current user: public

If you have questions about the server, please let us know.

Query: TM0013 TM0013 281894 Purified-2001-08-24, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# E-value Template Links and tools%idFirst MFENEILFDNGQHKFMFLGWEEKEEEIVQTNQYLILDGNEGILLDPGGAHVFPRVMSNVAEVVDLSSIRHIFYTHQDPDVTSGILLWLSICENAKIYISSLWVRFLPHFGIYDQKRIVPISDKGTKIKLLSGNELEILPAHFLHSTGNFVLYDPVAKILFSGDIGAAVFEKGKRYRYVDDFERHLPLMEAFHKRYMSSNAACKKWVDMVSKKKIDMIAPQHGAVFRGESVKKFLEWFRNLKCGVDLIDNLYSLLast
1 2.000e-85UniRef50_Q0AUF2 Putative flavoprotein n=4 Tax=Syntrophomonas TaxID=862 RepID=Q0AUF2_SYNWW  ali  17  6IKENIYWVGVQDPDLRVFDIIMRTEKGSSYNAYLIKGSEKTALVETVKDEFFEEYIEKLQEIIKLEDIDYLIMNHTEPDHSGSIARLLEKAPGITVVGSSNTIEFLREIINKDFDAR---IVGQGSNLNLGDKSLHFIGATLLHWPDSIYSYLPEDRILFTCDSFGSHYASDKIFDDLIEEDFSQEYKYYFDVIMGPFKPYVLRALERIKGLDIDIICPGHGPILRSN-ITHYIDLYRQWPKIVMAYASAYG. 263
2 2.000e-83UniRef50_A0A1G1LH30 MBL fold hydrolase n=4 Tax=PVC group TaxID=1783257 RepID=A0A1G1LH30_9BACT  ali  19  8IVPGVYWVGAVDRERTVFDSFMSLPYGTTYNSYLIKGKGSTALVDTVSPDFADTLLKKVSEVVAPETIDYVVMNHAEPDHAGSLPKLLSIARKAQLVTTKKGLGMAKVFYDIPEERVK--VVAGGDTLSLGDKTLRFIDAPWLHWPETMFTYCVEDKILLSCDFFGAHVASERLYADEVGDIVLAEAKRYYAEIMMIFLNPVRKALERLEGLDIKIIAPSHGPVWRNP--DKILQAHRGWPKVVIIYVSMYG. 261
3 6.000e-82UniRef50_C8VZX9 Beta-lactamase domain protein n=5 Tax=Clostridia TaxID=186801 RepID=C8VZX9_DESAS  ali  18  9....VSWVGAKDPDLRIFDIVMETKYGTTYNAYLIQGQEKTALVETVKSRFYDELKQRIEEIVPLSEIDYVVVNHTEPDHSGSLGRLLLEMPKATVVASKVALRFLGQQINRDF---NQQVAVDGDKLDLGGKTLRFINAPFLHWPDSMFTYLLEDKILFSCDAFGCHYCGDSVFNDEV-GDISESYKYYFDVIVKPFRRYVLEAAEKIKDLDIQIIAPSHGPILRKDPWS-YVQMYAQWKSVLILYTSAYG. 261
4 5.000e-81UniRef50_D7CNL4 Flavodoxin/nitric oxide synthase n=1 Tax=Syntrophothermus lipocalidus (strain DSM 12680 / TGB-C1) TaxID=643648 RepID=D7CNL4_SYNLT  ali  15  6IASGVHWVGVLDPSLRVFDVVMEAPHGTTYNAYLIQGKDKVALIETVKEKFFDEYLEKLRELTDLSKIAYLVLNHTEPDHSGSVAKLVELIPGLEIVGSATALKFLQGIANQPLNAR---EVGDGDLLDIGGVSLKFISAPFLHWPDSMFTYLPEKQVLFTCDAFGAHYSDERLFVDQIEEDYLPDYKYYFDVLMKPFKSYVLEALAKIESLPISCICPGHGMILRQD-WRHYVNLYREWRRVTVLYVSAYG. 263
5 2.000e-79UniRef50_A0A1M5MQ97 Flavorubredoxin n=1 Tax=Thermosyntropha lipolytica DSM 11003 TaxID=1123382 RepID=A0A1M5MQ97_9FIRM  ali  18  6IRPDVYWVGVQDPELRTFDIIMRTENGSSYNAYLVR-GEKNALIDTVKAKFADEFIERIKAIMPIENIDYLVLQHAEPDHAGAVEKILELNPEMTVVAHPNTVEFLHEILNRDFKYKR---VGNGKELDLGGKTLHFISALLLHWPDNIYSYLKEEKILFSGDSFGSHYADERLFDDIIGDSFMHDFAYYYDKIMHPFKKQVYATMTKLEGLEIEMICPAHGPLLRKEP-QRYIELYRKWPKIVIVYASAYG. 261
6 3.000e-79UniRef50_A0A1F8YJD1 Flavoprotein n=1 Tax=Deltaproteobacteria bacterium GWC2_65_14 TaxID=1797820 RepID=A0A1F8YJD1_9DELT  ali  18  6LAENVHWVGAKDPGLTVFDIVIPTGHGTTYNAYLVRGSEKTALIDCVKRPFAGELFRNIEEHLPVKQLDYVVINHSEPDHAGGLVELLERNPKVTVYLSRSAKTFVDNMVHAGYPF---HLVNDGEELPLGGKTLRFLNAPFLHWPDTILTYLVEDRILFPCDFLGAHYASPEYFNDELPEEARQAFEFYYSTIMRPYKEHILKAIGKVRALPVDMIAPSHGPILRKDPLS-YLDWYEERKKVTIVYASAYG. 264
7 9.000e-79UniRef50_A0A0C7NY07 Beta-lactamase domain-containing protein n=51 Tax=Bacteria TaxID=2 RepID=A0A0C7NY07_9BACT  ali  17  7ITDDIYYVGVNDRDTALFENLWPLDKGVSYNSYLILDE-KTALIDTVKESKISEFFDKIRHLLNGRALDYLIINHMEPDHSGSIPELLQEFPGIKIVGNKTTFQFIKDLYKVEDNF---QEIKDGSVLNLGKHTLKFYLTPMVHWPETMMTYDEKDKILFSGDAFGGFGTDGGIFDDEVRIDFFEDEIRYFSNIIGKYTKMVQRALNKLKDIDIDIIAATHGPVWRKDP-KRIIDLYDKWKGVVIAYGSMYG. 263
8 9.000e-79UniRef50_A0A1M5BUU4 Flavorubredoxin n=2 Tax=Caldanaerobius TaxID=862261 RepID=A0A1M5BUU4_9THEO  ali  22  6IKDETTWVGVMDKDLLIFDIVFPLNKGTTYNSYLIK-GEKIALIDTVKEPFFDEFFEKIASVVEPAKIDYIIINHTEPDHSGALAKLLERVPEAIVVGSRSAIQFARGITNK---EFKSQIVKQGDTIDLGGKTLEFIMAPFLHWPDTMFTYLREDKILFTCDAFGAHYCPEDKDGNMFNDEYFDEFKYYYESIMSPFKPKILEAIDKIKGLDIDIIAPSHGPILRERPVDKYKEWFSNLKDIVVVYASAY.. 261
9 3.000e-78UniRef50_A0A1F8XEX0 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=A0A1F8XEX0_9DELT  ali  18  9...NVHCVGVKDPGLTVFDIVIPTEYGTTYNSYLVRGTEKTALIDCVKRPFAGEFLNNIEEIVPISKIDYVIVNHSEPDHAGALVDLLDRNPSVTVFLSRSAKTFVDNLVNAGFPFR---IVGDNDELSLGGKTLRFINAPFLHWPDTILTYLAEDRILFPCDFLGAHYASSHTFNDEEPEKARKAFEFYYSTIMRPYKDYVLKACERLKDVPLEMIAPSHGPVLRKDP-RKYIAWYEERKKVVIVYASAYG. 264
10 7.000e-78UniRef50_A0A2N6DQC5 FprA family A-type flavoprotein (Fragment) n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6DQC5_9DELT  ali  16  7ITENVYWVGVRHPELQIFDELFPTHNGTTYNSYLVRGAEKTALIDTVKAPFTEEFLDKIDQVCGLQQIDLVVVNHTEPDHSGALATLLERRPDLPVYCSKPAENFLKQLLNKPFDAR---VVGDGDEIDLGDKTLRFILAPYLHWPDTMFTYLVEEAVLFPCDAFGAHYCSKKLFNDEIP-DFSSDFYFYYDCIMRPFKDKVRQAVDKIDGLDLRILCPSHGPVYRHEP-QAAVNAYRRLSA........... 243
11 1.000e-77UniRef50_A0A2N2E1U4 MBL fold metallo-hydrolase n=1 Tax=Firmicutes bacterium HGW-Firmicutes-12 TaxID=2013773 RepID=A0A2N2E1U4_9FIRM  ali  19  6IKENIYWVGAIDWDIRNF-HGYATQRGTTYNAYLIIDE-KITLIDTVKHYLYDEMIARISAVIDPSKIDYIVSNHVEMDHSGGLPKLLELIPNAKVITSPNGEAGLKAHYQSEWDF---HVIKSGETINIGKRNLSFVTTPMLHWPDNMVGYLVEDKILFSNDAFGQHIASSERFDDQYPFDIQEEAAKYYANIVLPYGTQVQKALEPLQDLDIEIIAPSHGIIWRS-QIQTIINAYRKWHKAVIVYDTMWN. 258
12 2.000e-77UniRef50_A0A1E8EZZ7 Flavo-diiron protein FprA1 n=12 Tax=Clostridiaceae TaxID=31979 RepID=A0A1E8EZZ7_9CLOT  ali  19  6VKNNIYWVGALDKKLKVFDIIMTTPYGTTYNSYVVKGKNKTAVFETVKEKFFDEYVERLKSLIDISKIDYIVVNHTEPDHAGAIGKMLDLAPKAKVVGSPAAIKFIKAIANKEFETI---VVKDGDKLDLGGKTIKFINAPFLHWPDSIYSYVEEDKVLITCDSFGSHYCLDKVFNDENEEEYMEALKYYFDMIIGPFKSYVLKAVDKIKDLDIDVICPGHGPILRDNPL-KIVEIYKKWKRVVISYVSAYG. 266
13 2.000e-77UniRef50_A0A1V5XJ42 Flavo-diiron protein FprA2 n=5 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1V5XJ42_9FIRM  ali  19  6ISDGFYSVGVQNPNLRVFDIIMKTEFGTTYNAYLVRGSKKTALIETVHKRFFDEHIENIQEVCDISKIDYIILNHCEPDHSGSLAALLKLNPDITVVASVPGIKYLSAITNTTFNAV---AAKDGDKIDLGGRELVFITAPFLHWPDSMFTYSEADKALFSCDFFGAHYCEPRLVDKKYPADYEKAFENYYKAIFSPFRSFVVAGLEKVDKLNIQTICTSHGPILT-ESIEAAKEKYRRWKTALILYVSAYG. 263
14 2.000e-77UniRef50_A0A2J6N3D7 MBL fold hydrolase n=2 Tax=Fervidicoccus fontis TaxID=683846 RepID=A0A2J6N3D7_9CREN  ali  21  18LTEGIYWVGVKDWSRKIFDAFAPLERGTSYNSYLVKGSTSVALIDTVESDFQSEFFEKLESVVNIKDIKYVIMNHAEPDHSGSIPVVMEKASDAKLVTTAFGAKLAKVFYHVPDERIK--IVRDGDIIDLGGRTLKFIEAPMLHWPETMFTYLVEDGVLFSCDFFSAHLAEGIWDDDVSDIIEF--SKEYWATIMMPFRTNAISALKKISNLKIKMIAPSHGPIIRHP--EKILEKYNEWKKVLILYVSMYK. 269
15 3.000e-77UniRef50_A0A2N2D0L2 MBL fold metallo-hydrolase n=8 Tax=root TaxID=1 RepID=A0A2N2D0L2_9FIRM  ali  16  6IRNDVHWVGVQDPDLKVFDIVMTTELGTTYNAYLIKGAEKTVLIETVKERFFAEYIEDLEKVVKLQDIDYLIMNHTEPDHAGSVEKLLQKIPGLTILGSPTALKFLKEITN---SKFASREVHQDDELDLGGKTLKFISAPFLHWPDSMYTYLQEDQVIFTCDSFGSHYADPRVFNDLIEKDITPAFKNYFDDIMGPFKPYVLEAMDKIKDLPIEVICPGHGPVIRQD-IQHWIDLYREWPKIVLAYVTAYG. 264
16 4.000e-77UniRef50_K0B4N8 Anaerobic nitric oxide reductase flavorubredoxin NorV n=5 Tax=Terrabacteria group TaxID=1783272 RepID=K0B4N8_CLOA9  ali  21  4LKDNVYWVGTNDWEVRFHGDELSTHKGTTYNAYLIKD-DKNVLIDTVSEPLTEIFLERIKKVIDLGDIDYVVINHAEPDHSGALTTIMELCPNAKIVASVKGKESIQRHFHKNWD---VQTVKTGDKINIGKRDLMFIEATMLHWPDTMFTYLTEANILFSNDAFGQHYASSELFNDKVDAEVHQEALKYYANILTPFSKFVIKKIDEIKNLPLDIIAPSHGIIWRENPVEKYYEWAESEDSVVIIYNSMYG. 260
17 6.000e-77UniRef50_A0A212PLD5 Flavorubredoxin n=1 Tax=Geobacter sp. DSM 9736 TaxID=1277350 RepID=A0A212PLD5_9DELT  ali  18  11....IWWVGVGDPELRVFDDLFPTEHGTTYNAYLVKGRDRIALIDTVKGKRSDELLAKVKQLCDPSLIDYIVVNHTEPDHSGSLAKMLQHCPHATVVSTQAARTFLGNLIHTPF---NSHVIKDGEVLDLGGRRLRFIVAPFLHWPDTMFTLVEDEGVLFTCDAFGAHYCGGSIFNDQLP-DITADMKFYFDCLVRPFKDKVLAAIEKLRNERVTMICPSHGPVLRTEPL-RAVELYESWKRIAILYLSPHG. 260
18 1.000e-76UniRef50_A0A2N6BM90 Uncharacterized protein n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2N6BM90_9DELT  ali  18  6ITDNIWWVGILDPQLRVFDVVMKAEHGTTYNSYLIKGTEKTALIEANKGRFSGEFISRLSEVVDPKEIDYIILNHMEPDHSGALADLMEVAPQAQLFFTRAGKSFAENVSNKLLDD--AHVIADGETLDLGGRTLEFMVEPYLHWPDTMFTYLKEDKILFTCDFLGAHYCDDRLFDDLVGNYDY-AFKYYFTAIMRPFKSHVRRALERISGLDVKMVLTSHGPIIRTERLESYREWSLPLEKGAVLYVSAYG. 262
19 1.000e-76UniRef50_R6GRZ9 Beta-lactamase domain protein n=6 Tax=Clostridiales TaxID=186802 RepID=R6GRZ9_9CLOT  ali  17  7INPDLTWVGALDPNLRIFDIIMETKFGTTYNSYVLKGTEGVAIFETVKEKFFDEHLEKIKSVVKPEDITYIVVNHTEPDHAGSVGKLLEFAPNATVVGSSLAIRYMGQIMNKPFKNK---IVKDGETISLGNKTIKFLSVPQLHWPDTMYSYVIEDETLITCDSFGAHYSDERVIKSQLEAEKEDDYIYYFSMIMGPFKPFVLKALDKIKDLSIKFICPGHGMVLDGANIEKYMELYREWPSIVIPYVSAYG. 267
20 3.000e-76UniRef50_Q0W2L7 F420H2 oxidase n=89 Tax=root TaxID=1 RepID=Q0W2L7_METAR  ali  18  9IEKDVYWVGSRDWNRRMFDALIPLPQGTTYNAYLVVGKNSTALIDTVNPGFHSELCDKINCVGDVSKIDYLIMNHAEPDHASAIPVILDASKQAVLVTSKKGAEMAATYFKVPEER--MKIVGDGDSLELGGKTLRFIEAPWLHWPETMFTYLSEDRILFPCDFFGAHTSVGLYDDEVQDLMPL--AQRYFGEIMMPFRRMGAKAMEKIKGMDISIIAPSHGPIYRNP--QRILEEYRRWQKALIVYASMWG. 260
21 3.000e-76UniRef50_A0A0A8WNK7 Flavo-diiron protein FprA1 n=6 Tax=Geobacteraceae TaxID=213422 RepID=A0A0A8WNK7_9DELT  ali  18  7IKPGVHWIGSIDPDLRVFDDLFPTERGTTYNSYLIKGSEKVAIIDTVKEKRAEEFLEKVKSLVDPAKVDYIIINHTEPDHSGSIAFLLGHCPNATVISTQAARTFLSNLIHRDFPSR---VVKDGETVDLGDRTLRFVIAPYLHWPDTMFTLLEQDEMLFTCDAFGAHYCTNSIYNDEV-QDYSTDMHFYFDCLIRPFKDKVISAINKISGEKIGMICPSHGPIIRKDP-ARYLAFYQEWAKPVI........ 246
22 5.000e-76UniRef50_A0A1Q9PE69 Anaerobic nitric oxide reductase flavorubredoxin n=1 Tax=Candidatus Heimdallarchaeota archaeon AB_125 TaxID=1841596 RepID=A0A1Q9P  ali  19  8VVPDIYYVGVNDHLTKLFEGLWPIPEGVSYNSYIVK-GEKTALIDTVKIPFVDEFLKKVEEVTSFE-IDYIILNHIEPDHSSSLLRLLEKVPNATIMCSKKAEGMIESLYRITE---NIHVVEEGEKLDLGGRELTFYMDPLVHWPETMVTYDNKDGILFSCDAFGSYKADFGLFDDECDPDFYEETIRYFSNIVAKYVKYVKKAMEKLGGLDIKIIAPAHGLIWRDNP-QRIIDLYVKLPGVVIIWGSMYG. 261
23 5.000e-76UniRef50_A0A174BK34 Rubredoxin/flavodoxin/oxidoreductase n=54 Tax=Clostridiaceae TaxID=31979 RepID=A0A174BK34_CLOPF  ali  16  6VKKDIYWVGSLDPELRVFDIIMYTPYGTTYNSYVVKGSEKIAVFETVKEKCFDDYLSKLNSLIDPKSIDYIVVDHTEPDHAGSVEKLLELSPKAKVIGSMQAIEFLKDIVNKDFEYI---VVGDNDTISLGNKTLQFISAPFLHWPDSMYTYIPEDKALITCDSFGSHYSCEEVFNDLVPEEYLDALRYYYDCIFGPYKPYVLKAIDKIKDLDIELVCPGHGPILRQDPW-KIINTYKEWKKVTIPYVSAYG. 267
24 5.000e-76UniRef50_A0A1Q6R6F8 MBL fold metallo-hydrolase n=13 Tax=Acidaminococcaceae TaxID=909930 RepID=A0A1Q6R6F8_9FIRM  ali  20  6IAENIYDVGVQDWAVRDF-HGYKTERGATYNSYLIMDE-KITLIDTVKAPFTEELLANISKVTPLDTIDYIVINHVEPDHSGAMPALAKACPKAKFYITMQGKNEAIQHYGDIFAFE---VVKDGATLNIGKRTLTFASMAMLHWPDSMATYSEYDKILFSNDAFGQHYATSKRFDCEVNQDELFEAKKYFANILWPYAKLIGNALKKLGGLDIKMIAPSHGVIWT-EHIADILRCYSEWGSGVIAYDSMW.. 257
25 1.000e-75UniRef50_F0R577 Beta-lactamase domain protein n=28 Tax=Bacteroidia TaxID=200643 RepID=F0R577_BACSH  ali  16  3LKGKVYYVGVNDRSKALFENLWPLPYGVSYNSYLIADDEMVALVDTVDVAFFEVYLKKIKAVIGERKINYLIINHMEPDHSGSIALIKQYYPDIVLVGNKKTFDMVEGFYGVGGDR---YVVGDGDFLKLGHHQLRFYLIPMVHWPETMVTFDETEGILFSGDAFGCFGAGGCIDKDINTEIYEGEMRRYYSNIVGKFGNPVQKALQKCKGLDIRMICSTHGPVWT-EKIPQVVDMYDRLEGVVIAYGTMYG. 258
26 1.000e-75UniRef50_A0A1V2LZA1 Flavoprotein n=1 Tax=Epulopiscium sp. SCG-B11WGA-EpuloA1 TaxID=1710701 RepID=A0A1V2LZA1_9FIRM  ali  18  1MKNTFFEVGVQDYKLRIFDIVMEAEFGTSYNSYLLKGSEKTVLFDSVKYSFTDEFIKNIKKYVDPSKIDYIVVHHTEPDHSGSLYKVLEYAPNATIVGSAIAIKYLKSIINKPF---KSQIVKDGDSISVGDKTIKFLSVPMLHWPDTIYSYIVESKILLTCDSFGSHYASDKSFYSELDEKYALAAKYYFDVIIGPFKPFVIKALDKIANLDIDYICPSHGLIIDKPHIEEFKKLYKEWSTVIIPYVSAYG. 261
27 3.000e-75UniRef50_A0A0M8KE13 Flavodoxin/nitric oxide synthase n=1 Tax=Candidatus Symbiothrix dinenymphae TaxID=467085 RepID=A0A0M8KE13_9BACT  ali  20  6IAKGIYSVGVADWNVRNF-HGYLTQKGTSYNAYLIMDE-KITLIDTVKAHFSQELIDRISQIVSLDKIDYVVSNHVEMDHSGALPEVMKHLPNATVLTSQAGEREFKLHFNPDWKF---QIVKTGDSISLGKRTLSFIMTPMVHWPDNMVTYCPEEKILFSNDAFGQHLASSNVFDDEPLDVIMEEAKKYYANIIMPYSAQVVGALEAVQKLAIQMIAPSHGLIW-KNNIPAILEHYTKWKKVVIAFDSMYG. 257
28 8.000e-75UniRef50_B9YAG1 Metallo-beta-lactamase domain protein n=3 Tax=Holdemania TaxID=61170 RepID=B9YAG1_9FIRM  ali  18  7LTNDLTWVGVQDPQLKVFDIIMETEYGTTYNAYLLKGLEKTALIETVKLPFFDEFRKRIEAVLPITQIDYLIVNHTEPDHAGSIARLLEINPDLTVVGSPAALQFLKEIVNQDF---RSLIAKEGMTLDLGGKTLQLIMAPNLHWPDTMYTLAQEDGILFTCDSFGAHYAEGLRVSEVKDHEAYQSALKYYDHILKPFRPFMRKALDKVEGLDVKMICPGHGPVL-DCGLDGIIEQYRQWNKLILAYVSAYG. 263
29 1.000e-74UniRef50_A0A1V6GKY5 Nitric oxide reductase n=3 Tax=Bacteria TaxID=2 RepID=A0A1V6GKY5_9BACT  ali  17  5LADNVFWTGMIDWAVRDF-HGYKTGRGSTYNAYLVVDE-KTALIDAVKAPYVAELLQQIQSHVPLEKVDYIVCNHAEPDHSGGLPSVMRACPNATLLCNAKCKDALARHY--DTRDWKVQVVADTETLALGRRTLQFFDTPMVHWPESMVTYLVEEGILFSMDAFGQHYASGFRFDDESDLCEVMEAKTYYANIVLPYGRPVATALARLGGLTLKMVAPSHGVIWRS-HFDTILAAYQAWRKVVIAYCSMWG. 258
