPEDVFDDEGMNLTDPALLSAYRAFSVAVRNEERAFLFWTYVSAHAPTQEIAERMAREELGHVSVLRRER. 154
606 2.000e-12UniRef50_A0A259U6A7 2-polyprenylphenol hydroxylase/glutamate synthase n=1 Tax=Sporomusa silvacetica DSM 10669 TaxID=1123289 RepID=A0A259U6A7_9FIRM :_  ali  28  4LLSDLEGLRIAMNIEKRGFNFYQKAYNKFKDQAKALFKTLMEEEQEHLITFTEYFNQIEEEYLFDAETSKYLTALVDSHVFPAEQINELATLGNIIKLAIGAEKDSILLYDELAKCSDAKAVFLKLKGEEQRHVTEIS.... 157
607 2.000e-12UniRef50_A0A1E3X7Q8 Uncharacterized protein n=5 Tax=root TaxID=1 RepID=A0A1E3X7Q8_9BACT  ali  22  5..TIESILKKAADKEEGAYLLYKNAANCAKDHTKTVLSKFAEEEQKHKQALEE-FNIGSLKEQKIEIEEEHRQGISEYLVSTDERLSEDSDFKDIIIYAAKREKKAFRFYSNMSKSVGEKKLFVWLAQEESKHKEDIEAL.. 145
608 2.000e-12UniRef50_A8ZZU0 Rubrerythrin n=2 Tax=Desulfobacteraceae TaxID=213119 RepID=A8ZZU0_DESOH  ali  13  5..DFTDIIRFAMDNELEAQTFYEEASARLENPAKQMFTELAGEEKRHRDLLRALYTS-----NRFGDFFHEDRDFQVAETVEMPALSTDMKPADAFALAMKKEEAAMKEYTALGDACRDKRLFLDLAAMERSHKLKMEK... 140
609 2.000e-12UniRef50_A0A151F1C1 Uncharacterized protein n=6 Tax=cellular organisms TaxID=131567 RepID=A0A151F1C1_9EURY  ali  22  7..NIDNLLIEAMNAEIKAKEFYIYASEKAQSKAKKLFKELADFEQNHYDRVKGIIQTRKNGQKVEDIFSSPGIPSVRSEIEGEFEPNKDEVAM-VIDLAIKAEKNAQERYLKIAKMLKDKQIFSNLAQDEKNHQRILEDE.. 147
610