30 1.000e-74UniRef50_A0A2K2VBM8 MBL fold hydrolase n=1 Tax=Fervidicoccus sp. TaxID=2060324 RepID=A0A2K2VBM8_9CREN  ali  21  9IEDNVFWVGAKDYSRTIFDSLIRLQKGTSYNSYLVIGDNEAALIDTVNPGFEDIMEKRIRSVVEPEKIKYIVMNHAEPDYAGGIERALTLSKGAKLITTQLGSKFATLFYNIPQDRIK--VVKEGEKIDLGGYTLSFIEAPMLHWPETMFTFLNERGILFTCDFFGAHTAEGMWSDEVEDIMYH--AKKYWGEIMMPFRVNAKNALKKISGLDVKMIAPSHGPIYRKEILERYIDWSETKEKVLILFTSMWG. 260
31 2.000e-74UniRef50_A0A259U721 Nitric oxide reductase n=8 Tax=cellular organisms TaxID=131567 RepID=A0A259U721_9FIRM  ali  17  6LSESVYYVGAVDWNLRDF-HGYTTPRGVTYNSYLIIDE-KVCLIDTVKAPFARELLERISQIIDPGKIDYVITNHIEPDHSSGLPAVMTRAPHAKVLLTEQGRTGIIKHYQQNYDF---QVVKEGDVLDLGCNKLQFVPVPMLHWPDSMISYLTGEQILFSNDAFGQHISTTKRFDDENELPELIEAEKYYANILQPFGKMVVKAINKLNELPIKIIAPSHGVVWRK-HIPDIVAKYQDWGKVVIAYDSMWG. 258
32 2.000e-74UniRef50_A0A0J1DIL8 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium 1109 TaxID=1655638 RepID=A0A0J1DIL8_9FIRM  ali  17  3IRKGIHWVGVLDPGLEIFDIVIPTQWGTTYNSYLI-EADEPALVDTVKGNFTEEFLEKLEERIDLANLKHLIVNHTEPDHSGAVGELLRRAPHLKVHGSRAAIQFLREQVNMDFD---AHVVGENDSLDLGNRRLRFIMAPFLHWPDTMFTYLEGEGVLFTCDAFGSHYPEGKLLESEQAEDFTEAIRYYFDSIMSPFKPKVQEAVAKVGSLDIDLIATGHGPILDRDPW-RVVDLYRRWKKVIIAYASAYG. 259
33 2.000e-74UniRef50_A0A1V4VTM1 Nitric oxide reductase n=4 Tax=Bacteria TaxID=2 RepID=A0A1V4VTM1_9FIRM  ali  17  6IKPKIYWVGGVDWNLRYF-HGYLTPRGTSYNAYLIID-DKITLVDTVKEYLFDEMLDRIGKIIDPARIDYLVVNHVEMDHSGSVPKFMEAAPQAKIVTSPNGKKGLQRYYKKDWDYL---LVNSGDELKIGARTLKFVHTPMVHWPDSMVTYIPEEKLLLPNDAFGQHIAGAERFDDELGWEIYEEAAKYYANIVLLYGDNVKKALGVVAGLPIDMIAPSHGLIWRS-FIPNILKAYQRWKKAVIVYDTMWG. 258
34 3.000e-74UniRef50_A0A1V5T6B4 Nitric oxide reductase n=52 Tax=Bacteria TaxID=2 RepID=A0A1V5T6B4_9BACT  ali  19  7IRDGIYWIGVNDRTTDIFEGIWPLPRGVSYNSYII-DDDKVAVIDTVKQNSFEKFLDKINSVIGLRKIDYLIVNHMEPDHSGAIGLLLNLHPEMKIVGNKKTAEFLKSFFGI--SENVVTVADGGSL-DLGKHSLSFHLTPMVHWPETMVTYESEEKILFSADAFGGFGATGGIFDDEVDIAYFEDEIRYFSNIVGKYCAMVQKAIEKLKHINISVIAPTHGPVWRSNP-GWIVDRYDRWSRVVIAYASMYG. 262
35 4.000e-74UniRef50_A0A1V5VZ86 Nitric oxide reductase n=6 Tax=Bacteria TaxID=2 RepID=A0A1V5VZ86_9SPIR  ali  19  6LTENIYWVGVVDWRLRNF-HGYMTQRGSSYNAYLIIDE-KITLIDTVKAPFCDEMLTKISAVIDPSKIDYIISNHAEMDHSGAIPELAKRIPNVEIIASANGEKALKEHF---KENFKIKSVKAGDKLNTGKYTFTFVPEPMVHWPDSMVTYLEEERILFSNDAFGQHIATSERFDYEYSLEIMEEARKYYANIVLPYSQQVQRALKDLSGLKIDIIATSHGIIWRQ-HVSKIMAEYQKWKKALVIYDTMW.. 257
36 4.000e-74UniRef50_A0A174D9W2 H(2)O-forming NADH oxidase n=5 Tax=Firmicutes TaxID=1239 RepID=A0A174D9W2_9FIRM  ali  18  6LVENVYWLGIQDHDLEVFDVVMETKYGTSYNSYFVKGEDKVALFDTVKAPYFEDYLQKIQKHVSIDKIDYIIVHHTEPDHAGSIEKLIKLNPNITVIASAVAIRYLRNIVNIDF---KSQAVKMNDVLDLGGRTLKFISAPNLHWPDTIYSYLVEEEILFTCDSFGSHYAFDDVLMSKLPVEKNDDYMNYYNPIFAPFKTYVLKAIATLSGLNVKMICPGHGPVL-DARIEEIINIYKEWKLVVIPFTSAYG. 265
37 7.000e-74UniRef50_A0A1S8RWY3 MBL fold hydrolase n=50 Tax=Bacteria TaxID=2 RepID=A0A1S8RWY3_CLOBE  ali  20  6..DGVYWVGATDWKVRIHGNELSTHRGSTYNSYLIKDE-KTVLIDTVWEPLTEMFLENLREVTDISKIDYVVMNHGEPDHSGALPALMEYIPNATVFVSKKGLESIQKHYHKEWNFK---VVSTGEKINIGKNNLVFIEAPMLHWPDSMFTYLTGENILFSNDAFGQHYASSSIFNDEVDEEVNQEALKYYANILTPFSKLVTKKIDELKKLPVDMIAPAHGIIWRKDPVEKYYEWAKSNKSVVVAYNSMWG. 260
38 7.000e-74UniRef50_D3S055 Flavodoxin/nitric oxide synthase n=6 Tax=Euryarchaeota TaxID=28890 RepID=D3S055_FERPA  ali  16  3IADNVYWVGVVDWNVRDF-HGYSTMYGTSYNAYLIKDE-KVVLIDTVKFGFEEDLLGKIEEITD--RIDYVVVNHVEMDHAGALKAVLEKYPEAKIVTNARGKRGLKEAYGI---ERDVEVVKTGDRLKIGKQELMFIETPMVHWPDSMATYLIEQKILFPNDAFGMHYASSKLIDVELSEEDLEEAAKYYANIVLPYSQQVRKVLDELKKIELKMICPSHGIIW-KDNIEKIVKKYDEWRKIVIAYDSMWG. 256
39 8.000e-74UniRef50_A0A2M6ZZ02 MBL fold metallo-hydrolase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A2M6ZZ02_9DELT  ali  18  8.IKDNIWWVGAIDWNLRNFHGYITPRGSTYNAYLILDE-KNVLIDTVKKPFSHELLERISSVVSLDKIHYVIANHVEMDHSGSLPELKKALPNAKFVADKRAAEDLNRHFKEGWDFQIVKTSDN---LSIGKRTLTFVEVPMVHWPDSMVTFCPEEKILFSNDAFGQHIASHERFDNQLNWEIHGEAAKYYANIVFPFAGPATKALDAISKIDVEIIAPSHGIIWR-ENINKIISCYKDWAKAVIVYDTMWN. 260
40 1.000e-73UniRef50_B5E980 Rubredoxin:oxygen/nitric oxide oxidoreductase n=6 Tax=Deltaproteobacteria TaxID=28221 RepID=B5E980_GEOBB  ali  17  9..KGLHWIGVKDPSLTVFDDLFPTEYGTTYNSYLVQGDTHTAIIDTVKRKRFDEFLANIRSITDLSKIDYIVVNHSEPDHSGSLALLLELCPEATVVSSQAARTFL---GNQIHTQFGSRIVKDNDTLDLGGRTLRFIAAPFLHWPDTMFTLLEEEGVLFPCDAFGSHYTGEGIFADEMP-DFSGETRFYFDCIMRPFKERILQAVAKLDDVELKMLCPSHGPIYRSDA-RKPIELYRKWRRIAIFYISPHG. 260
41 1.000e-73UniRef50_B9M4E5 Rubredoxin:oxygen/nitric oxide oxidoreductase n=17 Tax=Bacteria TaxID=2 RepID=B9M4E5_GEODF  ali  16  7IKPDIFWIGVKDPELRTFDDLFPTEHGTTYNSYLIKGRDKIAVVDTVKGKRGEEYLEKVKQLVDPADIDYFVVNHTEPDHSGSLAFMLKHCPKAKVVSTQAAHTFLGNLIHNPFP---SQIVKNGEVIDLGGKRLRFLVVPFLHWPDTMFALLEEDEVIFTCDAFGSHYCGSSIFNDELP-DFSADMQFYFDTIMRPFKDKALTAIDKMKNEKIAVICPSHGPVLRSDPWKTV-GLYESWKKIILFYISPHG. 260
42 2.000e-73UniRef50_A0A1D3UP57 Nitric oxide reductase n=73 Tax=root TaxID=1 RepID=A0A1D3UP57_TANFO  ali  15  4IAKNIYYVGVNDRQKHLFENIWPLPGGVSYNSYLIA-GEKSALVDTVDICYSDMFFKKIAKILNGRTLDYLIVGHMEPDHAGSIRLLRQQYPDMKIVGNRQTFGMLAGYHNITEG---LHEVKDGESLDLGTHKLTFYMAPMVHWPEVMFTYEETERVLFSADAFGTFGTGGVLDTEMNTDRYWSEMMRYYSNIVGKYGGPVQKALQKLAGVDVQMICSTHGPVWRGRVIEIYLSRYEGIEGVTLVYGSMYG. 258
43 2.000e-73UniRef50_UPI000831CAEE MBL fold metallo-hydrolase n=1 Tax=Clostridium septicum TaxID=1504 RepID=UPI000831CAEE  ali  17  6IKKDIHWVGALDPNLRIFDIIMYTPYGTTYNSYVVKGSKKTAVFETVKVEFFEEYISRLKDLIDTKKIDYIVVDHTEPDHAGSVAKLLELSPNAKVVGSSVAIRFMKKIANTEFEYIT---VGDGDTLSLGNKTLQFISAPFLHWPDSMYTYIPEDEILITCDSFGSHYSSPSIINSENEEHYMDALKYYYDCIFGPYKPYVLKAIDKIKDLNIETICPGHGPVLVENPM-KIVELYKEWKLVTIPYVSAYG. 267
44 2.000e-73UniRef50_A0A0S6VUH2 Flavodoxin/nitric oxide synthase n=1 Tax=Candidatus Moduliflexus flocculans TaxID=1499966 RepID=A0A0S6VUH2_9BACT  ali  17  64....VHWVGVLDPDLITFDIIMKTDRGTTYNAYLVRGDTQMALVETVKAGFETELLDKVATLADPGRIDYVVLNHTEPDHSGAVGAVLERAPGATVVGTAKALQFLQEMLNRDFAKR---AVKQGDALDLGGLALRFMPAPFLHWPDTMFTWLEQERVLFSCDVFGAHFADEAMLEDAVTGDFWPALRHYYDAIMGPFAPHVQRGLKALDGLPVETICPSHGPILRT-GAARAIEAYRTWSAAVVCYASIYG. 315
45 3.000e-73UniRef50_A0A1G3NY62 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWF1_31_7 TaxID=1802187 RepID=A0A1G3NY62_9SPIR  ali  18  6LKENIFWVGALDPELKVFDIIMETEFGTTYNSYLVKGSNKTVLFETVKVKYFDQYIDKLKSLTNIVDIDYIVVNHTEPDHAGSIEKLLDIAVRAKIVGSEQAIDFLKQIANRPFEYI---IVKHGDTIDLGNKTLKFISAPFLHWPDSIYTYIPEDKVLFTCDSFGSHYSFDEILYSKIPSTAMKNYRYYFTAIFSPFKEYVLQAIEKIKELQIDMLCVGHGPVIDTD-VHTIIDTYKKWKTVVIPFVSAYGF 267
46 3.000e-73UniRef50_A0A132HDK6 Flavodoxin/nitric oxide synthase n=1 Tax=bacterium F083 TaxID=1768114 RepID=A0A132HDK6_9BACT  ali  17  6LTENIYYVGVNDRRTDMFENHMELPNGVSYNSYLIVD-DKVALIDPVEAGFIEEYLFKVKSALQGRKVDYLIVNHDEPDHSSSIAAVLREWPDVQVVGNAKTFAPLEAFYGAIGNKK---VVAEGETLSLGNHTLQFYMLPMVHWPESMVTYEQTSGIVFSNDAFGGFGANGGIFDDQVNLAFYEDEMRYYANIIGKVAMQVVKAIEKLSALEIKMIAPSHGLIWRSNLLGKYSQWSKQEPEVVVVYGSMHG. 260
47 3.000e-73UniRef50_A0A1F4RDD8 Uncharacterized protein n=1 Tax=candidate division KSB1 bacterium RBG_16_48_16 TaxID=1798559 RepID=A0A1F4RDD8_9BACT  ali  17  6IKNDIFWIGALHPDLRLFDIIMRTKNGTTYNSYLIRDE-KIAIIDTVKEKFAHQYISHIKELVDPGKIEYIIAQHTEPDHTGSLSSLLEIAPNAQIVCAKVAVKYVENTINREAG---IIPVENNSTLSLGTRTLRFLSTPFLHWPDTMMTYSESDEILFPCDVFASHFCDSRMFDDTIARDFRPDFRQYFEVILRPYKRHLRNALKKIEPLTIKTIAPSHGPILRKN-IADYINCYKAWAAVLIYYASAHG. 261
48 4.000e-73UniRef50_A0A0K8JJI6 Nitric oxide reductase n=13 Tax=Negativicutes TaxID=909932 RepID=A0A0K8JJI6_9FIRM  ali  19  10.....VYYVGAVDWNQRDFHGYYTPRGVTYNSYLIVDE-KICLIDTVKAPFTNELLERIRQIVDPAKIDYVVVNHVEPDHSGALPAIMEHAPNAKVILTANGRTETIKHYQREYDF---QVVKEGDILSLGKNSLHFIPLPMLHWPDSMASYLDGHQILFSNDAFGQHICTSSPFDDQNDIDILYEAAKYYANILMPYSKLVGRALSKVEGIPVKQIAPSHGVVWRS-HINKIIEKYAAWDKVVVIYDALWG. 258
49 4.000e-73UniRef50_G9RTD6 Uncharacterized protein n=4 Tax=Clostridiales TaxID=186802 RepID=G9RTD6_9FIRM  ali  17  7.KENIWYVGVQDPGLRVFDIIMHSDHGTSYNSYIVKGTEKTVLFETSKEPFFEEFLANIREVCDPASLDYIVVNHTEPDHTGSMKRLLELAPGATVLGSGTALTFLKEIVNGPFPSRAVTEKDE---IDLGGLTMKFLSVPMLHWPDSMYTYIPELKALFTCDSFGCHYADPRVFNDLIDGDFTPAYKYYFDHIIGPFKDPFMRSLDKIGSLPVEFVGNGHGPVLRS-GVQKYFDMYRTWKVVAVAYVSAYG. 262
50 6.000e-73UniRef50_A0A1G3CC75 MBL fold metallo-hydrolase n=4 Tax=Planctomycetes TaxID=203682 RepID=A0A1G3CC75_9BACT  ali  20  6IKNNIYWVGALDPEMKIFDIVFKADHGTTYNSYLIKDE-KTALIDTVKEPFTSEFISRLKSQTDLKDIDYIILNHTEPDHSGALPELIKYANNAKIMVSKAGGHLLKNIINVPVDLTIIEDSDG---VDLGSCELRFISVPYLHWPDTIWTYLGKEKILFTCDAFGSHFCDERMFDDLVGDFNH-PFHYYYDSIMRPFKPYILKAIEKIGELDIDIIATGHGPIIRKYP-RKHIESYRSWKNVLILYVSIYG. 259
51 8.000e-73UniRef50_W0JHM7 Lactamase n=5 Tax=cellular organisms TaxID=131567 RepID=W0JHM7_DESAE  ali  17  10VKDGIYWVATLDPELKIFDIIMRTAHGSTYNSYLVKGTNKKAIIDAVKEPFFEGFLENLEKLVKPEEIDYLVVNHNEPDHSGALPELLKYMPNVKLVVSKQGKVFLDNIINKSYD---CIEADDNLEIDLGDKTLKFIIAPFVHWPDTMFTYVPESKVLFTCDFLGSHFCDERM-IDTQVEDFSEDFRFYFDGIMRPFKEYVLQHIEKIEKLDIDIIAPSHGPILTQP--KHYIELYKQWKLAAVLYVSAYG. 262
52 9.000e-73UniRef50_D1VRT3 Metallo-beta-lactamase domain protein n=3 Tax=Peptoniphilus TaxID=162289 RepID=D1VRT3_9FIRM  ali  17  9IKDNIYYIGTNDRQTEKFEGMWPLPNGVAYNSFLIK-GEKNIIVDLVKINTISVYVEKIKEIIGDEKVDYIIMNHLEPDHSSSVPELIDLYPDVEIIVSPKAVPMLKNFYGVTE---NIRVVKDGEHLKLGDREFDFYLTPMVHWPESMVTYEKASKVLFSQDIFGGFGTNGGIFDDQIQFDDHEEAARYFINIVGKYAKQALKALERLKDLEISTICTVHGPIWRKDPVDFYISLAKQEKGCVVIYGSMYG. 264
53 1.000e-72UniRef50_A0A173TP82 Nitric oxide reductase n=30 Tax=Terrabacteria group TaxID=1783272 RepID=A0A173TP82_9FIRM  ali  18  7VTDDITWIGASDRRLALFENIFPIKRGVSYNSYVLLDE-QTVLFDTVDASVAGQFFENLEAALEGRTLDYLIVNHMEPDHCAMIGDIVRRYPAVKIVGNTKTFGMMNQFFGTDFSERSVVVKEGDTL-SAGKHTLHFVMAPMVHWPEAMVTYDDVDKVLFSADGFGSFGANGNVFADEVDFDWLDDARRYYTNIVGKYGASVQTLLKKAAGLEIAVICPLHGPIWR-ENLSYILEKYQKWQAVVIMYASMYG. 265
54 2.000e-72UniRef50_A0A0S2I326 Nitric oxide reductase n=91 Tax=Bacteria TaxID=2 RepID=A0A0S2I326_9BACT  ali  16  6LSDDIYYLGVNDRRTNLFENAWPLPNGVAYNSYLIVDE-KVALIDTVEYGHMEDFLLKIEEILGQTPIDYLVVNHMEPDHSGAIKQIVNKYPDIEIVGNKKTFPMLEGFFGIEEGKK---EVAEGDTLKLGKHELSFYMAPMVHWPETMVTYESTTKTLFSADAFGSFGTDGGVFDDELNLDFYDELRRYYSNIVGKYGNQTQKALAKLSTLEIKQIAATHGPVWR-CHINYIMDKYQKWSKVVIVFGSMYG. 261
55 3.000e-72UniRef50_U5MM52 Nitric oxide reductase FprA n=69 Tax=cellular organisms TaxID=131567 RepID=U5MM52_CLOSA  ali  19  6VKKGIYWVGAIDWSLRNF-HGYTTNRGVTYNAYLIIDE-KIALIDTVKAQFAGELLERISKVIDPEKIDYIISNHVEMDHSGSIPKVMEVCKNAAIITSPSGLKGLTAHYGQ----YNYKSVKANETLSLGKRTLKFVPTPMLHWPDNMVTYCPEEKILFSNDAFGQHYASSRRFDDEQLEIILEEAKNYYGNIIMPYGKQVQGACEIICSLDIEMIAPSHGVIWRKN-IQTIFDAYKLWSEAIVVFDSMW.. 257
56 3.000e-72UniRef50_B0PE05 Metallo-beta-lactamase domain protein n=4 Tax=Ruminococcaceae TaxID=541000 RepID=B0PE05_9FIRM  ali  14  18VTDSIYSVGILNPNMRVFDIVMSTDYGTTYNSYVLK-GEKNVLIEACHKTYFEQYLANIREVIDPKNIDYIVLNHNEPDHSGALAQLLDYATNATVVVSKAGSIYLKNITNRT--DLKVQVALDGDVIDIGGKTLRFINAPFLHWPDSMFTWVEEEKTLFSCDFLGAHYCEPYTFDMAYPAKYEIAFKGYYDAIFGPFKPYVLAGLEKIKNLPIERVCNSHGPIITKGRLAYVLEKYNEWSQVPVFYTSAYG. 277
57 3.000e-72UniRef50_A0A069A837 H(2)O-forming NADH oxidase n=120 Tax=Clostridia TaxID=186801 RepID=A0A069A837_CLODI  ali  15  8IKENLYWVGSLDPDLRVFDIIMYTPYGTTYNSYVLKGTEKTVLFETVKDKHFDNYIERLNDLIDFEKIDYIVVSHTEPDHAGSVEKLLDLAKNAKVVASETAIKYLKEIVNKDFEYV---AVTDGDTLSIGDKTLEFFSVPMLHWPDTIYTYIKEDKTLVTCDSFGSHYSNDKIVLDENEEKDYLDALRYYDCIMGPFKPSMVTAIEKIKDLDIDTVCPGHGPVLTENP-RKIIDLYYNWKEVTICYVSAHG. 268
58 3.000e-72UniRef50_A0A1F2WSN4 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_13_55_18 TaxID=1797197 RepID=A0A1F2WSN4_9ACTN  ali  16  8IKPGIYWIGVNDRVKDLFEGIWPLPRGISYNSYLVIDE-KVAVIDGVEEGFSQEWYENIERLIDPSKIDYVISNHMEPDHSGSLPFIRRMVPEATIVLSEKAREMLNDFYGI---RENVQTVGDGDEISLGERTLRFHEIPYVHWPETMVTYLMEEKVLFSGDAFGTYGADGGFFDDQVDVDYYIDEMRYYANIIGMYSIPVQNALSKLGGLSMDVIAPAHGPIWRQD-IGRVIGLYDRWEKGVLIYGSMYG. 262
59 4.000e-72UniRef50_D1B8C0 Beta-lactamase domain protein n=3 Tax=Synergistaceae TaxID=649777 RepID=D1B8C0_THEAS  ali  15  7IREGIYWIGANDRETDLFEALWTLPRGVSYNSYLICD-DKVAVIDTVKSSFMRDYLQRLSWVLDCKPVDYLIINHMEPDHSGSIAMMRKVYPDMKIVGNKKTLEMIKAFYDIEDGLV---EVSEGDVIDLGSHKLSFHMIPMVHWPETMVTYDQTTKVIFTCDAFGGFSAEGGVFDDEVDMDYYEDEIRYFANIVGRYSSFVQKAIAKLRTLEISVICPSHGPILRSNPW-RVVDLYDRWEEGVIVYGSMYG. 262
60 4.000e-72UniRef50_A0A0M2NNN8 Putative flavoprotein n=4 Tax=Firmicutes TaxID=1239 RepID=A0A0M2NNN8_9FIRM  ali  18  8ITDGIWWVGVQNPDLRIFDVIMRTEWGTSYNSYLIQGSEKIAVVDAVKQGFSEEQLERISAVVDPKKIDYIICNHTEPDHSGALVKLMDAAPNAVVVCSRPAKTFIKEIINRDFE---CIVAGDGVTLDLGNKTIEFISAPYLHWPDSIFTYVKEDAFLSSGDVFGVHYSAGQIFDDLTDANMIASQKYYFDVIMSPFKSYVLQAVEKIRNLKIDVIGPSHGPVLRQDPWGAV-KRYENWKKIYIGYVTCYG. 265
61 4.000e-72UniRef50_A0A2N7PQQ4 MBL fold hydrolase n=141 Tax=cellular organisms TaxID=131567 RepID=A0A2N7PQQ4_9BACT  ali  14  6IKNDVFHVGVQDWDRELFDELIPLNEGTSYNSYFVKGSQKNVLIDTVDPSKTDLFIENIKS-LGVTKIDYVISQHAEQDHSGSIPKILELYPEAKVVTNQKCKEFLKSLLLIDDSKFIT--INDGDEISIGNKTLQFIFTPWVHWPETMSTYLKEDKILFTCDFFGSHVASNELFVGQKKERVIEGAKRYYAEIMMPFRSSIKSNIKKIENLEIDFIAPSHGQVYDEPDI--IINAYKNWNKVTVLYLSMHG. 258
62 5.000e-72UniRef50_UPI00083094E2 FprA family A-type flavoprotein n=1 Tax=Clostridiales bacterium MCWD3 TaxID=1766203 RepID=UPI00083094E2  ali  18  8IKKDVKWIGVLDPSLVTFDVVMETKYGTTYNSYFI-DADKKTIVETSKETFKDEYIQKVKKVVNPDDIEYIVLDHTEPDHSSNLKHLLRIAPNATVVASKSAINFLKYMVDIDFKYK---IVKDGDTLDLGNKTLKFISAPFLHWPDSMYTYLIEDKVLFTCDSFGCHFCDERMFDDLVD-NFDEAFKYYFDVILKPFSNYMLSAIDKIKDLDIEVICPGHGPILRSKP-QKYIQMSKDLHKIFIPYVSAYG. 262
63 5.000e-72UniRef50_A0A1H4FCZ9 Flavorubredoxin n=7 Tax=Bacteroidales TaxID=171549 RepID=A0A1H4FCZ9_9BACT  ali  17  10....IHYVGVNDRTTTRFEALWSLPIGVSYNAYLVV-GEKIALIDTVEEAFGSRLEANIREAIGERKIDYLVVNHMEPDHSSSITALRRLYPDLEIVGNAKTLQMIDGFYGI--AGGTVEVKEGDTLDLGSRKVLSFHMIPMVHWPETMVTWCAGDKTLFSGDAFGTFGAGGITDSQVEADRYWDEMRRYYACIVGKYGGPVQKALQKVRTLPVETICPTHGPVWQRE-IPRVMDIYDKLPGVVVAYASMYG. 261
64 6.000e-72UniRef50_UPI00082F1FB5 FprA family A-type flavoprotein n=2 Tax=Ruminococcaceae TaxID=541000 RepID=UPI00082F1FB5  ali  15  6ITDSIYSVGILNPNMRVFDIVMTTEYGTSYNSYILKGSEKTVLIESCHKTYFKHYLDNIRQVVDPAEIDYIILNHNEPDHSGCLAQLLDFTPNATLIASQAGSIYLKNITN--RADLKLQVAKNGEVLDIGGKTLRFISAPFLHWPDSMFTWCEEEKTLFSCDFLGAHYCEPYTFDMAYPKKYQAAFRGYYDAIFGPFKPYVLAGLDKIKDLPVEYCCNSHGPVLTRDGLQAAMDLYRAWSQPVVFYTSAYG. 266
65 7.000e-72UniRef50_A0A1E7S2C9 Nitric oxide reductase n=15 Tax=Firmicutes TaxID=1239 RepID=A0A1E7S2C9_BUTME  ali  15  6IKNDIYWVGVNDHETYLFEGMWPIDDGVAYNAYIIND-DKVAVVDTVKSFKQGEYIEKIKSIIGDKKVDYLIVNHMEPDHSSSIADLLAVYPDMQIIGNKKTFPIMKNFYNIDK---NILEVADGDTLDLGHHELQFYMTPMVHWPESMVTYDATDKVLFSMDVFGSFGTDGSIFDDENDVASYEDNRRYYACIVGKVSGQAQKALQKLGPLDIQTICPSHGLIWRSNPVDFYMSRYETEEGVVIAYGTMYG. 261
66 7.000e-72UniRef50_K2A5U4 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2A5U4_9ZZZZ  ali  18  4IKDHIHWVGAIDWDLRVF-HGYSTPSGTTYNAYLIND-TRPTLIDTVKEEFFSEMLERIREVMDPAGIVSIISNHTEMDHSGSIRKMLEVCPKAEVICSPKGAEGLLRHFKKTWNLR---VVKTGDVLDTGGRPLQFVLMPMVHWPDSMATYAPNDHILFSNDAFGQHHASHERFADEINLSMYREAAKYYGNIVMPYGKQVQAVLKSVATLPIDQIFPSHGLMWRREDIQKIVALYDGWKKVVIVFDSMW.. 257
67 8.000e-72UniRef50_A0A1V1RHY3 Uncharacterized flavoproteins n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1V1RHY3_9ACTN  ali  18  6IAEGIHWVGAIDWNLRDF-HGYETPFGSTYNAYLVRGSEKTALIDTVKAPFVPELLARVSSVMDPADVDLIVVNHVEPDHNGGLRDVMAAMPDARVVASPSGVKGVAEYH----DGLAVDAVTADDVIDLGGRTLRFLPMPMVHWPDSMFTYCAESKTLMPNDAFGQHYACEERFADELGLDTALEQLIYYANILLPLGTQVAKAVDKVLQWEIDVIAPSHGVAWRGADIAVAIERYRRWDKAVVVYGTMWG. 261
68 1.000e-71UniRef50_A0A1F8U6I8 Uncharacterized protein n=1 Tax=Clostridiales bacterium GWB2_37_7 TaxID=1797677 RepID=A0A1F8U6I8_9FIRM  ali  15  6LKENVFWVGAKDPDLRVFDIIMNTEYGTTYNSYLIK-GQKNILIETVKVRFASEYLEKLESLLQGEKLDYLITNHTEPDHSGSVRNIITKYPDIQVIGTRAAYIYLKAMLNEDLNFK---VVSDGEELKLGNKTFKFILAPFLHWPDTLFSYCIEDDILFSGDFLGCHYCMENGKILSTDADDFLDAFKYYFEIMSPFKEHALKALDKIKDLDIQMVCTSHGPVLVKD-IDMYKDLYRQWKVVFIGYVSAYG. 263
69 2.000e-71UniRef50_A0A1V6A956 Nitric oxide reductase n=1 Tax=Firmicutes bacterium ADurb.Bin153 TaxID=1852883 RepID=A0A1V6A956_9FIRM  ali  14  7ISDRVDYVGSQDWDRTIFDSLIPLPDGTSYNSYIVKGSSKTALIDTVDPKFLQELEGKLEEAG---NVDYVVVNHVEQDHSGCLNMVLDRYPKATALCSEKAKDLIITHLHTAPERIIT--VKDGEELSLGDRTLRFVYAPFVHWPETMLTYLVEDRILFSCDMFGSHLASSDVFTVKPPHEYVESCKRYYAEIMMPFAIPIKKNLEKVEALSPAMICPSHGPCWTEPA--FVMDLYRRWNKALLLYVSMHG. 257
70 2.000e-71UniRef50_A0A140LBG0 Nitric oxide reductase n=25 Tax=cellular organisms TaxID=131567 RepID=A0A140LBG0_9CLOT  ali  21  6IKKGVYWVGAIDWDIRFHGPSYHTHKGTTYNAYLIIDE-KVALVDIVDAHFAEEMLENIRQVIDPSKIDYVVVNHVEPDHSGGFPKLMEYIPNAKVFCSKNGKDAMMHHY---FGDYQYEVVKTGDIIRLGEKTIQFIEAPMLHWPDSMFSYIAEEALLLPNDAFGQHLASSKLFDDENDLCEMEEAKKYFANILMPFGPLVVKKIEEIMKLKIDMIAPSHGIIWRSNP-EKIIEKYMQWRKAVVVYDTMW.. 261
71 2.000e-71UniRef50_Q5P8G0 Fusion protein of nitric oxide reductase (Flavorubredoxin NorV) with its associated reductase (NorW) n=4 Tax=Rhodocyclales TaxID=2063  ali  18  5VKSNITWVGKQDWELRFHGAEYSTHKGSSYNSYLVR-EEKVALIDTVWSPYAQEFIDNLEKEIDLHKIDYIIANHAEIDHSGALPALLARIPDTPIYCTENGVKSLKGHFH--KDWNFKVVKTGDTLDLGNGKQFVFVEAPMLHWPDSMMTYLAGDAVLFSNDAFGQHYASEQMFNDLVDQEELRECLKYYANILTPFSARVAAKIHEVLKLPLEMICTAHGVIWRDNPVEQYLAWADQENQITLIYDTMWN. 262
72 2.000e-71UniRef50_A0A1V4MK82 MBL fold metallo-hydrolase n=6 Tax=Bacteria TaxID=2 RepID=A0A1V4MK82_9FIRM  ali  18  5INDSVTWVGKIDWELRFHGEELSTHRGSSYNSYLVRGNNKTALIDTVWKPFAGEFVENLKKEIDLKKIDYIIANHAESDHSGALPDLLREIPDTPVYCTRGGVKSLSGHYHEDWNFK---PVKTGDKLDLGDKELIFIEAKLLHWPDSMFSYLTEDAILFPNDAFGQHYASELMYNDLVDQELYGEAIKYYANILTPFSKLVAAKIKEVLELNVNMICPSHGVIWRQDPLQKYAEWADRENQVTIIYDTMW.. 261
73 2.000e-71UniRef50_A0A1X0XXP3 Uncharacterized protein n=10 Tax=Desulfuromonadales TaxID=69541 RepID=A0A1X0XXP3_9DELT  ali  16  13......WVGVRHADLKVFDDLFPTHNGTTYNAYLVRGNDKVALIDTVKEPFADEFFSKVGEHVRPEDVDLVVVNHTEPDHSGALAQLLDKNPEIVVYCTKAAENFLKQLINRPF---KCHVVSDGEELDLGGRTLRFLLAPYLHWPDTMFTYLVEEKTLFSCDAFGSHYCPRRLFDDEIADFSYDFFFYF-DCIMRPFKDKIRDAVAKVDDLDIDIVAPSHGPI-RRQSGRNAINAYKRWAA........... 243
74 2.000e-71UniRef50_A0A1V5MK09 Nitric oxide reductase n=1 Tax=candidate division TA06 bacterium ADurb.Bin417 TaxID=1852828 RepID=A0A1V5MK09_9BACT  ali  19  6IGKDIYWVGAVDWNLRDF-HGYRTGRGSSYNAYLILDEKK-CLVDTVKSPFTGRLLENISALVKPGEIDYIISNHLELDHSGAILEILRHCPKARLLATGHW---IEGAEKYFGPGLPVQPVKTGDTLSLGRRTLQFIEAPMLHWPDSLFTYLPEDGILLPNDAFGQHYAAGSRFDDEVPEAVLMEAARYYANIIMPYSNLVAKMLGRIMKLDIRLIGPSHGLIWRRP--EKILAAYRDWEKAVVAYDTMWG. 259
75 3.000e-71UniRef50_A0A2N2A0W9 Flavodoxin n=5 Tax=Firmicutes TaxID=1239 RepID=A0A2N2A0W9_9FIRM  ali  19  7VNEDITWVGGNDRRLAMFEGVYSIPDGVSYNSYLILDE-KTILFDTVDKALGKIFFENVAHTLNGRKLDYVVVQHMEPDHSATLMDLLCRYTDTKIVCTKKTSEMICQFFDEDVMDRAIIVKENDTL-STGKHEFQFVMAPMVHWPEVMFTYDRTDKVLFSADAFGTFNANGALFADELDFYNTFEARRYYANIIGKYGPQVQSALKKVANLDVRIICPLHGPVHRKDYMEKYLRWYEPEETGVMLYASIYG. 265
76 3.000e-71UniRef50_A0A0B5QGQ9 Flavo-diiron protein FprA1 n=113 Tax=Firmicutes TaxID=1239 RepID=A0A0B5QGQ9_CLOBE  ali  19  6LKKNLYWTGVLDANLRVFDIIMETEFGTSYNSYLLKTSEKTVLFETAKAKFLDGYLKALNKLVDIKDIDYIVVNHTEPDHAGSIEKLIEMNPNIKIIGSQVAIGFLKNIVN---REFNGIIVKENETLSLGDKTLRFMSVPNLHWPDTMYTYIEEDKTLVTCDSFGSHYSEGILLSKVTDNEGYLRALKYFDCIIGPFKPFMIKALDRIKDLEIDMICTGHGPVL-DCRIDEIMEYYKKWKTVIIPYVSAYG. 265
77 3.000e-71UniRef50_A0A174P4X1 Flavodoxin n=56 Tax=Clostridia TaxID=186801 RepID=A0A174P4X1_9FIRM  ali  17  7LTEQVWWVGGSDRRLALFENLFPITRGVSYNSYLILDE-QTAVVDTVDSSISRQFLENVLHTLDGRPLDYLVINHMEPDHCASIETLLLRFPTLKLVGNAKTFAFMGQFYDFPLDGRTVTVKEGDTL-SLGGHTLHFHMTPMVHWPEVMMTYESSEKLLFSADAFGSFGTGGNLFNDELNFDWLDDARRYYGNIVGKYGLQVQAALKKLSGLDIAMICPLHGPIWRSN-LDYLLDKYDKWRAVAVLYASMYG. 265
78 3.000e-71UniRef50_A0A1U9NPQ6 Nitric oxide reductase n=148 Tax=root TaxID=1 RepID=A0A1U9NPQ6_9BACT  ali  16  4IADNIYSVGAIDWDRRLFDELIPLPDGTSYNSYLIKGQEKTVLIDTVDPEKTEILIDNLVSA-GVTKIDYIVAHHGEQDHSGSINDVLLLYPDAKVVANEKCKKMLIDLLCLDESNFLT--IKEGDTLSLGDRTLEFIDTPWVHWPETFSTYLQEDKILFPCDFFGSHLATSDIFV-ENESAIYGPAKRYYAEIMSPFRRQIRGNLKKLEKFNIEMIAPSHGPVYKNP--KFIIDAYAKWASVMLPYVSMH.. 254
79 3.000e-71UniRef50_A0A1G3BF65 MBL fold metallo-hydrolase n=1 Tax=Planctomycetes bacterium RIFCSPHIGHO2_12_FULL_52_36 TaxID=1801980 RepID=A0A1G3BF65_9BACT  ali  16  5VTDSVYWVGAIDWDLRLYHNTYSTHHGTTYNSYLLLDE-QIALVDTVYGPFYEELLKNIKELVPVEKITYVIVNHAESDHSGALPRVMGIIPRARVVCTSKCKDILSRLYHSGPATWDFLIVGSGDELKIGKKTLRFIEAPMMHWPDNMFTYVMEDKLLLSNDPFGQHVASSERFEDEVEQAVVWEEVKYFANTLSPFTALIKRKVEEIQSLPIEIIAPSHGVIWRKEP-QRILEKYQRWERVLIAYETMW.. 264
80 3.000e-71UniRef50_Q1Q106 Similar to flavoproteins norVW and fprA n=16 Tax=Planctomycetes TaxID=203682 RepID=Q1Q106_KUEST  ali  18  6LTNSVYWTGVLHATLRTFDVVFETRFGSTYNSYLIM-ADKPTIIDGVHEKFTPEYLNKLQSLIPLKDICYIVVNHTEMDHTGSLGQLLKLAKNAQVLSTKTASMFLKNILN---SEFNGKTVEDGECISLGNRQLQFIHAPFWHWPDTMFTYLHDDAILFPCDGFATHFCDERLFDDRVD-EFFEDFRYYFEHIMGPFRKKILEALDKTNQLDIKMIAPSHGPILRTDP-QKYIKAYKEWKLIVILYVSVYG. 260
81 4.000e-71UniRef50_A0A1C5W2X0 H(2)O-forming NADH oxidase n=136 Tax=Bacteria TaxID=2 RepID=A0A1C5W2X0_9FIRM  ali  16  8..DDFYWAGIVDDTLRVFDIIMYTEFGTTYNSYVLKSGGKTVLFETVKEAFFEEWMDKLGEVIDVTKIDYLVVNHTEPDHAGSVQRLLKLSPQLKIISTACAAGFLKEIVN---SEFCNLIVHDNETMKIGDKTLRFLLVPNLHWPDTMYTFIEEEQVLVTCDSFGSHYGQDVLVSKVTDREGYMRAKYYFDCIIGPFKPFMLKALERVRELDVSMICPGHGPVL-DSGIDFIEETYERWKTVVIPYVSAYG. 264
82 4.000e-71UniRef50_A0A1B0VHZ3 MBL fold metallo-hydrolase n=72 Tax=Bacteria TaxID=2 RepID=A0A1B0VHZ3_FERIS  ali  67  7.IENITLYDDGQHKFIFLAWEEQEEEGVQTNQYLIIDGNEAMLLDPGGAHVFPRVLANVSEIIDPSKIKYIFFTHQDPDVTSGITLWLSIAENAKIYISALWTRFLPHFGVYDQRRVVALPDKGDKLRLSSGTELEFIPTHYLHSTGNFTLYDPRAKILFSGDLGVAVFPKGQRYVFVENFNEHVKLMEGFHKRYITSSVALKKWLSIVERKDIDIVAPQHGAIFKGENVKKLFDWFKNLKCGIDIIDEIYG. 258
83 4.000e-71UniRef50_A0A174D5M0 Nitric oxide reductase n=6 Tax=Bacteroidales TaxID=171549 RepID=A0A174D5M0_9BACT  ali  17  10....IHYVGVNDRTTTRFEGLWSLPQGVSYNAYLVADE-KVALIDTVEEGFGSRLTENIREAIGDRKIDYLVINHMEPDHSSSVRALRMLYPDIQIVGNAKTLQMLQGFYGIDTG---TLEVKEGDSISLGSKTLSFYMAPMVHWPETMVTWCAEAGTLFSGDAFGTFGAGGITDSQIDPSRYWDEMRRYYACIVGKYGGPVQKALAKVRGLNPTTICSTHGPVWQREDVYDRLSRYEGEPGVVIAYGSMYG. 260
84 5.000e-71UniRef50_A0A1C6HQ07 Nitric oxide reductase n=134 Tax=Bacteria TaxID=2 RepID=A0A1C6HQ07_9CLOT  ali  19  7VKDDLIYVGGSDRRLSRFENLFPIPKGVSYNSYVLLDE-KTVLFDTADESISRQYIENVVHALNGRPLDYMVVQHMEPDHCAMIDDMLRRYPEAKMVCSAKAVGMFAQFYGTDVAARALIVKEGDKL-STGEHTLHFVMAPMVHWPEVMVTYDEKDKILFSADAFGTFGAAGNIFDDEIDATWMNDARRYYTNIVGKYGVQVQTLLKKAASLDIEMICPLHGPIWHKD-LGLLLEKYQKWKTVMIAYATMYG. 265
85 5.000e-71UniRef50_UPI000A036213 MBL fold metallo-hydrolase n=1 Tax=Sedimentibacter sp. B4 TaxID=304766 RepID=UPI000A036213  ali  15  29LKDNIYWVGSLDPELEVFDIIMRTEFGTSYNSYVVKGSEKIALIETVKLKCFDDYLERLKELISAQDVDYIIVNHTEPDHSGSIENLVKMNPGIQVVGSKQAIEFMNHICNT---QFKSIAVKDGDELSLGDKTFKFIDAKFLHWPDSMFSYLKEDKTLFTCDAFGAHYSLDTVLTVVNKDDYMGAFKYYFDNILAPFKSFYLQAIERIENLDIDMVCTGHGPVLDEDPW-KIINLSKQYSTIVIPYVSAYG. 288
86 5.000e-71UniRef50_X0YHV1 Uncharacterized protein (Fragment) n=13 Tax=root TaxID=1 RepID=X0YHV1_9ZZZZ  ali  15  6IKPGIYWVGAIDWDRRLFDSLIPLPDGTSYNSYLIKGSEKTALIDTVDPTMQDVLINNLSE-LGVKSIDYVVANHAEQDHSGAIPQVLEKYPEVKVVVTPKCKSMLIDLLMIPEERFIT--VNDKETISLGDRTLEFIHAPWVHWPETMLTYLREDKILFPCDFFGSHLATTDLYVRDG-GQVYEAAKRYYAEIMMPFRTSIQKNLEKVKDCAIDIIAPSHGPMHDRPELNAYHSWAFDEPKNIVVYISMHG. 257
87 6.000e-71UniRef50_D1Z2S1 F420H2 oxidase n=2 Tax=Methanocella TaxID=570266 RepID=D1Z2S1_METPS  ali  17  7...NGIYWVGAIDWNMRDFHGYDTPKGTSYNAYLIVDE-KVALVDTVKGGFSEEMFMGIREHVDPSKIDYVIVNHLEKDHSGALEDVMAVAKNAKVYCSTRARAGLVDKYG---ERWPMTAVKTGDTLKLGKKTLRFIEVPMVHWPDSMFTYAEEDKVLLSNDAFGQHIATSQRFEDQVRANIMYDARAYYANILMPLSSIIAGTLEKLLNLSPDIIAPSHGLIWRRDP-GRIVNAYTAWEEAVIAYSTMWGL 259
88 6.000e-71UniRef50_A0A101ID69 Beta-lactamase domain protein n=2 Tax=Candidatus Marinimicrobia TaxID=62680 RepID=A0A101ID69_9BACT  ali  13  7LSQNIFWIGVNDRRTHLFENLWPLDKGISYNAYLIRD-RKNALIDTVEIGHVESYFDAIDKILGGKNVDYLVINHMEPDHSGALKLITQRYPDITLVGNRNTFKFVRGFFG---DFERILEVEEGDTLDLGAHSLTFVMTPMLHWPETMMTFETKTQILFTGDVFGSFGTDGVLFDDEANLDEWEEQRRYYSNIVGKYVKQTQKALEKLKTVDVRMFAPTHGLIWRQHP-EHIANLYDRWRGVVIVYGSMYG. 262
89 8.000e-71UniRef50_A0A0P0M1N2 Alkyldihydroxyacetonephosphate synthase n=437 Tax=root TaxID=1 RepID=A0A0P0M1N2_BACVU  ali  16  3IKGKVHYVGVNDRNKALFENLWPLPYGVSYNSYLI-DDEMVALVDTVDVCYFEVYLKKIRSIIGDKPINYLIINHMEPDHSGSISLIKQYYPNIVIVGNKKTFEMIEGYYGVGGER---YVVGEGDFLALGHHRLRFSLIPMVHWPETMVTFDETEGILFSGDAFGCFGAGGVVDTNINTDIYWNEMVRYYSNIVGKYGAPVQKALQKLQNLKITTVCSTHGPVWTEERIYDRLSRYEAEEGVVIAYGSMYG. 257
90 9.000e-71UniRef50_A0A0U1CPB2 Nitric oxide reductase n=12 Tax=Bacteria TaxID=2 RepID=A0A0U1CPB2_CHLTH  ali  19  7INDSTYYFGQNDRTQRFFEHLYPLPHGMAYNNYLIKDE-KNVLLDTVDVGLSERFFSQLDSALDGEPLHYLIVQHMEPDHSGSIGLLLRRHPEVTVVSNKKTKSMLEGYGVCPDKF---MEVDEKTPLNIGSRELQFVFAPMVHWPEVMFTYDAKEKTLFSADAFGAYGAIDGGFWDEDLAAYLPEAHRYYTNIVGKYGSFVQRAIDKALKLDIKIIAPVHGVVWRK-HIPEVLELYRKMPGVVIVYGSMYG. 261
91 1.000e-70UniRef50_A0A1V5SEI8 Nitric oxide reductase n=8 Tax=Bacteria TaxID=2 RepID=A0A1V5SEI8_9BACT  ali  18  6IADDVWWVGAIDWNARFHGHTYTTKRGTTYNAYLIVDE-KITLVDAVYGPFTDEMIQRIRTVIPVEKIDTIIANHIEPDHSGAYPELLKLCPNAKLYGSARAGQGLERYYHQKFDF---TPVKTGDKLSLGKKTLRFIEIPMIHWPDSMMTYLEEDQILFSNDAFGQHYATNERFDDEVPWEILMEAAKYYANILWPFSHLIAKKLVELAELPIRMIATSHGVSWRKEP-RKIITAYERWPKIVIVYETMWG. 262
92 1.000e-70UniRef50_A0A1V5LZ69 Nitric oxide reductase n=3 Tax=Bacteria TaxID=2 RepID=A0A1V5LZ69_9BACT  ali  19  9....VYWVGVTDWNLRFHGHEYSTHSGTTYNAYLIVD-DRTVLVDTVWEPFAEDLLANIREIVDPAQIDFVIANHGEIDHAGGLPLVMREAANAEIVVSKRGAHSIEGYYHQPWRFRTVCT---GDRMQIGAHELVFIEAPMLHWPDSMFTYLTGHHLLFSNDAFGQHYASAGHFNDDVDQELYGEALKYYANILTPFSDLVLKKIDEILNLPVEMIAPAHGVIWRADPLQQYQTWARQMPEAVVVYDTMW.. 260
93 1.000e-70UniRef50_A0A1Y3Y2R1 Pyridine nucleotide-disulfide oxidoreductase n=2 Tax=Blautia TaxID=572511 RepID=A0A1Y3Y2R1_9FIRM  ali  18  8..DNFYWTGIVDDKLRVFDIIMYTEFGTTYNSYVMKAGDKTILFETAKAKFFEEYLEELKQITDVEKIDYLVVNHTEPDHAGSVEKLLEINPGLKIIATGCAVNFLKEIVN---GEFTALPVKDGQEMKIGDKTLKFMVVPNLHWPDTMYTYIEEEQILVTCDSFGSHYGKDILLSKVTDQEGYMRAKYYFDNIIGPFKPYMQKALERVRELDISMICTGHGPVLDTR-IDFILDTYQEWKTVIIPYVSAYG. 264
94 1.000e-70UniRef50_A0A1Y4DPT0 MBL fold metallo-hydrolase n=18 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Y4DPT0_9ACTN  ali  22  7.ISPDIWWVGGIDWNERSFHGYTTEKGITYNAYLIMDE-KITLIDTAKATFTDEFLQRISQVVDPSKIDVVITNHVEMDHSGSLPAIHKIAPNATIYASAAGVNEVRAHFGIEA-----TPVKSGETLSIGKRTLTFVTTPMVHWPDNMVTYSDVDKILFSNDAFGQHFASTKRFDDENDLCEYKQAKKYYANIVWPYGMQAKKALDVVKTLDLNMICPSHGVIWRS-HIADILDKYEAWDKAVVVFDSMW.. 257
95 2.000e-70UniRef50_A0A150FRB2 Beta-lactamase domain protein n=5 Tax=Clostridiales TaxID=186802 RepID=A0A150FRB2_CLOPD  ali  19  6IKNNIFWTGVIDADLKVFDIIMETEHGTTYNSYFINDEKK-VLIDTVKANFKDEFIEKLSTLTDIKDIDYVIINHTEPDHSGSLKYILEINPNIEVFCTQAASIFLKEQVNK---EFKCNIIKDGQILNIGSRNLKFITAPFLHWSDSMFVYSESDKVLFTCDGFGSHYSKVD-PQSVNDPEYPEALKFYYDCIVRPFAQHVLNAIDKVKDLDIDIILTSHGPILSEDPVKKYLEWSSEERQVALIYLSAY.. 260
96 2.000e-70UniRef50_A0A2N1QFN5 FprA family A-type flavoprotein n=1 Tax=Tenericutes bacterium HGW-Tenericutes-1 TaxID=2013844 RepID=A0A2N1QFN5_9BACT  ali  16  8IEKNVFWIGVNDYDLRVFDIVMETKFGTTYNAYLVKGSEKTALIDTTKINFKDDYITKLSSLVDIKKIDYLIMNHTEPDHAGSIASILDINPDLTVIATTPGINNIKEIINRPFKSIT---AKEGLEISLGNRTLTFYPLPFLHWPDTMFTYMKEEEMLFTCDFFGAHYAEGVLAKNVKEIGDYRYSIKYFDSIMSPFKKFVNKALDRIETLKIKYVLTGHGPVVDSMNLEEYREWAKDEPLVIIPYASAYG. 267
97 2.000e-70UniRef50_A0A1W6HQ29 MBL fold metallo-hydrolase n=1 Tax=Prosthecochloris sp. HL-130-GSB TaxID=1974213 RepID=A0A1W6HQ29_9CHLB  ali  15  9ITDDVTWIGVLDPGLVTFDIVMETKYGTTYNSYFINAEKKAV-VETTKAPFWDTYLDKIKQVTDPAEIQYIIVDHTEPDHSGNIGRLLEVAPDATVVGSANAIKFLKDLVGKEFSYIT---VKDGDTLDLGNKTLRFVNALNLHWPDSIYTYLEEDKVLFTCDSFGCHYCNEAMYDDLS-GDFDDAFTYYFDAILRPFSKYMLDAIERIKDLEIDVMCPGHGPILRSD-WRKYVDLSKKEKNILVAYVSAY.. 263
98 3.000e-70UniRef50_R8VWX9 Uncharacterized protein n=2 Tax=Butyricicoccus pullicaecorum TaxID=501571 RepID=R8VWX9_9CLOT  ali  19  6IRDNIYAVGARDPEVRIF-HGYATPFGATYNCYLILDGDKKILVDNVKAAFTEEFFRNIEEICPVESLDILIQNHIEPDHSGSFPALLERCPNLEVYCTAGAQKGLKAYYG---WEGACHVVKMGETLNTGSYTFHFIPAPMVHWPDSMLTYLAEEKILFSNDAFGQHICPPVNYDDELGEERLMEAVDYYGNIVLPFGMQVTNLLKAASALDIELVCPSHGVMLRGKMVESYAKWAKNENKVVMVYDSMWG. 260
99 4.000e-70UniRef50_A0A2N6D341 FprA family A-type flavoprotein n=4 Tax=Deferribacteraceae TaxID=191394 RepID=A0A2N6D341_9BACT  ali  17  6IKNDVYWVGVKDPQLEIFDIVIPTEHGTTYNSYLVKGTEKCALIEANKFTFKDEYIQRVEQVMPIKDIDYIVLNHNEPDHSGALPALLDINPDMEVIYSKTAKTFVENIVNREFNGR---AVGDDDVIDLGGKTLRFFHTPFLHWPDTMFTYLVEEKILFPCDFLGAHYCPKGDVLMNSDVENKEEAREYYSMIMRTYKEHINKAMEKIKDIEIDMVCPSHGPILTED-IKSYMNYYKNMKQVTLVYATAYG. 267
100 4.000e-70UniRef50_A0A1E3X5M3 Putative flavoprotein n=4 Tax=root TaxID=1 RepID=A0A1E3X5M3_9BACT  ali  20  8.............RLITFDIVVPTKYGTTYNSYLVR-GEKIAIIDTVKAYCVDEFISKIRSLVKLEDINYIVINHTEPDHSGGLISLMELAPNAVPVFSRGARTFVKNILHKDFDYK---EVKDGDSIDLGGKVLKFISAPFLHWPDTMFTYLENDKILFPCDAFGSHYCSDKRFNDELDEDAFGEFEFYYNCILRPFKKHIIDALDNIKDIDIEIIAPSHGPILR-ENIEKYIESYKEWSKVTVVYVSSYG. 253
101 4.000e-70UniRef50_C0EJ89 Metallo-beta-lactamase domain protein n=2 Tax=Ruminococcaceae TaxID=541000 RepID=C0EJ89_9FIRM  ali  18  5ITDGIYYVGVLNPNMRVFDIVMRTEFGTSYNAYLVKGTEKTALVETCHLTFFENYIENIKEVVDIDKIDYLVMNHNEPDHSGAIAKLLELNPNITIVVSQAGSIYLKNITNS--KDLKIQVAKDGDKLDLGGKTFQFLNAPFLHWPDSMFTWVPEDKTLFSCDFLGAHYCEPQMLDSITYLDNYLESLKYYDAIFSPFNPYVVKGLDKIKDLDIEFACTSHGPILTKGQLENAIARYREWSAPVVYYCSAYG. 265
102 4.000e-70UniRef50_A0A151AN54 Flavo-diiron protein FprA1 n=245 Tax=root TaxID=1 RepID=A0A151AN54_9CLOT  ali  19  7VTDDLYWVGGNDRRLALFENIHPIERGVSYNSYLLLD-KKTVLFDTVDWSICRQFIENIEGVLGDRSLDYIVINHMEPDHAASIEEVIIRYPDAKIICTEKAAMFMHQFGFQVSDRII--EVKEGDTMSFGKHKVVFITAPMVHWPEAMVTYDTTNGVLFSADAFGSFIADGRLFNDEVNFDWIDEARRYYTNIVGKYGPHVQALLKKASTIDIKMICPLHGPVWRNN-FEYFLDKYNKWKGVLIVYGTMYG. 264
103 5.000e-70UniRef50_E3PWG7 Beta-lactamase domain protein n=41 Tax=Firmicutes TaxID=1239 RepID=E3PWG7_ACESD  ali  16  8IHEDVHYIGVNDRETHLFENMWPLDNGISYNSYLL-TGEKNVLLDTVKITKVDSFLVKIQNILKDKPLDYLVIHHMEPDHSGSIKSVIDMYPDVKLVGNKKTQDFLEAFYGVTGNFI---EVKEGDTLDLGDKKLTFYMTPMVHWPESMVSYESKHKILFSQDAFGGFGADGPIFDDEINWDFYEETRRYYSNIVGKHSKQVQVAIKKLAGLDISMICPVHGPVWRSKP-EKIVSLYDKWSKVVIVYGTMYG. 262
104 6.000e-70UniRef50_A0A1G4FLL2 H(2)O-forming NADH oxidase n=72 Tax=root TaxID=1 RepID=A0A1G4FLL2_9FIRM  ali  20  11....IFWVGGSDRRLERFENMFPLPNGISYNSYLILD-KKTALLDTADSSISSLYLENVEHVLNGRTLDYLVINHMEPDHCANIQDIVFRYPKVKIVGNSKTFQFIEQLFNFDKKNDYYEVKEQDEI-CLGEHTLKFYFAPMVHWPEVMFTYETKKKILFSADAFGTFGANGNIFSDEIDFKYLSEARRYYTNIVGKYGPQVQNILKKLSDTDINMICSLHGPIWRKN-LNYILDKYNKWKQGVILYASMYG. 265
105 6.000e-70UniRef50_D4MRZ7 Uncharacterized flavoproteins n=5 Tax=Firmicutes TaxID=1239 RepID=D4MRZ7_9FIRM  ali  17  6..EGFYWTGVIDENLRVFDIIMYTEFGTTYNSYVLKAGDKTILFETAKAKFFDEYLEKLKEIIDVGNIDYLVVSHTEPDHAGSVERLLDLSPKMKILATGCAIGFLKEIVNRDF---VSIPVKDHQRMGIGNKTLQFLIVPNLHWPDTMYTFIEEEQILVTCDSFGSHYAHSGVLASTVPEDYMKAARYYYDCIIGPFKPFMLKALNRIKNMDISMICTGHGPVLTKESIKNIMAKYEEWKTVIIPYVSAYG. 264
106 6.000e-70UniRef50_C9M635 Metallo-beta-lactamase domain protein n=2 Tax=Jonquetella anthropi TaxID=428712 RepID=C9M635_9BACT  ali  13  6ITDRIWWVGVNDRTTARFENLWPLKRGVCYNSYLI-DDEKVALIDGARAGFLDDYLGHIESALGDRQVDYLIVNHMEPDHSSAISMLRRRFPRMTVVGNKQTLQLMRQFYGPIDGTLQ---VGEGDRLELGSHVLKFILAPMVHWPETMFSWEETTGTLFPCDAFGSYGADGSVFDDENDLDNLEETRRYYATIVGRFGPFVQKALAKCKDLPIQRICPSHGPIYRS-HVSRIVSLYDRLPGAVLAYGSMYG. 261
107 6.000e-70UniRef50_A0A1W9S0W8 MBL fold hydrolase n=12 Tax=Bacteria TaxID=2 RepID=A0A1W9S0W8_9BACT  ali  15  6IKPDIYSVGVVDWDRRLFDELIPLPDGTSYNSYLIRGSEKTALIDAVDPTKEDELIANL-STLNIDHLDYLVANHAEQDHSGGIPRILDVYPEAKVITNKKCRDFLIDLLLISEGRFIT--IEDGDNISLGNKTLEFIIAPWVHWPETMLTYLKEDNILFSCDLFGSHLATSQLYA-ICDEKLLESAKRYYAEIMMPFRNNIKNHLERLENYNIGMIAPSHGPIYKKP--EFIMDAYKEWNEVVLPYVSMHG. 257
108 6.000e-70UniRef50_A0A0E9LRH6 Flavoprotein n=2 Tax=Bacteria TaxID=2 RepID=A0A0E9LRH6_9BACT  ali  17  7LTDKIFYVGVNDRRTHLFENLWPLERGVAYNSYVIND-HKVALIDTVEIGHVDQFLKKVRAVIGDKPIDYLVINHMEPDHAGSVQILTELYPDMQLVGNKKTIPMVEGFFGINDKDKFIEV-GEADVLMLGENTLQFHMIPMVHWPETMVSYVQEQKLLFSGDAFGSFGTDGGVFDDEVEFDYFKDEMRYYSNIVGKYGNPVQKALDKLSGLEIEMIAATHGPIIRT-HIAEMLEMYDAWSKVVIAYASMYG. 263
109 7.000e-70UniRef50_A0A1G1NRG4 Uncharacterized protein n=4 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1NRG4_9BACT  ali  19  7IKENLYWVGAIDWNIRTFGYTYSTHSGTTYNSYLLID-DKVALIDGVHMNFFEEWRSRLSRVIDPKRIDYFICNHVEPDHSGAIPQMMKLMPQAKIITNQRAKDALLKHYFTSWNFE---LVKTGDILKLGKKRLKFIEAPMIHWPDSMFDYLEEDGILFSNDAFGQHYASLERFDDQASLELLMENAKYYANILWPLSPIILKKLQEIKAMNIEMILTSHGLSWRKKAVESYINWAKALPKVLIVYDTMY.. 262
110 7.000e-70UniRef50_A0A2N6AT88 MBL fold metallo-hydrolase n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2N6AT88_9FIRM  ali  18  6IKKGVYWVGAFDWDLRLFEGIYHTPNGVSYNAYLIID-DEITLVDSVESRFFGEMLEKIESLTPISKIDHVIINHVEPDHSGAFPEMMKMMPDAKIHCTQKAKEALLKYYYG--EEYDYNVVKTGDVLNIGKRNLHFIESRMLHWPDNMMTFVPEDKLLLSNDAFGQHLASSHLFDDENDMEMMREAKTYYANILMPFAPLLIRKIEEIMDLDMDMIAPSHGVVFRKDPIDAYLKWAKPEKKAIIIYETMY.. 262
111 8.000e-70UniRef50_Q97K92 Flavo-diiron protein FprA1 n=132 Tax=Clostridiales TaxID=186802 RepID=FPRA1_CLOAB  ali  17  8..ENVYWVGVKDQKLRVFDIIMNTKKGSTYNSYLIND-DKVAIIDTVKDGFYDEFLKSIKSVIGDKKVDYIVVQHTELDHSGSMYRLIKEYPEAKVVSSKAANMYLKEIVNDEFNSLDAMEVKE---LNLGKNTLEFISAPNLHWPDTMFTYNKENNILFTCDVMGCHYCPDGSIKDEGGEDYLPEMRYYFDVIMSPFKKFVNMGLDKIKDLKLDMIAPSHGPVHIND-IEESVKLYREWAKVQIFYITAYG. 260
112 8.000e-70UniRef50_F7JYT9 Uncharacterized protein n=1 Tax=Lachnospiraceae bacterium 2_1_58FAA TaxID=658082 RepID=F7JYT9_9FIRM  ali  16  8..EEFYWTGIVDDQLRVFDIIMYTEFGTTYNSYILKAGDKTVLFETAKAKFFDEYLEKLSEITDIRKIDYLVVNHTEPDHAGSVERLLELNPGLKIIATGCAIGFLKEIVN---GEFTAIPVKDNETMKIGNKTLRFLSVPNLHWPDTMYTYIEEEQILVTCDSFGSHYGFHDILLSTQWDDYVRATKYYFDNIIGPFKPFMSKALARVRELDLSMICTGHGPVI-DDKISWMLDTYEEWKTVIIPYVSAYG. 264
113 8.000e-70UniRef50_UPI00068FB2EC FprA family A-type flavoprotein n=1 Tax=Firmicutes bacterium ZOR0006 TaxID=1339252 RepID=UPI00068FB2EC  ali  19  5LKEGIYWVGAIDWKLRNF-HGFITPRGGTYNAYLIIDE-KVTLIDSTKPEFGPELLRRIREIIDPSEIDYVICNHAEIDHSGSIPSVMAVAPKAKIITSTKGKAILERHHKQTWEYE---LVRTNDELSIGKRTLKFATIPMVHWPDSMVTYAIEDKILFSNDAFGQQIATWERFADEMSMDIMEENQRYYANIVMPFANPVKNALKLVGGLECEMIAPAHGVIFRTEHIAAVLESYRKWNRAVIVYDTMW.. 258
114 8.000e-70UniRef50_A5I0X0 Anaerobic nitric oxide reductase flavorubredoxin n=59 Tax=Bacteria TaxID=2 RepID=A5I0X0_CLOBH  ali  19  5INDIVTWVGKIDWELRFHGKEYSTYKGSSYNSYLIKDE-KNVLIDTVWQPFAKEFVSNLKKEIDLDKIDYIIVNHSESDHSGALPELMKEIPSTPIYCTKNGAKLLKAHYHEDWNFV---EVKTGDTLEIGENKLIFVEARMLHWPDSMFTYLSGKNMLFSNDAFGQHYASELMYNDKVDSELLQEAIKYYANILTPYSPLVIKKIEEILNLAVDMICPSHGIIWRENPVDKYMEWAKNYREATIIYDTMWN. 261
115 8.000e-70UniRef50_A0A1F3BM73 Uncharacterized protein n=1 Tax=Anaeromyxobacter sp. RBG_16_69_14 TaxID=1797238 RepID=A0A1F3BM73_9DELT  ali  17  12IKPDVYWIGVLDSDLRVFDDLFPTRYGTTYNSYLIKGADKTAIIDTVKGKFGVEFLGKVKRLVDPAQIDYIIVNHSEPDHSGSLGLLLKHCPGATVVCTQMAATFLSNLYHSPFSLR---VVKHREVLDLGGKHLRFFSAPLLHWPDTMFTLLEEANALFTCDAFGAHYCGDSMFNDEVP-DLVPETKFYFDCLMRPFKDKVLSAIDKIRNEKIDIIC................................... 225
116 1.000e-69UniRef50_A0A264Y9W1 FprA family A-type flavoprotein n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A264Y9W1_9BACT  ali  17  5ITSSIHYVGVNDRHKTLFEGLWPLPYGVSYNSYIILD-DKIALVDTVEVDFFPQFLDNIRRVIGDRQIDYIIVNHVEPDHSGSIALIKKYYPEAVIVGNKKTFDMLGGYYGVGKAGDILEVKQGDTL-SLGHHELAFTMVPMVHWPETMVTLDTTAATLFSGDAFGCFGALSGAVIDEDMCCDWDEMRRYYSNIVGKYGVQVQQALKKLAGVKLDYICSTHGPVWHK-HIERVMSRYEAEPGLVVCYGSMYG. 261
117 1.000e-69UniRef50_A0A1C6BGA9 H(2)O-forming NADH oxidase n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1C6BGA9_9CLOT  ali  16  3ITEHVSYVGVQNPSMRVFDIIMTTNYGTSYNSYLVQ-GEKCALIETVHDAFSEEFFHNIENYIDVAAIDYVILNHTEPDHSGSLCKIVAANPQVEVIGTTAAIRNLANITNMEFKSRVIKQVTGEQLDLGGGVVLDFIVAPMLHWPDSMFTYLKADKVLFSCDVFGSHFCEPSVLDRKYPEAYASERLNYYTCIFSPFKKFVIAGMDKLKGLEIETACTSHGPVL-QEKLKETMELYRAWKKIAIFYVTAYG. 261
118 1.000e-69UniRef50_A0A1H0QR81 Flavorubredoxin n=1 Tax=Clostridium gasigenes TaxID=94869 RepID=A0A1H0QR81_9CLOT  ali  16  6IKKDIHWVGALDPNLRIFDIIMYTPYGTTYNSYVVKGSEKTAIFETVKVQFFDEYIGRLKDLVNPNEIDYIVVDHTEPDHAGSVAKLLELSPNAKIVGSPVAINFLKKIANCKFEHIS---VGDGDSLSLGNKTLQFISAPFLHWPDSMYTYVVEDEVLITCDSFGSHYSSPEVFNNESQENYMEALKYYFDCIFGPYKPYILKAINKIKDLKIDIICPGHGPVLIDNPM-KIVEIYKEWKLVTIPYVSAYG. 267
119 1.000e-69UniRef50_A0A259U612 Anaerobic nitric oxide reductase flavorubredoxin n=17 Tax=Negativicutes TaxID=909932 RepID=A0A259U612_9FIRM  ali  15  7IKKDVYWIGGNDFFTERFENMLPLPNGVSYNSYLILDE-KTAVIDSVDASIRVQFLANAKYLLQDRKLDYLVINHMEPDHCAALVDLVEMYPDVKIVGNAKIFTLFEQFYGKPCPDNYVTVGEGD-VIDLGQHKLQSFKAPMVHWPEVTVTFEQTEKILFSADAFGTFGTNGNIFADEVDYDYLADARRYYSNIVGKFGPQVQLALKKLLPLGIEMIAPLHGPIYRTPEIQYIVGKYNAWKGVLIAFASMYG. 267
120 1.000e-69UniRef50_A0A1W2A0J0 Flavorubredoxin n=2 Tax=unclassified Ruminococcaceae TaxID=552397 RepID=A0A1W2A0J0_9FIRM  ali  19  7ITDSIIYVGANDRKCDIFEGTYPVPDGMAYNSYLIKDE-KTVLMDTVDKAVAEVFYDNLKAALSGRDLDYVVVQHMEPDHSATLAGVLLRYPSAKIVTNAKTVPIMKQFFDMEIDSRVEIVKEGD-VLSVGSHELTFVMAPMVHWPEVMLTYDKKDKVLFSADAFGSFGANGNLFMDPSEYVTYKEARRYYTNIVGKYGAQVAAVLAKAASLDIDIIAPLHGCVWR-EGKEQILDSYKAWDGVAIIYGSVYG. 264
121 1.000e-69UniRef50_A0A1J4VPJ7 MBL fold metallo-hydrolase n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1J4VPJ7_9BACT  ali  18  5LKNKIYWVGAVDHNVRDF-HGYITPNGTSYNSYLIVD-DKITLVDTVKKEFAACLLGHVSEIIDPAKIDYLIVNHVEMDHSGSIVDILKVAKNAKIFCSAKGKEGLLKHYQITGREF--NVVKTGDTLSLGKRTLKFITAPMIHWPDSMFTYCVEDKVLLPNDAFGQHLASPKRFADEGEAYCMEESAKYYANILMPLGSIIAKKIDEIKSLPIDIIGPSHGAIWRNN-IPALINSYMDWEKVVIVYDTMW.. 259
122 2.000e-69UniRef50_I0GKT0 Putative flavoprotein n=2 Tax=Bacteria TaxID=2 RepID=I0GKT0_CALEA  ali  16  6IKDGVYAVGVNHWDRKLFDEIIPLPNGTSYNSYLIIGSQYTALIDTVDPALQDGLINNLKEFKDL-KVDYIISQHAEQDHSGSIPKILEMYPDAKVVTNEKCKELLIEHLGIPDEKFI--VIKDYDKLSLGNKTLTFIFTPWVHWPETMSTYLQEDKILFTCDFFGSHYATSELYAKNSEI-VLEGAKRYYAEIMMPFRNFIKSNINKIEKFDFEIIAPSHGPMWNDPKINAYLDWISPVNEVVVLYTSMHG. 257
123 2.000e-69UniRef50_C0D8T7 Metallo-beta-lactamase domain protein n=3 Tax=Clostridiales TaxID=186802 RepID=C0D8T7_9FIRM  ali  18  6IREGIYWVGAIDWHIRNF-HGYTTNRGATYNAYLILDE-KVTLIDTVKEGFSGELLERLSDVIDPAKIDYIISNHVEMDHSGALPAMVRACPNATIITSPSGLKGLSAHYG----NLNYKPMKTGDSLNIGRRNLTFVTTPMLHWPDNMVTYCPEERILFSNDAFGQHYATSERFDDETDLAAMEEAKKYYANIVMCYGRQAAAAWNVVHELGLDMIAPSHGIIWRS-HIDTIMDAYKRWSAAMVVFDSMW.. 257
124 2.000e-69UniRef50_A0A1B1PZ04 H(2)O-forming NADH oxidase n=58 Tax=Bacteria TaxID=2 RepID=A0A1B1PZ04_9CHLB  ali  16  9VTDDVTWIGVLDPGLVTFDIVMATKYGTTYNSYFINAEKKT-LIETTKVNFWPAYLEKIKQVTDPSEIAYIVVDHTEPDHSGNIANLLELCPEATVVGSANALKFLRDLVG---REFKSLTVKDGDTLDLGNKTLRFINALNLHWPDSIYTWIEEDQVLFTCDSFGCHYCNEAMYDDL-CGDFDDAFTYYFDAILRPFSKYMLDAIERIKDLDIKAICPGHGPILRKD-WKKYVDLSRKEKNILIAYVSAY.. 263
125 2.000e-69UniRef50_A0A2N5ZTQ3 MBL fold hydrolase n=1 Tax=Candidatus Parcubacteria bacterium TaxID=2053309 RepID=A0A2N5ZTQ3_9BACT  ali  16  6IAKNVFYVGVNDTSRKMFDAFLPLSEGTSYNSYLIEGSEKTVLIDTVDHIKSEELLKNLKQV---KKIDYIVANHAEQDHSGSLREVLKKYPEAKVLTTAYCKSMLIDLLHIREDSFELVVEN--QEVSLGDKTLRFIFTPWVHWPETFSTYLIEEKILFSCDFFGAHMSNKNIFSDNESENVIKQAKIYFAAIMMPFRELIKRNLEKVNSLELEMIAPSHGPIYKNPEL--ILNAYQSWDKVLIPYLSMHG. 257
126 2.000e-69UniRef50_A0A1V6J689 Nitric oxide reductase n=15 Tax=Bacteria TaxID=2 RepID=A0A1V6J689_9BACT  ali  15  8LSENIYWVGTNDRKTRLFENYWPIPSGIAYNSYLILD-DQITLMDTVSMGTMDSFLEKLKEILNGRAINYLIINHMEPDHSGAVKTIINEFPQVTIVGNNRTFPMLEGYYGI---KKNLMEVEENAVLHTGQHQFHFYLTPMVHWPETMMTYESTEKILFSADAFGSYGTDGGIFDDELNLSFYEDEMRYYSNIVGKYGLQVQKALAKLESLDLRMIASTHGPIWRPKVVEFYRNWYKTEQGVVIAFGSMYG. 262
127 2.000e-69UniRef50_R5HYB5 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=R5HYB5_9BACT  ali  18  4ISNKVFYIGTNDRKKHLFENNWPLPNGVAYNSYIIADE-HPALVDTLEYGSDPDYLSNIDTALGGRDLEYLVVNHMEPDHSSMIGEILRRYPRVKVVANCKTFKILESYYPLPAE--NVYEIKEGDILELGYHKLTFVMVPWVHWPETMVTYDTVDQILFSCDAFGSFGTDGGIFDDTANFDFYEEDMRYYSNIVGKWSGMVQKAFKKLEGVPVRIICPSHGLIWRKDP-GKVLALYDKWSKFVIAYASMYG. 259
128 2.000e-69UniRef50_D4H0W6 Beta-lactamase domain protein n=4 Tax=Deferribacteraceae TaxID=191394 RepID=D4H0W6_DENA2  ali  15  6LKKDIYWVGVKDPELEIFDIVIPTQHGTTYNSYLVKGTNKCALIEACKLNFKDEYIQRVEQVMPIKDIDYIILNHNEPDHSGALPALLDINPDIEVIYSKTAKTFVENIVNREFNGR---AVGDDDIIDLGGKTLRFFHTPFLHWPDTMFTYLVEDKYLFPCDFLGAHYCPKGDTLLNTELENKEEAKEYYSMIMRPYKEHINKALQKISDIEIDTVCPSHGPILSED-IQSYIDFYEKNRQVTLVFATAYG. 267
129 2.000e-69UniRef50_A0A1V5SPA1 Nitric oxide reductase n=6 Tax=Bacteria TaxID=2 RepID=A0A1V5SPA1_9BACT  ali  17  6VAENIWWVGAIDWKARYFGHTYTTKRGTTYNAYLILDE-KITLIDAVYGPFTDEMVQRIKSVIPAEKIDTIIANHIEPDHSGAYPELLKLCPKAKFYGSARAGQGLERYYHRKLDF---TPVKTGDKLKIGKRTLRFIEIPMIHWPDSMMTYLEEDGVLFSNDAFGQHYATNERFDDEVPRETLMEAAKYYANILWPFSHLIAQRIDEIEKLPIKMIATSHGLSWRKDPAG-IIAAYKRWPKIVIVYETMWG. 262
130 2.000e-69UniRef50_A0A1E3ACF0 Nitric oxide reductase n=168 Tax=root TaxID=1 RepID=A0A1E3ACF0_9FIRM  ali  21  10....IYAVGVVDWNVRSF-HGYTTNRGATYNAYLIVDE-KIALIDTVKAPFAAELLERVREIIDPARIDYLVSNHVEMDHSGAIPAVMEAAPGAVIVTSPSGLNGLKMHYG---DSYEYMPVKAGDSLSLGRHTLQFVPTPMLHWPDNMVTYCPEEKILFSNDAFGQHYSSSKRYDDEVDLEVMAEAEKYYANILMPYGMQMKKTIPVIEGLDISLIAPSHGVMWRS-HIGDIIKAYKHYKKAVVVFDSMW.. 258
131 2.000e-69UniRef50_A0A1F6PYH3 MBL fold hydrolase n=30 Tax=cellular organisms TaxID=131567 RepID=A0A1F6PYH3_9BACT  ali  16  6IKDNVFSVGVIDWDRRLFDELIPLPHGTSYNSYLIKGSEKTALIDTVYTPKLEELVLNLKEKLQIERLDYIVANHAEPDHSGSLPAILQMYPEARVLTNAKCKELLQAHLQILDDKFIT--VDNSTEISLGNRTLKFMISPWVHWPDTMFTHLPEDKILFTCDFMGSHMATSDLYS-VNEGAVYEAAKRYYAEIMMPFRPQVKKYTEQVKNMEIDLIAPSHGPLHNRPAIDAYTDWASDTPKVVIPYVTMY.. 261
132 2.000e-69UniRef50_A0A1E7IB03 Uncharacterized protein n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1E7IB03_9DELT  ali  18  6IAEGVHWVGAYHPDLEVFDELYPTESGTTYNSFLIQGKNKTVLIDTVDEHFFDEFIERIEEVCSVADIDFIVSNHTEHDHSGSIEKMLELNPKIQVIASRSGEKFLQEQINKPINSRSI---KDGEQLDLGGRTLQFMVVPFLHWPDTMFTYLVEDEILFSCDAFGAHHCDNRIFCDELAADISVDFKIYFDTIIRPFKSNVRSALAKLSDTAIQMVCPSHGPIYRQ-GIAGLVENYQSWSQEVEA....... 249
133 3.000e-69UniRef50_Q58142 Uncharacterized protein MJ0732 n=23 Tax=Methanococcales TaxID=2182 RepID=Y732_METJA  ali  17  8IKNGIYWVGVIDWEIRDF-HGYGTPYGSTYNSYLIKD-KKNVLIDTAKDYMFNELIYGISKFIDPKDLDYIIVNHVEKDHSGCVDKLVE-ISNATIITNEKGKEHLSLYY--DTKDWDFIIVDTGDEINIGDRTLKFIRTPMLHWPDNMLTYCKEEKILFSNDAFGQHIASSERFDYEIGEGIFEHAKDYFANILMPYKMLIPDAIKAVKNLDIELICPSHGVIW-KEYINEIIEKYNEWNKAVIVYDTMYN. 259
134 3.000e-69UniRef50_A0A1E3AJ52 MBL fold metallo-hydrolase n=256 Tax=Bacteria TaxID=2 RepID=A0A1E3AJ52_9FIRM  ali  19  7VTEDLYWVGANDHRLTLFENIHPIPRGVSYNAYLLLDE-KTVLFDTVDWSACRQLLENMDYLLQGRQLDYLVINHMEPDHGASIEEILLRFPKVTIISTPKAFMLMRQFGFDIDNYTQLEVKEGDT-QSFGRHTVTFVNAPMVHWPEAMVTFDVTDGVLFSADAFGSFGADGKLFNDEVDFDWIDDARRYFTNIVGKYGAPVQALLKKASKLDIKMICPLHGPVWRSN-IGYFIEKYDLWKGVMIAYASMYG. 265
135 3.000e-69UniRef50_E0STW1 Beta-lactamase domain protein n=2 Tax=Thermoprotei TaxID=183924 RepID=E0STW1_IGNAA  ali  19  2IVDNVYWVGVNDYLKDLFEGLWPLPYGISYNSYVVVGDRDVALIDTVDEHYIYEYIGRVQEVVDLSRVRYIVVNHLEPDHHGATEELIKMLPNARLVMSSIAMNIANSLYNIPRERIVT--VKDGDVIDLGGKKLRFIYTPWLHWPETMMTYLEEDGILFSCDAFGSYGAENGVFDDEVDLDFYDEAKRYFSNIVIKYSKNVIDAIEKLEKLDIRIIAPSHGPIYRSNP-RRIIDLYRLWRDVLLIYGSMYG. 261
136 3.000e-69UniRef50_A0A1V5QN47 Flavo-diiron protein FprA1 n=3 Tax=Bacteria TaxID=2 RepID=A0A1V5QN47_9PROT  ali  15  6IAENFYWVGALDPDLRVFDVIMRTEFGTSYNSFLLTTPKYKVLFETVKIKFFDGFLQRLSEHCEPVDIDYIVINHTEPDHSGSLEKLLQLAPKAKVVASPVALSFLSDICN---RELPVHPALDNGVLELDTCRLRFLSVPLLHWPDSMYTWIEGPDILVTCDSFGCHYADERICNDLIEGDFLSAYRYYFEMIMGPFKPNVRYALERIKDLPIRIIAPGHGPVLRSN-LDYYLDLYRKWPRVVIPYVSCYG. 264
137 4.000e-69UniRef50_A0A1V5B5M3 Type A flavoprotein FprA n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1V5B5M3_9EURY  ali  15  11....INWVGAIDWDRRLFDALIPLPEGTSYNSYLIKGSEKTALIDAVDESMADVLLGNL-SALGIERIDYIIVQHAEQDHAGSLKRLLDQYPDAKVLGSAKCLDLLMSFALAGKD--QLQEIKDGEKMSLGDRSLQFISAPWVHWPDTIFSYLAEERILFTCDFLGSHLATSDLFA-SDEATVYRAARRYYAEIMMPFRQNINRHLARIADLPLDIIAPSHGPLYDRP--EFILDAYRDWNQVVLPYVSMHG. 258
138 4.000e-69UniRef50_A0A2G9YMR0 MBL fold metallo-hydrolase n=8 Tax=cellular organisms TaxID=131567 RepID=A0A2G9YMR0_9BACT  ali  16  7....VYSVGVVDWNVRFHGYTYTTKRGTTYNAYLIVD-DKIALVDTVYGPFADELIENIRQIVPVEKIDYVIANHVETDHSGALPSIMKLCPKTKVLGTEKCKEGLYRHYYGNWDF---QVVHTGDKIKLGKRTLTFLEAPMIHWPDSMFTYCPEEELLLPNDAFGQHYATKERFDDEVDQCALMEAVKYYGNILWPLGPVILKKIEEVQKLNIKMIAPSHGIIWRKDPINAYVSWARNEPKVIVIYETMWG. 259
139 4.000e-69UniRef50_R7EVY9 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:485 TaxID=1262927 RepID=R7EVY9_9BACT  ali  15  6IAPGVSYVGVDDRRKILFENLWPIPRGVSYNSYLVEGTEATALIDSVEVTEIGDLVKHISQNSASGALHYLVVNHMEPDHSGGIPELLRIYPELKIVGNNKTLEMCQGFYGVPADR--MMEIKDGQILDLGGKTLQFFMTPMVHWPETMMTWLEADGILFSGDAFGGFGALNGNPLDEDVSPFFEEIYRYYACIVAKYGRFVQNALKKVGNLSITTICPTHCLIWRK-HLKEVVDLYSRLSSWVIVYGTMYG. 262
140 4.000e-69UniRef50_UPI000834D90A FprA family A-type flavoprotein n=1 Tax=Methanofollis ethanolicus TaxID=488124 RepID=UPI000834D90A  ali  15  6IVPDVYSVGVVDWDLRLFDALIGTPEGTSYNAFVVRGTEKTALIDTVDPKFDEELLKNLMK-LGMSSLDYIVINHAEQDHSGTLPLLLEMFPGATVIADEKCCDLLDRLLQIPPERIQM--VKDGDTLDLGGKTLEFLVTPWVHWPETMLTFEKEDGILFSCDLFGSHLATSELFVRDF-TTVYHAAKRYYAEIMMPFRTSVKAAMQKTAERDVAIIAPSHGPLYRDPSL--ILGAYEDWTSVLIPYVSMHG. 257
141 4.000e-69UniRef50_A0A1V5ZZS6 Nitric oxide reductase n=28 Tax=cellular organisms TaxID=131567 RepID=A0A1V5ZZS6_9BACT  ali  21  5IKKDVFWVGVKDWALNFFGHELSTHRGSTYNAYLVRD-KKIAVVDTVWDPFTEKYLDNVKSLVDPSRIDYVVANHAETDHSGALGALMELAPQAEVIVSPRGMDSIPGHFH--KEWKFRQVKTGDKIPL-GETEMIFVEATMLHWPDSMFTYLSGRDLLMPNDAFGQHYASAFPYNDQVDQEEYQECLKYYANILTPFSPMVLKKIDEVLGLKVDMIAPSHGVIWRKDPVKKYQEWARQEPEAVILYDTMWN. 261
142 5.000e-69UniRef50_A0A1C5RJ28 H(2)O-forming NADH oxidase n=16 Tax=Bacteria TaxID=2 RepID=A0A1C5RJ28_9CLOT  ali  15  3ISTCVKYVGVNDHQVDLFEGQYKVPNGMSYNSYVILDE-KIAVMDTVDGFFTEEWLNNVEQVLSGKTPDYLVIQHMEPDHSASIPAFLKKYPKTTVVSTAKGFQFMEQFFPEFFPAEQHIVAANDGVLELGQHSLHFVYAPMVHWPEVMMTYEATEKILFAADGFGKFGA------LDVEEEWANEARRYYIGIVGKYGPQVQAVLKKAAGLDIQTICSLHGPVL-KENLGFYLEKYDKWSSVVIAYASVYG. 258
143 5.000e-69UniRef50_UPI0009B9C81D anaerobic nitric oxide reductase flavorubredoxin n=2 Tax=Vibrio harveyi TaxID=669 RepID=UPI0009B9C81D  ali  18  5VKNNIHWVGQRDWEVDFHGTEYKMTKGTSYNSYLIR-EEKTVLIDTVDHRFSQQFIQNLEMEIDLKSIDFIVVNHAEEDHSGALSALMEKIPNTPIYCTEAAIDSIVGHHHHP-EWNFKTVKTGDSIDIGNGKQLVFVEAPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDERLFNDEVDQNELMECLRYYSNILTPFSSLVTAKIKEVLNLPVDMIATSHGIVWRDNPIEQYLAWADQEDRITIFYDSM... 261
144 5.000e-69UniRef50_A0A223YW58 Nitric oxide reductase n=6 Tax=Methanobacteriaceae TaxID=2159 RepID=A0A223YW58_9EURY  ali  14  6IADGVYYTGTIDWDRRTFDELVTLPRGTSYNSYLISGTSATALIDTTEPSRAAELLRTLEEM--DADIKYIISQHAEQDHSGTIPELLEIYPEAEVIGTPACIELLQELLRINGNFR---EVKDGESLSLGDRTLRFIVTPWVHWPDTMVTYLEEDGILFTCDFFGSHIATSDI--METPDDFLREAKRYYAHIMMPFSQMVASNLRKISELEVSMIAPSHGPVISEPGL--IMDAYDTWDGVVIAYTTMHG. 252
145 5.000e-69UniRef50_A0A1V5F4P3 Anaerobic nitric oxide reductase flavorubredoxin n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1V5F4P3_  ali  16  7ITDDIYYVGVNDRQKAKFENLIPLYDGVSYNAYLIVDE-KTALIDTVDIHFGEILIQKILSQLGDKGLDYLIINHMEPDHSGSLRLLRKYFPNMTIVGNERTLSMVKGFYEIDGSLLK---VSDEESLSLGRHQLQFFLTPMVHWPETMMTFDHADKVLFSGDAFGSFGANGSILDENLDIDKYWDEMRYYANVIGKYSSPVQKAIKKLEHLPYEIICSTHGPVWKIN-LKKAVEIYDRLEGVVIVYGSMYG. 261
146 5.000e-69UniRef50_A0A239ZP52 Flavodoxin n=6 Tax=Clostridium TaxID=1485 RepID=A0A239ZP52_CLOCO  ali  17  6IRDNIYSVGVKDPGLRVFDIIMETNRGTTYNSYLI-DDEKVAIIDAVKDGFYDEFYSNIKEVIGNRKVDYIVIQHTELDHSGSLINLLRDYPEAQVICSMAASVYLKNILNKDFNHQIAP-----KELSLGSTTLKFITAPNLHWPDTMFTYVPEKKVLFTCDFLGGHYCPEKDIVSGEVENNHEEMVYYFNVIMSPFKKFVLAGLDKIKDLDFDIVANSHGPIHTKESIKKYMDMYRKEDKIEIFYISAYG. 262
147 5.000e-69UniRef50_U7V8N6 Pyridine nucleotide-disulfide oxidoreductase n=1 Tax=Cetobacterium somerae ATCC BAA-474 TaxID=1319815 RepID=U7V8N6_9FUSO  ali  18  6LKDGIYWIGALNPDLKVFDVIMETQFGTTYNSYLVKGDKKIAVFETVKENKFQEFLERLKTCLDISKIDYIVLNHTEPDHSGSVGKLLDLAPNAKVVGSKNTIEFLRGILNKDFPHI---IVGQDDTISLGNKTLKFISAPFLHWPDSMYTYIEEDKYLVTCDSFGSHFSFDGILLSKVPVERHKDYMYYYMCIFSPFRKYMLEGIEKIKDLKIDAILPGHGPVLDID-IDKMIQTYKNWKSIIIPYATAYG. 267
148 7.000e-69UniRef50_A0A1H4BRU3 Flavorubredoxin n=2 Tax=Eubacterium TaxID=1730 RepID=A0A1H4BRU3_9FIRM  ali  15  6ITQDISWVGVDDHQTELFEGLWPLDNGISYNAYVINDE-KVAVIDAVKDFECETYLEKIKSIIGDKPVDYLVVNHMEPDHSSGISELRAAYPGVTIVANQKALPMLKNFYGIEEG---IQIVADGDTLELGAHCLSFHMTPMVHWPESMVTYDQKDKVLFSMDVFGSFKTDGVIFDDENIVESFVDEIRYFACIIGKVRLPAAKALKKLGGLEIKTICPSHGLVWRENP-GYILDLYETENGVVIAYGSMYG. 260
149 7.000e-69UniRef50_A0A0N8GNE4 Beta-lactamase n=1 Tax=Ornatilinea apprima TaxID=1134406 RepID=A0A0N8GNE4_9CHLR  ali  13  6IAPDTFWIGINDRTTDLFEGLWPIKDGITYNTYLINDAKKAI-IDLAKEFESIAFLEQIQHLVSLNEVDYVIINHMEPDHSGAVKALLAEAPQVKLVCSKKAAKMLVSYYGITE---NVQIVDDGDTLELGSHTLRFYSTPFVHWPETMMTFDETTGALFSCDGFGGYGAGSIFDEDTTDLDFYTEALRYYVNIVATFSIPVSKAIQKLAEVPIKVVAPSHGLIWRKNP-QEIIQLYSQWNAVTMLYATMYG. 265
150 7.000e-69UniRef50_A0A251X9T8 MBL fold metallo-hydrolase n=15 Tax=Proteobacteria TaxID=1224 RepID=A0A251X9T8_9GAMM  ali  17  20ISSRVHWIGALDPTLRTFDIILKTANGTTYNAYLVRGQDGVAVIDTVKEKFSDEFFQRLESVANYDDIRVIVLNHLEPDHTGALPELMRRAPHARLYISHKAQRMLKGLLKQ--ESFDFTPVTTNDTVSLGDCTLRFLNTPYLHWPDTQCTYLEEEAILFSGDAFGCHFCDPRLFNDLV-GDFRFSFEYYYAHIMRPFREHVLAALELIEPLHLKIIAPTHGPILRDQP-ARYVARFRELKTLLVFYLSSYG. 278
151 7.000e-69UniRef50_A0A1C5LWU7 H(2)O-forming NADH oxidase n=524 Tax=root TaxID=1 RepID=A0A1C5LWU7_9FIRM  ali  16  3ITEDIKYVGVNDHDIDLFEGQYQVENGMAYNSYVI-TDDKIAIFDTVDAHFSEEWLANIKNVLGDAKPDYLIIQHMEPDHSASIGIFMENYPDTTIVASAKAFTIMKQFFGCDYAEHQLVVKEKDTL-ELGKHTLTFVAAPMVHWPEVIMTYDSYAKVFFSADAFGKFGA------LDVEEDWACEARRYYFGIVGKFGAQVQALLKKAAGLDIQTICPLHGPVL-NENLDFYRNLYQTWKGVLIAYTSVYG. 252
152 8.000e-69UniRef50_A0A1C5RWT4 H(2)O-forming NADH oxidase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1C5RWT4_9CLOT  ali  17  4LKNNIFYVGVKDPTLRTFDIFMETEYGTTYNAYLVK-GEKTALIETAHEKLLDSYISNIEEIMPVSEIDYLICNHTEPDHSGSVKKILELNPDIEVVGSIAAIRNLKEITNMT--FKEHIAKDGAELDLGDGKVLKFCIVPNLHWPDTMVTYLESEKTLFSCDVFGAHYCEDAVVDDIIYYDKYEKAMKYYDCIVSPFNSFVVKALEKLSALDIEMVCNSHGPILKK-YIAEAVKKYSAWKTVAIFYASAYG. 261
153 8.000e-69UniRef50_B1XCN7 Anaerobic nitric oxide reductase flavorubredoxin n=2522 Tax=root TaxID=1 RepID=NORV_ECODH  ali  17  5VKNNIHWVGQRDWEVRFHGTEYKTLRGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGHHHHP-EWNFNVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFECQRYYANILTPFSRLVTPKITEILNLPVDMIATSHGVVWRDNPVELYLKWAAQEDRITIFYDTM... 261
154 8.000e-69UniRef50_A0A1W9W135 MBL fold hydrolase n=3 Tax=Fusobacteriia TaxID=203490 RepID=A0A1W9W135_9BACT  ali  16  7VSKSVKWVGVIDQDITFHGEELDIPHGTSFNSYLIRDE-KIVLVDTVMEKFSSEWIEQLKGEIDLNTIDYVVMNHNEPDHSGSLSTLMKEIPNTPIYCTAKGVEIIKAYHNIDAEFR---VVKTGDVLDLGKKKLTFVEMKMLHWPDSMASYLSKENILFSNDAFGQHYGANGLFNDECDQNILYEALKYYACILTPFSPLIKRKIEEILSLNINQICTSHGVIWRKNPLQ-IIEKYMKWDQILITYDTMW.. 262
155 9.000e-69UniRef50_H3K853 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=H3K853_9FIRM  ali  19  6IRDDIYWVGAIDWSVRNF-HGYETGRGSTYNAYLILDE-KITLIDATKKTFSDEILSRISSIIDPAKIDYIVCNHLEADHSGSLDIIAQKCPNATIFVSPNGLKNIAKFCG----EHTYQGVKAGDSINIGKRTLKFVPVPMLHWPDSMVTYCPEEKILFSNDGFGQHLATNERFDDEVDYAVLMEAKKYYANILMLYGRQAQTALKTVSTLDIDMILTGHGISWRK-HIKDILDLYAKWHKAVVVFDSMWN. 259
156 9.000e-69UniRef50_A0A1W9XA16 MBL fold metallo-hydrolase n=3 Tax=unclassified Desulfobacteraceae TaxID=231684 RepID=A0A1W9XA16_9DELT  ali  19  6IAEGIYDVGVNDWNIRDF-HGYSTYQGTSYNAFLIVDE-KITLIDTVKKEFADQLLDKIAQVVDPRKIDYMISNHTEMDHSGGLPRVMHRIGEDKLYCSKMGAKNLSRHFSQNWNY---QPVKNGEQLSLGKRTLTFLETRMLHWPDSMFTYVNEDKILFSSDGFGQHYAGHEKFDDVIGDAIMPHAKKYFANILLLYAPLILKLVDKILGLDIKMICPDHGILWRKDPINAYVEWSKQEKKAVIIYDTMW.. 260
157 1.000e-68UniRef50_A0A1C6HCH2 H(2)O-forming NADH oxidase n=6 Tax=Clostridiales TaxID=186802 RepID=A0A1C6HCH2_9FIRM  ali  18  6LKKGFYFTGAIDHNLRVFDIIMYTEFGTTYNSYVLKTGKHTVLFETAKAKCCEDWLKKVGEITPIEEVDYLVVSHTEPDHSGSIERLLDLNPRLKIVATGCALGFLKEIVNKDF---YSIAIKDGQTLELDGKTLEFIVAPNLHWPDTMYTYIREDKTLVTCDSFGSHYAMDEVVASVTDREGYLRAKYYFDCIIGPYKRFMLSALKRVRQLDLDMICPGHGPVL-DCNIPWMLDTYEEWSTVIIPYVSAYG. 264
158 1.000e-68UniRef50_A0A2N1UA00 MBL fold hydrolase n=1 Tax=Candidatus Riflebacteria bacterium HGW-Riflebacteria-2 TaxID=2013830 RepID=A0A2N1UA00_9BACT  ali  17  6LTDRVQWMGAVDWNRRLFDTLIPLPDGTSYNAYLIKGSEKTVLIDAVDPAMQSILLHQLK---GIERIDYIVSQHTEQDHSGAIPVLLEKYPKSTLICSEKAKGLLIDHLLIDPARIKT--VADEETLSLGDCTLKFYMTPWVHWPETMVTYLPEDKLLFSCDFLGSHIATTRLLAGRDPFVA-EAAKRYFAEIMMPFRTFVKKNLEKIKTLDINMVAPSHGPVYDQP--DWIIEDYEDWNLVVLPYISMHG. 255
159 1.000e-68UniRef50_A0A1Y4GFU4 FprA family A-type flavoprotein n=2 Tax=Synergistaceae TaxID=649777 RepID=A0A1Y4GFU4_9BACT  ali  16  7ITDSIYWIGGNDRETDLFEGLWTLPRGVAYNAYFINDE-KTAVIDTIKADKLSDYMERLVSGLPGRTIDYLIVDHMEPDHSGSISIMRRLYPEMKIVGNKKTLEMIDAFYGIKDGTV---EVKEGDVLDLGHHKLTFAMIPMVHWPESMVTYDTTEKVLFSTDAFGGFCAEGGIFDDELDMSLYEDELRYFANIVGRYSAPTQKAIAKVRGLDLKIICPAHGPILRSNP-KHIVDLYDKWSKVVVVYGSMYG. 262
160 1.000e-68UniRef50_U2EEH4 Flavo-diiron protein FprA1 n=4 Tax=Bacteria TaxID=2 RepID=U2EEH4_9BACT  ali  16  5IKENIHFIGVLDREIEVFDVVMETEFGTSYNSYLIKGKEKNAIVETVKDRFFDEYLNNINELVGIENIDYVIMDHTEPDHAGSLEKLLELNPNIEVVGSRAAILYLKDITNMEFKSR---VVKQNDTLSLGDKTFRFISAPFLHWPDSIYTYLEEDNTLFTCDSFGCHYAHDGIFISELDAKEQIDFIYYFNAIFSPFKKFLLQAVAKIETLDIDIIAPGHGPVFDKSEAQQIINFYQSWAEQHVDYETM... 260
161 1.000e-68UniRef50_A0A1F9Z1G7 MBL fold metallo-hydrolase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1F9Z1G7_9BACT  ali  17  6VVKNVYSVGVVDWNIRFHGYTYTTNRGSSYNAYLIID-KKIALIDTVLGSFSNELIERIKEIIDPSKIDYIIANHVETDHSGALPEIMKLANNAKLVGTAKCKEGLFRHYYTNWDFQT---VKTGDEISLGEKTLKFIEAPMIHWPDSMFTYIPEDKLLLPNDAFGQHIASTEKFDDEIDNCLLMEAAKYYANILIPYSQVILKKIDEISGIDIKIIAPSHGIIWRKDPVNSYIQWAKGLPDVIVIYETMWG. 263
162 1.000e-68UniRef50_T0E2L6 Flavo-diiron protein FprA1 n=2 Tax=Clostridiales TaxID=186802 RepID=T0E2L6_PAESO  ali  14  8LKKDLYWVGSLDPSLRVFDIIMYTPYGTTYNSYVLKANEKTILFETVKAKHFDSYLARLESLIDLEKIDYIVVSHTEPDHAGSVERILKLSPKAKVIASQNAINYLKEIVNCDFNYIK---VEDNDELKIGNKTLKFYSVPLLHWPDTIYTYIKEDEVLVTCDSFGSHYCEGIINTKIENKDHYMEALRYYYCIMGPFKPYVLKAIDKIRALKLDIICPGHGPVLVENP-REIVDIYEKWSK........... 248
163 2.000e-68UniRef50_A0A1V6D1H8 Nitric oxide reductase n=10 Tax=cellular organisms TaxID=131567 RepID=A0A1V6D1H8_9CHLR  ali  18  10....IYWVGVNDRVTDLFEGLWPISQGVSYNAYLVKDE-KTALIDLSKEMLSDDYLSQLSAVVDLASVDYVVINHMEPDHSGALKRMLEFAPNAQILGMPKAIDMLKDFYGLEENTTR---LSNNQELSLGKYTLRFVYTPLVHWPETMMTYLVEEGILFSCDGFGGYGAGGVFDDDYADLAFFEEALRYFSNIVAAFSKSVLSALKKFVDMPIRMIAPSHGLIWRADP-ARIIDLYRTWSEITILFGTMYR. 265
164 2.000e-68UniRef50_A0A0L7DPP7 Lactamase n=2 Tax=Clostridium botulinum TaxID=1491 RepID=A0A0L7DPP7_CLOBO  ali  18  6LKDDIYWVGVKDPNLEVFDIIMETKKGTTYNSYIINDE-KVVIIDSVKDGFWDKSIESIKEIIGDKKVDYIVVQHTELDHSGSLIKFLEEYPDATVIGTIAALNYLKEIVNKEFKGKNINEIKE---LNIGNNTLKFISVPNLHWPDTMITYIPEQNILFTCDITGAHYCTLDIESDLDDMEYVREFEYYFNCIMGPFKKFVLSALDKIKDLKINMIVPSHGPVHKDKNVNKVLELYENIKKVQILYASAY.. 261
165 2.000e-68UniRef50_UPI0004665939 FprA family A-type flavoprotein n=1 Tax=Butyrivibrio sp. FCS014 TaxID=1408304 RepID=UPI0004665939  ali  15  7VTDGIYWIGGSDRRLSRFENIFPIPEGVSYNSYFV-DDEKTAVFDTADVSVADQYLENLGEALSGKKLDYLIVLHMEPDHCSQIANVTALFPEVTVVGSKQTFTFMEQFFPEAKDYKRLEVKEGDTL-STGAHTFKFVAAPMVHWPEVLFAYDETSKALLSADAFGTFGADGGLFADEYDFDFLPSARRYYANIVGKYGVQVQAVLKKAAGLDIGMILPLHGPVWRKD-IAWFVDKYNKWDDAIVVYGSLYG. 265
166 2.000e-68UniRef50_A0A1V5LDC7 Nitric oxide reductase n=1 Tax=Alphaproteobacteria bacterium ADurb.Bin438 TaxID=1852792 RepID=A0A1V5LDC7_9PROT  ali  16  6LVKDVYAVGVKDWNIKNF-HGYAITLGITYNAYVVKGSEKVALIDTVKEKFTDEYIARVKATTDLDKVDYVICNHVEMDHSGAIPHLMKLLKDAILVTSMKGKENLEAHY--DMNGVNIQVVKTGDILSLGDRNFKFVNTPMLHWPDSMETYLIEDKILFSNDGFGQHYTGEMYFDDRDECVIFDQAAKYYANILQLFDKPANAALNILKDVEINMIAPAHGVIFRKENIEKILKKYQEWNKAVVIYDSMWG. 262
167 2.000e-68UniRef50_D5RFV7 Metallo-beta-lactamase domain protein n=121 Tax=Bacteria TaxID=2 RepID=D5RFV7_FUSN2  ali  19  7INDDIIWIGINDRKTERFENYIPLDNGVTYNSYLIMDE-KICIVDGVEEGENGNFLSKIEAMIGNSPVDYIIVNHVEPDHSGSIKNMLKIYPELKVVGNAKTIMMLKLLGLDLPDERVVIVKEKD-ILDLGKHKLTFYLMPMVHWPESMATYDITDKVLFSNDAFGSFGADGAIFDDEVNTDFFTDEMRYYSNIVGKFGAPVNAILKKLSSVEISCICPSHGLIWRK-YIKEIIERYQKWEGVVIVYGSMYG. 264
168 2.000e-68UniRef50_A0A124EG74 MBL fold metallo-hydrolase n=24 Tax=Bacteria TaxID=2 RepID=A0A124EG74_9FIRM  ali  20  5LTDKVTWVGKIDWELEFHGHEYSTEKGSSYNSYLIRD-TKTVLMDTVWKPFDEEFVANLKREIDLKDIDYIVMNHNENDHSGALPALMREIPDTPIYCTKKGEAILRGLYHQDWNFVN---VKTGDTLDLGSSQLVFIEAPMLHWPDTMFTYMTGENILFSNDGFGQHYASEKMYNDCVDAELYQEAMKYYANILNLYSPMVTRKIDEILNMNVSMICPSHGVIWRDNPVAKYQEWAKQENQITIIYDTMWN. 261
169 2.000e-68UniRef50_A0A1V6EIJ3 Nitric oxide reductase n=18 Tax=cellular organisms TaxID=131567 RepID=A0A1V6EIJ3_9BACT  ali  16  25INDRVSLAGAVDWNRRLFDSLIPLPEGTSYNAYIVRGSEATALIDTADPAMASILKSQLEEV---DRIDYVISQHAEQDHAGALPDVLALYPEAVVICSVKAKDMLIDHLHLPASRIRT--VAEGETLSLGDCSLTFVYTPWVHWPETMCTYLPEDRILFSCDFFGSHLATSRMYAGEDPHVC-EAAKRYYAEIMMPFRKIVKNNVAKVQKLDCALIAPSHGPIYDKPRIDAYVSWLSDTNKVVIPYISMHG. 274
170 2.000e-68UniRef50_A0A256XK94 Uncharacterized protein n=1 Tax=Thermoplasmatales archaeon ex4572_165 TaxID=2012525 RepID=A0A256XK94_9EURY  ali  22  215..................EYGYLTNRGTTYNSYLIID-KKITLVDTVKHYLFDEMLSRISEIIDPSKIDYIVSNHVEMDHSGSISKMLEICPNAKIITSTRGIKGLKRHYKKEWNFE---VVKSGDTLNIGKRTLHFVEIPMVHWPDSMVTYSPEDKLLIPNDAFGQHIASNLRFDDEIEWGILEEAAKYYANIVMPYGSQVEKAIDAISDLDIDMIAPSHGIIW-KEKISQIVDEYRKWNKAVIIYDSMW.. 449
171 3.000e-68UniRef50_A0A1M5TIH0 Flavorubredoxin n=36 Tax=Bacteria TaxID=2 RepID=A0A1M5TIH0_9BACT  ali  16  6..ENIKYIGVDDRDLDLFEGQYVVPEGMAYNSYVIVDE-KIAVTDTVDAHKVGEWLANLDAALAGRKPDYLVIHHLEPDHAGGIADFVAKYPEATLVASAKAFALLPQFMALPESVKKQTVKEGDTLAL-GKHTLQFIGAPMVHWPEVLFSYEQSEKVLFSADAFGKFG-----VYDADPDDWACEARRYYFNIVGKYGNQVQAVLKKAATLDIKTICPLHGPVLT-ENLGYYIDKYNTWKGVLVAFASIYG. 254
172 4.000e-68UniRef50_A0A124G6J0 Uncharacterized protein (Fragment) n=2 Tax=Bacteroidales TaxID=171549 RepID=A0A124G6J0_9BACT  ali  15  7IVNDVYYVGVNDRTKHLFENLWPLPHGISYNAYII-DDEKRALIDTVDVCYSDLFFQKVTAVLGDKPIDYLIVNHMEPDHSGSIGLLINRYPDIQIVGNKHTVKMLKGYHGIT---RNVILIEDMHTLNLGRNNLQFYLTPMIHWPETMMTYLQEKKMLFSADAFGAFGTGAVLDSQLTPERYRSEMIRYYSNIVGKFGSPVQTALKKLSEVPIEAICSTHGPVWTKENIAEVLSRYEAENGLVIAYGSMYG. 263
173 4.000e-68UniRef50_A0A1F9ZSI3 Pyridine nucleotide-disulfide oxidoreductase n=1 Tax=Firmicutes bacterium GWF2_51_9 TaxID=1798011 RepID=A0A1F9ZSI3_9FIRM  ali  15  6LSQNLWWIGSLDPDLRGFDIIMETEFGTTYNSYVLKGSEKTAIIDTAKLKTYDQYIAKLSEVVDVKDIDYIIVNHTEPDHAGSIGKLIQQNPDITIVGTQTALTFLKDIVNAPFNSI---AVKENDTLSLGDRTLRFMILPNLHWPDTMYTFVEEDGVLFTCDSFGAHFCDENVLLSKVTDRVGYERKYYYDMILDPFPKHMLKALDRIKNLNIKLIATGHGPVLDQE-IPEIQAKYKVWKTVIIPYVSAYG. 264
174 4.000e-68UniRef50_A0A2N1Q2R3 FprA family A-type flavoprotein n=1 Tax=Tenericutes bacterium HGW-Tenericutes-5 TaxID=2013848 RepID=A0A2N1Q2R3_9BACT  ali  17  6LKDGVYWVGAIDYDLKVFDIVMHTEFGSTYNSYIVKGNEKTSLIDTAKSPFKDEFFERINDIVKVEDIDYLIVNHAEPDHSGLIEYVLEKNPNIQIYGSPAAGLNIKE--IINMENLNFNRVKDGERLSLGNRTLEFSLQPNLHWPDTMFTYLVEDNILFTCDFFGAHYAFDGVVSSNNIKDYDRSLKEYFDAIMSPFMSSVRRGVKKVKEYYPEIIATSHGAVLEKDYIPKAIKLYEKWSKVVIPFASAYN. 265
175 4.000e-68UniRef50_UPI000C0872EC FprA family A-type flavoprotein n=1 Tax=Tepidibacter mesophilus TaxID=655607 RepID=UPI000C0872EC  ali  18  6IKNNIHWTGVLDPGLEVFDIIMKTEFGSTYNSYFIDDEKK-VLIDTVKANFKGEYLEKLSKLTDIKNIDYVIINHTEPDHSGSLKYLLEINPNIEVYCTKAASIFLSEQVNQ---EFKCHVIKDGEELDIGSKKLKFVTAPFLHWSDTMFVYSESDKVLFSCDAFGSHYASVD-PKVVHTDDYKKSLKHYYDCIVKPFAKHALSAINKVKDFEIDTILTSHGPILCEDNIQKYTEWSTEVKKVALLYLSAYK. 261
176 4.000e-68UniRef50_A0A1C6C0F2 H(2)O-forming NADH oxidase n=1 Tax=uncultured Clostridium sp. TaxID=59620 RepID=A0A1C6C0F2_9CLOT  ali  18  9IADGITYVGAADPNLRIFDVIMSTEYGTTYNSYFIEGTKARALVEVVKEGFGDEQIAALQEMTDLASLEYIILDHTEPDHSGAFYKLLDAAPDATVVATRAGMTLARELANRPFKE---MIVKDGDSIDLGGKTLQFIMAPFLHWPDTMFTYVKEDKALISGDVFGCHYGAPAQYDDEVKDDISQVRAYYFEVIMSPFKPYMLKAMDKLDGLTIDQILPSHGPLMRGAAVGEAISLMRKLSAAFVAYVSSYG. 266
177 4.000e-68UniRef50_A0A1T4KWL1 Flavorubredoxin n=3 Tax=Cetobacterium TaxID=180162 RepID=A0A1T4KWL1_9FUSO  ali  17  6LKNNIYWIGTLDPNLRIFDIIMETQYGTTYNSYMVKGSEKIAVFETTKEKYFDGYLKELEERLPPEKIDYIVVDHTEPDHSGSISKLLDYAKNATVVGSHTAIEFLKNIMNKDFKHI---VVKHGDKISLGDKTLEFISAPFLHWPDSMYTYIPEDEVLLCCDSFGSHYSNDKILLSKLDENELKDYRYYYMCIFGPFKKYVLDGIEKIKDLKIDMILPGHGPVLDRNPWD-IVDTYKKWKTIIIPYVTAYG. 267
178 4.000e-68UniRef50_Q8X852 Anaerobic nitric oxide reductase flavorubredoxin homolog n=15 Tax=root TaxID=1 RepID=NORV_ECO57  ali  17  5VKNNIHWVGQRDWEVRFHGTEYKTLRGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRNEIDLADIDYIVINHAEEDHAGALTELMAQIPDTPIYCTANAIDSINGHHHHP-EWNFNVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDAVLFSNDAFGQHYCDEHLFNDEVDQTELFECQRYYANILTPFSRLVTPKITEILNLPVDMIATSHGVVWRDNPVELYLKWAAQEDRITIFYDTM... 261
179 4.000e-68UniRef50_A0A1W9SXU1 MBL fold hydrolase n=7 Tax=root TaxID=1 RepID=A0A1W9SXU1_9DELT  ali  19  5IKNNVTWVGKIDWELRFHGYEYSTHCGSTYNSYLIK-EEKVVLIDTVWGPYSKEFVKNLANEIDLNKIDYIIANHAETDHSGALPELMQHIPETPIYCTKNGIKSLKGQYHQDWNFK---VVKTGDKLSLGNKELIFVEMPMLHWPDSMLCYLTGDEILFSNDAFGHHYASEFMFADVHQGELFTECIKYYANILTPFSSMVIKKINEILNLPLDMICPSHGMIWRDHPIKQYLKWADQENQITIIYDTMWN. 261
180 5.000e-68UniRef50_A0A1B7JTW4 Anaerobic nitric oxide reductase flavorubredoxin n=386 Tax=root TaxID=1 RepID=A0A1B7JTW4_9GAMM  ali  17  5VKNNIQWVGQRDWEVRFHGTEYKTLKGSSYNSYLIC-EEKNVLIDTVDHKFSREFVQNLRAQIDLNDIDYIIINHAEEDHAGALTELMSCIPDTPIYCTANAIDSINGHHHHP-EWNFNIVKTGDTLDIGNNKQLIFVETPMLHWPDSMMTYLTEDAVLFSNDAFGQHYCDERLFNDEVDQNELFECQRYYANILTPFSRLVTPKINEILNLPVDMIATSHGVVWRDNPVELYLKWANQEDRITIFYDTM... 261
181 5.000e-68UniRef50_A0A1C0BVP4 Flavoprotein n=1 Tax=Erysipelotrichaceae bacterium MTC7 TaxID=1768196 RepID=A0A1C0BVP4_9FIRM  ali  18  6ITDDFYWIGVENPDLRRFDIIMETEFGTTYNSYLLKTTEGVVLFETVKDKFFDVYLEKVKELVKLEDIKYIVCNHTEPDHSGSIEKFLELNPNIEILSTIAAQNNLKEIVNGPFNGR---IVKDQEELTIGGRTLRFIMAPNLHWPDTMYTYIVEEEILITCDSFGAHYATEVLLSQVANRENYERAFTYYTNIMGPFKPFVAKAMDKIRDLPIRYIATGHGCLIDQE-VEDFIKRYDDFKKVVIAYVTAYG. 263
182 8.000e-68UniRef50_A0A2L2XAJ2 Beta-lactamase domain protein n=1 Tax=Candidatus Gastranaerophilus sp. (ex Termes propinquus) TaxID=2029980 RepID=A0A2L2XAJ2_9BAC  ali  19  4VKNNIFYCGTKDPDRKLFDQLIPLPDGTSYNSYLIKGSEKTALVDTAYSTRVGEFMECLS---GVSKIDYVIINHAEGDHTDALPLVLERFPDIKIVTNSVCMNILIDAREIDKERFY--VVSDNEELSLGDKTLQFLISPWVHWPDTMFTYAKEDKVLFTTDFLGAHIIEENVYATQSP-EYLASAKRYYAEIMMPFRVHCQKHLKKIEELKPEIIAPSHGGVYNNP--EFILEAYRRWNKAVLAYVSMY.. 252
183 8.000e-68UniRef50_A0A1Y1RZ68 MBL fold metallo-hydrolase n=2 Tax=Marispirochaeta TaxID=1911565 RepID=A0A1Y1RZ68_9SPIO  ali  18  8..DNVYAITVNDRTTDLFEGLWPIQEGVSYNSYLIQDE-KTALIDLTKEFKTDELFDNVGMIKSLKEIDYLVVNHMEPDHTGAMKALNRLNPDITILCTPKARPMIENYYGITE---NVREVSDGEEISLGKKTLKFFHTPFVHWPETMMTYLVEEKILFSCDGFGGYGATGAIFDDQIDLDFYIESLRYYTNIVAKFTKPVLNAIEKLADYPIEIIAPSHGLIWRGNP-GKIVELYQKWEKGVLLYGTMYG. 265
184 8.000e-68UniRef50_A0A1V5DX74 Rubredoxin-oxygen oxidoreductase n=66 Tax=root TaxID=1 RepID=A0A1V5DX74_9DELT  ali  18  10.ISDHVYWVGAIDWTIRDFHGYTTPHGSTYNAYLIM-ADKITLIDTVKAPFKDEMLARIKSVVDPSQIKYIISNHSEMDHSGSLASVIDIIKPEKVFASSAGVRTLQNMFH---DQQGILPVADGETLSLGNMDLTFMETRMIHWPDSMITYLAKDEILFSQDAFGMHFATLERFNDEIPQAALEEAATYYANIVLPYSPIVLKALDKVKAWSLKIIAPDHGPVWRKD-LGRIIELYSKWAKAVIVYATMW.. 263
185 8.000e-68UniRef50_G9YJS4 Nitric oxide reductase family protein n=7 Tax=Bacteria TaxID=2 RepID=G9YJS4_9FIRM  ali  18  5ITDKVTWVGKVDWEVYFHGKEYSTERGSSYNSYLIRD-KKTVLMDTVWAPYGREFVESLKEEIDLNEIDYIVMNHNESDHSGALPFLMEEIPDTPIYCTKKGEAIIRGHYHKDWNFVT---VNTGDTLDLGDSKLVFIEAPMLHWPDTMFTYMTGEEILFSNDGFGQHYASEALYNDRVDQELYHEAMKYYANILNLYSPMVTKKIKEILAMNVKMICPSHGVIWRDNPLQ-IVEKYQQWAAITLIYDTMWN. 261
186 8.000e-68UniRef50_Q9FDN7 Nitric oxide reductase n=61 Tax=cellular organisms TaxID=131567 RepID=FPRA_MOOTA  ali  16  7ITDGIYWVGAVDWNIRYFGPAFSTHRGTTYNAYLIVD-DKTALVDTVYEPFKEELIAKLKQIKDPVKLDYLVVNHTESDHAGAFPAIMELCPDAHVLCTQRAFDSLKAHYSHID--FNYTIVKTGTSVSLGKRSLTFIEAPMLHWPDSMFTYVPEEALLLPNDAFGQHIATSVRFDDQVDAGIMDEAAKYYANILMPFSNLITKKLDEIQKLAIKTIAPSHGIIWRKDP-GRIIEAYARWAEGVIAYDTMW.. 263
187 9.000e-68UniRef50_A0A1J5ECZ4 Uncharacterized protein n=1 Tax=Fibrobacteres bacterium CG2_30_45_31 TaxID=1805149 RepID=A0A1J5ECZ4_9BACT  ali  17  8..SNIFSVGVANPNLRLFDIILHTEFSTTYNAYCVRGTQKIAVIETVHCAKWEEYLENLQSVCDPTAIDYIVMNHTEPDHSGSLIKLLEMAPQAVVVGTTAAIRFLKAICNRDFPNI---VVTDGMTLDLGGKTLKFMVAPNLHWPDSMFTYIPENEVVFTCDFLGAHYCETRSLLSQYPEEYTKAFKAYFDCIFAPFKKFVLAGIQKLEPLKLQFVATSHGPILNKENMAKYREWISTEKTAVIAYVSAYG. 263
188 9.000e-68UniRef50_A0A1P8F6G0 Flavorubredoxin n=1 Tax=Dehalogenimonas formicexedens TaxID=1839801 RepID=A0A1P8F6G0_9CHLR  ali  19  7LAKGVYWVGVVDWSLRFHGHELSTTHGTSYNSYLIIDE-KCVLIDTVPIGFQSPLIENISRIIDPGKIDLIVAAHAEPDHSGALPEIMKRCPSAEVVVSPRGIETFSRHYHQPWNFR---AVKTGDTYSIGQKTLTFIEAPMLHWPDNLFTYLGGDAILFSSDAFGQHYASTGRFDTDVDPDILWETVKYYTNILNPLSPMIARKIDEVLKLALNMIAPSHGIIWKKDPIQKYREWTEQRSCAVIVYDSMW.. 262
189 1.000e-67UniRef50_A0A172UBA0 MBL fold metallo-hydrolase n=61 Tax=Proteobacteria TaxID=1224 RepID=A0A172UBA0_9GAMM  ali  17  18LSERVHWVGAFDPNLRIFDIILKTANGTSYNAYVIRGSEGVAVIDTVKEGFAADFFARLESVADYSEIKVIVLNHLEPDHTGALPELMRRAPQAQLFISQKAQTMLKGLLKQDALSFTPVVT--GDSVSLGDRRLEFLHTPYLHWPDTQCTYAPEERMLFSGDVFGCHFCDKRLFNDRV-GDFRFSFEYYYAHIMRPFKEYVVRALELIEPLPLTLIAPTHGPILRDRP-QHYIQRYRQLKTLLIFYISSYG. 278
190 1.000e-67UniRef50_A0A1C7IBV3 Pyridine nucleotide-disulfide oxidoreductase n=12 Tax=Clostridiales TaxID=186802 RepID=A0A1C7IBV3_9FIRM  ali  16  8..KNFYWTGIVDADLRVFDIIMYTEFGTTYNSYVLKAGDKTVLFETAKVKFWDEYLEKVQEITAVDKIDYLVVSHTEPDHAGSIENLLKLNPGLKIVATGCALGFLKEIVNGDFTGI---AVKDNETMKIGDKNLRFLVVPNLHWPDTMYTYIEEEQILVTCDSFGSHYGFQDVLASVTDKEGYMRAKYYFDCILGPFKPYMLKALKRVRELDVSMICTGHGPVL-DDKIEQMYDIYEEWKTVIIPYVSAYG. 264
191 1.000e-67UniRef50_A0A2G6N4N9 MBL fold metallo-hydrolase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A2G6N4N9_9DELT  ali  17  6IADGIYDVGVIDWNIRDF-HGYSTDRGTSYNAYLIVDE-KVALIDTVKAPFTDQLIGNISQVIDPQKIDVVISNHTEMDHTGALPRIMQAVGDDTLYCSIMGAKNLALHF---PNAWNYHPVKEGEELSLGKRTLQFIETRMIHWPDSMFTYLKEDHILFSSDGFGQHYAGFDKFDDQADNNLMIQAKKYYANILLLYASRILKLMEKISGIQIDIICPDHGVIWRKNPIDAYLKWSRQEKKAVVIYDTMWK. 260
192 1.000e-67UniRef50_A0A1V4SNG8 Anaerobic nitric oxide reductase flavorubredoxin n=1 Tax=Clostridium hungatei TaxID=48256 RepID=A0A1V4SNG8_CLOHU  ali  18  4IKKNIYWCGIRDWGLDVFGHELSTHRGSSYNSYLIKD-KKTVLVDTVWDPYKEKFVEDLEREVGLENIDAIVINHSEPDHGGSLGLIMEKIPNTPIYCTKSGAEIIKKYFGKDWNF---QIVKTGDSLDCGEYKLKFVEMQMIHWPDSMLEYVEGAKLVISNDAFGQHYAGVSLFNDEVDECEYEEAVKYYANILWPFKPLIKKKVEQILNLDIDMIAPSHGVIWRTNPVQ-IVEKYLQWSEATIIYDTMY.. 260
193 2.000e-67UniRef50_A0A1K1LMM0 Flavorubredoxin n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1K1LMM0_9BACT  ali  17  4ITENIYYVGVNDRNKSLFEGLWPLPNGVSYNSYLI-DDEKVCLIDTVEVDFFTQYIERIREVIGDRKVDYLVINHMEPDHSGSIALIKKYYPEIQIIGNKKTFQMLEGFYGI---CDNTVEVANGDSIALGKQTLNFVLTPMVHWPETMVTLCGT--TLFSGDAFGCFGAGGIIDAQINCDTYWLEMERYYSNIVGKYGTPVQNALKKLADVKLDYICATHGPVWH-EYIDKVIAIYDRLSKLVICYGTMYG. 256
194 2.000e-67UniRef50_A0A031WH65 Anaerobic nitric oxide reductase flavorubredoxin (FlRd) (FlavoRb) n=65 Tax=Clostridiales TaxID=186802 RepID=A0A031WH65_CLODI  ali  19  7VKKDIYFTGVVDEGLKVFDIIMETEFGTTYNSYLIKDE-KTVLFDTVKANFKDEFLSNLSEVTDIAKIDYVVIHHTEPDHAGSLKYLLDINPNIEVYCTKAAKLYLDGQINRPF---NCHVIKDGEILNIGKRNLRFITAPFLHWVDTMFTYIEEDKTLLTCDAFGCHFASVDA-EVVNSEDYLKSAKHYYDCIVKPFAKHVLSAVDKVVGLNIETILTSHGPMLTKDPVKRYVEWSTEANQVSIFYLSAY.. 263
195 2.000e-67UniRef50_A0A1F6QS03 Uncharacterized protein n=1 Tax=Candidatus Margulisbacteria bacterium GWF2_35_9 TaxID=1817873 RepID=A0A1F6QS03_9BACT  ali  19  3IKNDVYWTGVLDPNLKKFDIILDTKKGSTYNSYLIKGETKIALVDSAKHGFENTFFSNLKKHLDISQIDYIIVNHTEPDHSAAMAELLDLAPNAIVYASKSAIKFLSAIMNKPFNSV---EVDESTSLDLGGKTLRFFKTPFLHWPDTIFTYLKEDQILFTCDAFGAHYCNKNMFNDLCP-DYTDQAFYYFDMIVRPFKSKVLQAVEKVSGIKIDTICPSHGPILRENPVHNYIKWSQPLRTVLIMYLSAH.. 260
196 2.000e-67UniRef50_A0A1G0W8L4 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium GWF2_38_69 TaxID=1798570 RepID=A0A1G0W8L4_9BACT  ali  19  8..DNVYWVGYVDWDVRDF-HGYSTTRGSTYNSYLIKDKD-VAIIDSVKAPYYKYLLDNIRSLVSFDEVKYVVCNHAEPDHSGSIPILMQECKNAVIVCNDKCKSALSMHY--DTKSWKFMVVDESSTLSLGTCTLKFINTPMAHWPESMATYLPEKKILFSMDGFGQHFASSGRFDFEENITVLHEAKKYYANIVMLYGKQIKSVLDKTSNIEIDIIAPSHGVMWSK-YITEIIERYRRWAKVLIFFDTMWK. 259
197 3.000e-67UniRef50_A0A0B5QVP1 Anaerobic nitric oxide reductase flavorubredoxin n=104 Tax=Bacteria TaxID=2 RepID=A0A0B5QVP1_CLOBE  ali  17  7VTEDLYWIGGNDRRLALFENVHPIPRGVSYNSYLLLDE-KTVLFDTVDWSICRQFLENIKGVLGDRDLDYMVINHMEPDHAACIEEIVIRYPNVKIICTEKAFLFMHQFGFQIEDKVEQ--VKEGDTMSFGKHNVVFVSAPMVHWPEAMVTYDTTNGVLFSADAFGSFGADGKLFNDEVNFDWIDDARRYYTNIVGKYGPHVQALLKKAGTIDIKIICPLHGPVWRND-FGYLLDKYDKWKGVMIVYGTMYG. 264
198 3.000e-67UniRef50_A0A1Q9PA27 Nitric oxide reductase n=3 Tax=Candidatus Thorarchaeota TaxID=1706441 RepID=A0A1Q9PA27_9ARCH  ali  20  5ITKGIYFIGVDDHHTELFENLWSIPFGVSYNSYLIVDE-KIALVETVKGPWSEEWLNNIRELVDPEKIDYIILNHMEPDHTSSLPDIAALAPNATLVYTPKAAPMQKSFYDVPLQEK---LVEDLEELKLGSKTLKFVHAPFLHWPETMMTYVVEDEVLLSCDAFGSFGANGKHFDDEIDLRIEFESRRYVSAIITSYFKFVQRALAKVKELGIKVIAPSHGPIYRSDPVGKYDEWTRELEKYTIVFGTMYG. 261
199 3.000e-67UniRef50_A8ABR1 Beta-lactamase domain protein n=2 Tax=Ignicoccus TaxID=54258 RepID=A8ABR1_IGNH4  ali  14  16VTEDLYVLRVDDRYTKYFEALWEIPEGITYNAYLLKTDEGDVLFDAWKRQFSSHLMEALERVTSPDRLKYVVVHHMEPDHTGSLEDVLRWAPNAKVLGHPLAGRMMNAY---PKAKERFKPVKDGEVLEVGGKKLRFVHTPWLHWPETMMTWLEEEGVLLTCDAFGGYGIPLSLFDDVKLEEMIREMRKYVVTVIGHYREWIDRNIAKLEKLKPNVVAPAHGLIWRKN-VDRVFQVYKKENKVLLVYASMYG. 274
200 4.000e-67UniRef50_B0VJL8 Nitric oxide reductase (Type A flavoprotein) (FMN-protein) (Flavoprotein A) n=47 Tax=Bacteria TaxID=2 RepID=B0VJL8_CLOAI  ali  18  23LKEGVYWVGVIDWDLRNF-HGYITQRGSTYNAYLIIDE-KVTLIDNVKSFLFEEMLSRISDIIDPSKIDVLIQNHTEMDHSGGLPELIKYLPDTAIYTNANGIKALKRHFKQDWNFN---EIKSGDSIKIGKRTLAFLTTPMVHWPDNQFTYCPEEKILFSNDGFGQHIASNERFAKELPAGIMEEAKKYYANIVLPYSKQVKKVLEEAGKWDINMICPSHGVIWTAENIPEILSAYHNWAKALIIYDTMWK. 277
201 4.000e-67UniRef50_I7L5A2 Flavoprotein n=15 Tax=Terrabacteria group TaxID=1783272 RepID=I7L5A2_9LACT  ali  17  7IKPDIIWVGGNDRRVNRFENLFPLTHGMSYNAYVILDE-KTVLTDTVDRSISVLFMENVKAALNGRNLDYLVIHHMEPDHCANIEAIVQAYPNIQLIGNRNTYKFLTQFYPAFTFDNFITVKEGEEL-NIGKRTLRFYMTPNVHWPEVMMFYEVSEGLLFSADAFGSFATDGNLFSDEIYFPEGDESRRYYVNIVGKFGSHVLKALKKFSELNITTILPLHGPIYRTEHIGLILDAYQNWKSTLILYASMYG. 267
202 6.000e-67UniRef50_A0A1Q6UGQ7 MBL fold metallo-hydrolase n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A1Q6UGQ7_9PROT  ali  16  6IKKDIYWVGVKDWNLREF-HGYATPHGSTYNSYLIMDE-KITLVDGVKSYMSQEMTERVKSVVDFSQISYVVVNHVEMDHSGNIPEIMKLAPQAVIITDNAGKMALEAHF--DTAGWNYKLVTTGESVSIGKRSLTFMTTPMLHWPDSMMTYVKEEKLLLSNDGFGQHLASDGLFVNEQPLDVVNEAKSYYANILFPYGAQAEKALNTALGLDIEMIAPSHGCIWSGDEVNTILGLYAKWAKAVVVYDSMWG. 263
203 7.000e-67UniRef50_A0A1F9WWZ1 MBL fold metallo-hydrolase (Fragment) n=1 Tax=Elusimicrobia bacterium RIFOXYA2_FULL_40_6 TaxID=1797958 RepID=A0A1F9WWZ1_9BACT  ali  17  6VADGLFWVGAVDWNVRFHGHTYNTQRGTTYNAYLVMDEGKVALVDTVHEPFANEMIENIRELVPLGKIDYIVMNHVERDHSGALPAIHKLCPKAQVLGTEKCKEGLYKNYYGDWEFK---VVKSGDKLSLGKKTLTFIEAPMIHWPDSMFTYMVEDQILLPNDAFGQHYATSERFDDEVDQFLMDEAAKYYANIIWPLSQIVLRKIEEVAGVPIKMIAPSHGIIWRKDPVNQYISWAKNEKKVVIVYETMW.. 263
204 8.000e-67UniRef50_A0A1V6I3X4 Nitric oxide reductase n=14 Tax=cellular organisms TaxID=131567 RepID=A0A1V6I3X4_9BACT  ali  14  6.KENLYLLDVVDWNRRLFDALIPLPDGTSYNAYFIEASEKNVLIDTAEPELAHIFFEKLE---GIKKIDYVVSLHSEQDHSGLLPEVLKKYPNAKLICSPKAKPTLSDHMPIAEDRFIT--VEDGEEISLGNKTLKFIHFPWVHWPETMLAYLKEDKVLFTCDFLGSHLATTDIFV-SNECEVYEAAKRYFAEIMLPFRNIINKNLPKLDEYDIEIVAPSHGPMYDNPKIDAYKEWLSDTPKVIIPYVSMHG. 254
205 8.000e-67UniRef50_A0A1Y4S6B7 MBL fold hydrolase n=2 Tax=Flavonifractor TaxID=946234 RepID=A0A1Y4S6B7_9FIRM  ali  16  6LKDGIWSVGVLNPSLRVFDIVMEAKYGTSYNAYLV-TGEKNVLIETVHADYFEEYLDNIRQVIPVEQVDYLIMNHNEPDHSGSVAKLLELVPDLKIVATAAGKKHLEDITNRTLP---IQVVKAGDKLDIGGKELEFIPAPMLHWADSMFTWDAADKTAFTCDFLGAHFCEPTMLDRNDKAAYEGEFAYYYAGIFGPFKSAVLAGLDKLPA-EAEMVCPSHGPVLTDTLADR-RDLYRAWKLAAVIYASAYG. 261
206 9.000e-67UniRef50_A6TNV5 Flavodoxin/nitric oxide synthase n=1 Tax=Alkaliphilus metalliredigens (strain QYMF) TaxID=293826 RepID=A6TNV5_ALKMQ  ali  19  6IKKGVYWVGAVDWDIRFHGPSYHTQKGTTYNAYLVIDE-KVTLIDLVDLHFVDDMINNIKEIIDPSLIDYVVVNHVEPDHSGAFPKLMEYIPEAKVFCTKNGKEGMLHYY---FGDYNYETVKTGDKLNIGEKTLEFIEAPMLHWPDSMFTYIKEVALLMPNDAFGQHLASSHRFDDENDLCEMEEAKKYYANILMPFNPLVLKKIQEIQKLEFDMIAPSHGIIWRTDPVEKYLSWSQNERKAVVVYDTMWN. 262
207 1.000e-66UniRef50_A0A1D3TS69 Flavorubredoxin n=2 Tax=Anaerobium acetethylicum TaxID=1619234 RepID=A0A1D3TS69_9FIRM  ali  15  7....VTYVGMQNPAMRVFDIIMKTEYGTSYNSFLVQ-GKKTALIETAHRRFTKEYIETIENYIPVKDIEYVVVNHTEPDHSGSLEKILEINPDIQVYGSAAAIKNL--GFIMNRTFKGNVVKNGDQLDLGDGTVLEFIIAPNLHWPDSMFTYLKQDKVLFSCDFLGSHYCEPLVLDRSIKYPEEYEIARYYDCIFGPFKKFVLAGLDKIKDLEINMACTSHGPML-QERLQETMDLYREWKNIAIFYVSAYG. 259
208 1.000e-66UniRef50_A0A1H5TBA8 Flavorubredoxin n=9 Tax=Prevotellaceae TaxID=171552 RepID=A0A1H5TBA8_PRERU  ali  16  4IINKIYYVGVNDRNKNLFEGLWPLPNGVSYNSYLI-DDEKVCLIDTVEVDFFVQFLENIHEVIGDRKIDYLVINHMEPDHSGSLALIRKYYPEIQIIGNKKTFQMAEGFYGVIDG---LLEVKNGDTLELGSHTLNFVMTPMVHWPETMVTLESVSHVLFSGDAFGCFGAGGVVDSQINTDTFWLEMVRYYSNIVGKYGTPVQNALKKLEGIQLDYLCATHGPVWH-EYVEKVISKYETEPGLVICYGTMYG. 258
209 1.000e-66UniRef50_A0A1G8TP09 Flavorubredoxin n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1G8TP09_9FIRM  ali  16  3VTNDIKYVGVNDHAIDLFEGQYDVPNGMAYNSYVIMDE-KIAVMDTVDKNFTHEWLDNLANALNGRKPDYLVVQHMEPDHSANIVNFAKNYPDATIVSSSKAFTMMKNFFGQEFEDRRIEVKEGDTL-SLGKHTLNFVAAPMVHWPEVIMTYDSCDKVLFSADGFGKFGA------LDVEEDWACEARRYYFGIVGKYGAQVQAVLKKAAGLDIQIICPLHGPVL-SENLGYYLNLYNIWDGIVIAYTSVYG. 252
210 1.000e-66UniRef50_A0A174R2D1 H(2)O-forming NADH oxidase n=10 Tax=cellular organisms TaxID=131567 RepID=A0A174R2D1_9FIRM  ali  17  7LKNDVYWLGVLDPNLDVFDIIMETKYGTTYNSYLVNTTEGAILVETVKEKFFDSYLQKIEEAIDLSQIKYIITNHTEPDHAGSIGRLVKLIPGLTVIGSKTAITYLKDILNINFNYLTADSLK---TFTLGEKTFDFIPAPFLHWPDSMYTYLSSDNVLFTCDSFGSHYSPKHGIKLSEVPASEEEALYYYTAIFSPFKPYVIKAINKINDLKLDMVCTGHGPVLDTR-IDEIIETYRNWKKVVMPYVSAYG. 269
211 2.000e-66UniRef50_A0A256YL85 MBL fold metallo-hydrolase n=2 Tax=Desulfurococcales TaxID=114380 RepID=A0A256YL85_9CREN  ali  18  11..DNLYLLRLDDDQIKYFESLWYIPEGITYNAYLLDTGDGAVLFDTWRKNYSELFVEELKKIIDPRDIKYLIVHHMEPDHSGAIKELVELNPEIIVYGHQFTKRLINSFYNVDPKFKSI---DDGEVLEFNGYRIKFIHTPWIHWPETMFSYLENYKVLFTCDGFGSYGIFDAIYVDENIGEYMWYMKKYLADIVGHYIDWVVKALEKLLKLNIELIAPSHGLIWRGEAISKYLEWIRGSDRIVVIYSSMYGF 267
212 2.000e-66UniRef50_A0A1V4TKJ1 Type A flavoprotein FprA n=3 Tax=Methanomassiliicoccales TaxID=1235850 RepID=A0A1V4TKJ1_9EURY  ali  17  6IADGIYWVGALDWNAREF-HGFATLRGTSYNSYLILDE-RNVLIDCVKTPFLGEMMARIRSVIDPKEIDLIVSNHAEGDHASGLP-LTQQITGAEILATKKGLEALR----LNYGEMRMREVADGEELSIGRRTLRFIETPMVHWPESMFTYAVEDQILFSMDAFGQHYCSSQRYDDQVDLTLMEEAATYYANIVLPFGAQVKKAYAKVKELPIKLLATSHGLMWRKDIVEAYVGWARTEERVLVIFDTMWG. 256
213 2.000e-66UniRef50_A0A1V2M9B1 Flavoprotein n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1V2M9B1_9FIRM  ali  17  4ITENLFAVGVKDPELRVFDIIMATEFGTTYNSYLLKGKNEFVLFETVKNEFFDKFLAHLKEAIDINDIKYLVVDHTEPDHSGSISRLLELLPDITVISSVIAKKYLEAITNTTF---RHIVAKDDSSLKLGSHTLTFKSVPQLHWPDTIYTYIEEDKALITCDSFGAHYSSDKNFTEDEIADFNQAYKYYYDMIMGPFKPFVLKALDKIANLDIKIVAPGHGLIFNDKNFEYYKELYRKWSSVLIGYVSAYG. 270
214 3.000e-66UniRef50_UPI000C068F4F FprA family A-type flavoprotein n=1 Tax=Anaerococcus sp. Marseille-P3625 TaxID=1977277 RepID=UPI000C068F4F  ali  18  7ITDNVFYVGVNDRRIDRFENMFPLTKGVAYNSYLIKD-KKNVLLDSVEAAFTRAYLENIEKALDGEDLDYLVVHHMEPDHCRNIDFVLNKYPNAKFVGNAKTFKFYEQFYNDAFKDRYYEVKEGDEI-DLGKHKLKFVFAPMVHWPEVMMSYESTDKLLFTADAFGAFNTIDGHLNIIHRGNWLDEARRYYVNIVGKFGNQVQALFKKVHDLEVNAILPLHGPVYDDDSIDFIMEKYNKWKGVVIVFASMYG. 267
215 4.000e-66UniRef50_A0A2N3GA54 MBL fold metallo-hydrolase n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-10 TaxID=2013645 RepID=A0A2N3GA54_9ACTN  ali  19  8.VSDRVTWVGAIDWNLRDFHGYETPRGTSYNAYLVRGDDKTALVDTVKLPFVDELLSRISDTMDPASIDLIVVNHVEPDHNSGLRKVMEAMPNARVVASRGGVAGVAEYH----DGLAVESVGAEDEIDLGGISLKFLPMPMVHWPDSMFTYVAGDKTLLPNDAFGQHMASAERFADEVGLDALRELDIYYANILMPLGTQVSKAVAKVLDWEIDTIAPSHGVIWRGDTLAKAIELYETLDKVVVAFSTMWG. 263
216 4.000e-66UniRef50_A0A2H0ZBD2 MBL fold hydrolase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H0ZBD2_9BACT  ali  16  6IAKNVYSMPVNHFNRKLFDSLIPLPDGTSYNSYLVKGSKYTVLLDTADPEKKEQFFDYLS---GEKKIDYVVAHHAEQDHSGLIPAALEKYPLARVLTNAKCKELLMTHLHVKEDRF--QVINDGDKFDAGGKTLEFVFTPWVHWPETFSTYLAEDKILFSCDFFGSHLATPELYA--VPELVHEPMKRYYAEIMMPFRANIKNNLEKLSGYDIKMICPSHGPMHKD--VEFAVNRYKDWNKALVLYVSMHG. 254
217 5.000e-66UniRef50_D4J0L2 Uncharacterized flavoproteins n=3 Tax=root TaxID=1 RepID=D4J0L2_BUTFI  ali  13  3ISDSIKYIGCNDKTIDLFESQYPVPNGVSYNSYIILDE-KVAVMDTADPRVTDEWLANLERELAGRKPDYLVVSHMEPDHAGSIKVFLEKYPETTVVGNAKTFPMMGQFMDATLFENRKQVVAEGDTLSLGSHELTFVMAPMVHWPEVMVEYESSEKILFSADGFGKFGA------LDIDEPWIDEARRYYLNIVGKYGVQVQALLKKAAALDIKTICPLHGPILT-ENLGYYIDLYDKWDGVLIVSASIHG. 253
218 6.000e-66UniRef50_A0A1Y4BX22 MBL fold hydrolase n=5 Tax=Clostridiales TaxID=186802 RepID=A0A1Y4BX22_9FIRM  ali  15  6LKENLWSVGVLNPSLRVFDIVMESKYGTSYNAYLL-TGEKNVLIETVHTDYFEEYLDNIRQVIPVEDVDYLIMNHNEPDHSGSVAKLLAVCPKLQVLATKAGKKHLEDITNLSLPCR---VVGAGDTLDLGDRVLEFIPAPMLHWADSMFTWDPKDKTLFTCDFLGCHFCEPTMLDKHIHAAYEGEFAYYYNGIFGPFKPHVLSGLDKMPA-EADLVCPSHGPCLT-ETIGKAKELYRAWRTAFVVYASAYG. 261
219 6.000e-66UniRef50_A0A1T4NP69 Flavorubredoxin n=1 Tax=Cetobacterium ceti TaxID=180163 RepID=A0A1T4NP69_9FUSO  ali  18  7VTPNVKWVGIVDDARKFHGEELSVNHGSSYNSYLIR-EDKIVLIDGVKATFSREWIEKLKEEIDLNRIDYLILNHCEPDHSGSIPDLVDEIPNVPIYCTQKAREILEAYYG--KRDWNFNIVKSGDNLSIGNKNLVFLEMKMLHWPDSMLTYLLEDQILFSNDAFGEHYGANELFDDMVDEDILYECLKYYACILSPFSKLIKLKLQEIEKLKFKIICPSHGVIWRKNPNG-IVEKYRKWCEGLIVYDTMWN. 264
220 7.000e-66UniRef50_A0A0B0EJ94 Putative flavoprotein n=2 Tax=Candidatus Scalindua TaxID=236756 RepID=A0A0B0EJ94_9BACT  ali  18  7ITEDVYWIGSVDPGLVVFDIVIPTKHGTTYNSYLVR-GEKIAVIDTVKSYCVDDFISKIRSLVRPEDIDYIIINHTEPDHSGGLIRLMELAPKAIPVFSRSARTFVKNILHKEFDYK---EVKTGDSIDLGGKVLKFISAPFLHWPDTMFTYLETDKILFPCDAFGSHYCSDKRFNDELDEDAFTAYEFYYDTILRPFKKHVIDALDNIKDIDIDIIAPSHGPILR-ENISKYIDAYREWAKIAIIYVSSYG. 265
221 8.000e-66UniRef50_D9Q0V0 Beta-lactamase domain-containing protein n=4 Tax=Acidilobales TaxID=871006 RepID=D9Q0V0_ACIS3  ali  19  12VVDGVYWVGVNDTRKVRFENMWPIPEGISYNAYVIGTGGGYVLVDGVEEEYTDLYLAKLSKVVDDDKVKYIVVNHLEPDHQGSLEETLRRARNAKVLISAVGARMIRDFYDVPEDRVV--PVKDGDRLEVDGKILRFIYTPWLHWPETMVTLDETDSVLFTCDVFGSYVARGGLFDDQLEMEHYEEAKRYYVNIVGRYTKNTIDALNKLSALDVKVIAPAHGPLYRGDPVKLYYDWARLEPEVSILYISMYG. 271
222 1.000e-65UniRef50_A0A1Q2MGL9 Nitric oxide reductase n=25 Tax=cellular organisms TaxID=131567 RepID=A0A1Q2MGL9_9BACT  ali  16  6IAKGIKVISTVHWERRLFDSLIPLPDGTSYNAYLIQGSKGTALVDTTDPELKHELLDQLESV---EHIDYLVTQHSEQDHSGTIPDVLARYPKAKLVCSSKAKDLV--LTHLDVAPERIRVVEDGEEISLGDKTLQFVYTPWVHWPETMCTYIPQDKCLLSCDFFGSHVATSDMYVTNKEL-VYEAAKRYFAEIMMPFRNMIRRNLDKLSGLEIDVIAPSHGPVYNEP--DFIVDAYKDWNEVVLPYITMHG. 255
223 1.000e-65UniRef50_D1Y7M3 Metallo-beta-lactamase domain protein n=3 Tax=Synergistaceae TaxID=649777 RepID=D1Y7M3_9BACT  ali  15  7VSDKIWWVGVNDRKTPLFENLWSLPYGVSYNSYLIDDG-KVALIDGVKAEFFGEYLERIQSIIGGRPVDYLIVNHVEPDHSSAIRMLRQVYPDITVVADKQALALIGQFYGPSMSAK---EVKDGETLPLGAHSLTFATIPMVHWPETMISFENSSGIAFTCDAFGGYGANGSIFGDELDMRVYDEARRYYATIVARFSVNVQAALKKAAALPIRMICPSHGPIHRGDGVEKIVRLYDGMQSATIVYGSMYG. 262
224 1.000e-65UniRef50_A0A2K9P4B2 Metallo-beta-lactamase/Flavodoxindomain n=4 Tax=Clostridiales TaxID=186802 RepID=A0A2K9P4B2_9FIRM  ali  16  8VSDSIKYIGVNDYDLDLFEGQYIIPNGVAYNSYVILD-DKITIMDTVDRRACGEWLNNLKEILGEKTPDYLVVQHMEPDHAASINILADLYPDMKIVGNQKTFGMINQFFDLDLGDGRKVIVSEGDKLELGNHCLNFVMAPMVHWPEVMLSYESTEKILFSADAFGKFGT------LDTDEEWDCEARRYYFNIVGKYGAQVQTVLKKASSLDIKTICPLHGPIL-NENLDHYISLYDTWDKGVIAYASIYG. 258
225 1.000e-65UniRef50_A0A1B7WMD9 Diflavin flavoprotein A (Fragment) n=1 Tax=Anabaena sp. CRKS33 TaxID=1710888 RepID=A0A1B7WMD9_9NOST  ali  15  19ISENTTAIRSLDWDRDRFDIEFGLQNGTTYNSFLIR-GEKIALVDTSHEKFRQLYFDTLTGLINPQDIDYLIVSHTEPDHSGLVKDLLQLAPHITVVASKVAIQFLEDLVHQP--FKRKIVKNGDRLELGNGHELEFVIAPNLHWPDTIFTFDHKTQILYTCDAFGLHYCSESTFDDDL-AAIEADFKYYYDCLMGPNARSVLSAMKRMAELNIRIIATGHGPLL-YHNVEELTSRYRHWSQGQIFYVSEYGF 275
226 1.000e-65UniRef50_A0A258TNZ1 MBL fold metallo-hydrolase n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A258TNZ1_9PROT  ali  17  8IAPGVHWIGALDPQLRIFDVILKTANGTTYNAYCVRGETGVAIIDTVKAEFADTFFEHLEQVARYDEITAIVLNHLEPDHTGALPELMRRAPNARLYISVKAQTMLKGLLKSEDLE--YTPVNTGDTVDLGGRTLTFLNTPFLHWPDTQCTYLNEEAMLFSGDVFGCHFCDSRLFNDRV-GDFRFSFEYYYQHIMRPFREHVRAGLDLIEPLELSLIAPAHGPILRDAP-RSYVQRYRQLKTLLIFYISSYG. 268
227 2.000e-65UniRef50_A0A1J0GC87 MBL fold metallo-hydrolase n=8 Tax=Clostridiales TaxID=186802 RepID=A0A1J0GC87_9CLOT  ali  16  7ITEDLYWVGGSDRRLALFENIHPIPRGVSYNSYLLID-KKTVLFDTVDWSICRQFIENIQSVLKGKPLDYLVINHMEPDHAACIEEIILRYPNVKIVCNHKAFLFMHQFGFHIDENVI--EVNEGDTMSFGKHIVTFVAAPMVHWPEAMVTFDTTNGVLFSADAFGSFGSDGQLFNDEVNFDWIDDARRYYTNIVGKYGPHVQDLLRKAGTIDIKIICPLHGPVWRND-LGYFLGKYDKWKGVMIVYGTMYG. 264
228 2.000e-65UniRef50_A0A1C5UJH8 Diflavin flavoprotein A 1 n=106 Tax=Firmicutes TaxID=1239 RepID=A0A1C5UJH8_9FIRM  ali  15  3ITDSIKYVGVNDHQVDLFEGQYAVPNGMAYNSYVILD-DKIAVMDTVDANFTHEWLDHLQQVLNNRKPDYLIVQHMEPDHAANVANFLKVYPDTTVVANAKTFTMIKNFFDLDLDGQKLEVKNGGTL-CLGSHNLTFVFAPMVHWPEVMVTYDSTDKVLFSADGFGKFGA------LDVDEDWDDEARRYFIGIVGKYGPQVQSLLKVAATLDIQVICPLHGPVLSQD-LGHYISLYDKWEGIVIAYTSVYG. 252
229 3.000e-65UniRef50_A1RXI0 Beta-lactamase domain protein n=5 Tax=Thermofilum TaxID=2268 RepID=A1RXI0_THEPD  ali  18  9VVDDLYVLRVDDDRTRFFEALWEIEEGITYNAYLLLTGEGAVVFDGWKKWFSELFLEKIREIVDYGDIRYVVVHHAEPDHSGSVPDVLRVSEKAVALGHPIAGRMLSSFYGVT----RFRPVKDGEELKVGERSIHFVYTPWLHWPETIMSYLRDDGVLLSCDAFGSYSVPALYDESVENFEKLAWFIKYYVTVIGHYSPHVLKALEKLGSLKPRIIAPSHGTIFRRNA-ERILDEYRRIAKAVVVYVSMYGF 266
230 3.000e-65UniRef50_A0A1G9WR13 Flavorubredoxin n=2 Tax=Veillonellaceae TaxID=31977 RepID=A0A1G9WR13_9FIRM  ali  18  7IKNGIYWMGCNDFRTEMFEHIFPLPFGISYNSYFI-DDEKTAVLDAMDKSVRDEFLEDIEYLLKGRTLDYFFLNHMEPDHAGSILALVEKYPNVKIIGQAQTFKLFEQFYRHPMPNNYVAVKEGDQIKL-GKHVIQMIKAPMVHWPEVMLAYDVTDKVLFSVDAFGMFGTSGNVYADQVDFDYMDEFRRYYVNIVGKYGPQVVNVLKKMDGLPIEVVAPVHGLVFRTPEIHKYLHWAKYVPEVVIAFASIYG. 266
231 3.000e-65UniRef50_A0A2P6WEU7 MBL fold hydrolase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2P6WEU7_9BACT  ali  15  6IVNGVSAIVAIDWDRRFFDELIPLPKGTTYNSYIVRGSEKIALIDTMYPARTDEYIASLKS-LKLPRIDYVIANHGEQDHSGSIPAVLALYPEARVVTNKVCRQLITHALDVPADSF--LIVGEGDTISLGDRTLRFLITPWVHWPDTMITHLVEDNLLFTCDLFGAHFASTDLFA-IDKGRVLEAARSYYAEIMMPFRPYVAKYMDMIDKIAPRMICPSHGPIHNRPAV--ILDPYRQWPEVVIPHVSMYN. 257
232 3.000e-65UniRef50_A0A2H5XP20 Flavo-diiron protein FprA1 n=1 Tax=bacterium HR19 TaxID=2035414 RepID=A0A2H5XP20_9BACT  ali  55  15......LYSDENHKFIWLGWSYKGAGEVQANQYLIISGREAVLLDPGGVHVFPFIITNISRYISLEQIRYIFYSHQDPDVSSGIGIFMNVCPNAKILISRLWIRFLPHFGAADTSGVE-AIQDSGKTIDLPFSRLHIIPAHFLHSEGNFSLYDSRSKILFSGDIGASVIPENDTYFEVEDFEKHVKYMEWFHKRYMKSNKVLRKWVSMVRKYEVDIIAPQHGAIFRGENVKRFLSWLENLKCGDDILDEIYG. 259
233 3.000e-65UniRef50_A0A174WB42 Flavoprotein n=16 Tax=Bacteria TaxID=2 RepID=A0A174WB42_9FIRM  ali  18  8..EGIWSVGILNPALRVFDIVMESKYGTSYNAYLL-TGEKNVLIETVHLDYWDEFVSNVEEVLPLEQVDYLIMNHTEPDHSGSVARLLERCPNLTVLCTTSAKKFLTAIANRALPCR---VVKDGDTLDLGNKVLHFLTAPLLHWPDSMFTWDPADRTLFTCDFLGAHFCEPTMKDPVYRNAYEGELRYYFDCIFGPFKPSVLAGLDKMPA-EAELVCPSHGPVLT-ETLAHAKERYRAWPTAAVLYCSAYG. 263
234 3.000e-65UniRef50_X1H5Y7 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1H5Y7_9ZZZZ  ali  17  6IKPDVYWIGVNDRTTDLFEGLWPTKEGVSYNSYLIDDEKKAI-IDLTKSFKGDEYLDQIDEVTDISQVDFVVINHMEPDHSGLIRTLRRIAPRVTFLGSAKTKDMLESFFSI---KENVRVVNDGDTLSLGKRTLKFFSTPFLHWPETMMTYEVSHRILFPCDAFGGYGAGAIFDDECKDFDFYKEALRYYVNIVASFSARVLGAIEKLADLPIDIIAPSHGLIWRKNP-SLIVNLYKNWAEITLIYGSMYGF 266
235 4.000e-65UniRef50_A0A1Q6ULT5 Uncharacterized protein n=3 Tax=unclassified Verrucomicrobia (miscellaneous) TaxID=417295 RepID=A0A1Q6ULT5_9BACT  ali  15  4IAPGVFYCGLHDRNRKLFDQLVPLPQGTTYNSYLVEGAEKRALIDTMYEKLLGPYCDMI--AARGAKIDYIVSNHAEPDHSGAIPTLLKTYPEAVVLCSPKCAENLVNMLGVDPSRIR--AVADGEEVSLGGRTLKFIMAPWVHWPDTMFTHMVEDNFLFSCDYFGAHYTDNELFADCSE-NLAEAAKRYYSEIMMPFRGFCAKYLGLARAMNPKMILPSHGPVYDRP--EFIMNLYAEWRKVVMPYVSMY.. 253
236 4.000e-65UniRef50_A0A292RDN4 MBL fold hydrolase n=1 Tax=Candidatus Gastranaerophilales bacterium HUM_9 TaxID=1916320 RepID=A0A292RDN4_9BACT  ali  18  6IKNNIFYCGLNDADRVFFDELIPLDHGTSYNSYLIIGSEKTAIIDTMYPPKTEEYIKNLEKN-NVTKIDYIIANHGEQDHSGSIPALLEKYPNAIVITNPTCKKNLISMLNVPEEKIQTIATN--EELSLGDKTLRFIFAPNVHWPDTMFTYVVEDNILFTCDFLGSHYTFDDVFAVPSD-ELVKSAKKYYAEIMMPFRVMCKKYTQMIKDMNVDMILPSHGPVYKDPNLDLYTDWSSDLGKNLVLYVSMYG. 257
237 4.000e-65UniRef50_A0A1I0MQI3 Flavorubredoxin n=1 Tax=Ruminococcaceae bacterium KH2T8 TaxID=1855400 RepID=A0A1I0MQI3_9FIRM  ali  18  7ITDSIIYVGANDRRADIFEGTYPIPDGMAYNSYLIKDE-KTVLMDTVDKSVADIFYANVKAALDGRDLNYVVVQHMEPDHSATLEGLLIRYPDAKVITNAKTVPMIKQFFDFDIDSRVEIVKEGD-VFSTGSHELTFVMAPMVHWPEVMLTYDKTQKVLFSADAFGSFGANGNIFMDPAEYVLYDEARRYYANIVGKYGAQVAAVLTKAAALDIDIIAPLHGYVW-KDGKEQILGSYKIWDGVAVIYGSIYG. 264
238 4.000e-65UniRef50_A0A1I1H8E0 Flavorubredoxin n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1I1H8E0_9RHOB  ali  15  26VADRVSWIGAFDPHLRSFDIILRTANGTTYNAYAVRGSDGVAIVDTVKQEFTETFLRNLESVASYDEITTLVLNHLEPDHTGAVPELLRRAPHLNICVSPRGVQVLRALLKDRFEDYSVTVVRTGDTVSLGDRTLRFLTTPYVHWPDTQCTYLEEQDLLFTCDLLGCHFCDERLFNDQV-GDFRFSFEYYFDHIMRPFKGYVVEALDLIEPLEIEMIAPGHGPILRAHP-REYIAHYRRLEVGLIFYLSAYG. 287
239 5.000e-65UniRef50_A0A1B3WTG0 MBL fold metallo-hydrolase n=6 Tax=Bacteria TaxID=2 RepID=A0A1B3WTG0_9CHLR  ali  17  6IRPNVYWAGVNDRTSELFEGLWSIRDGVSINSYVILDEKK-VLIDCSCEICTEPYVQMIESLVPLKEIDYVVLNHLEPDHTGALMYLRQANPDITYIGTKKAAEIIANFYEI---RDHFQIVGDGEELRLGEFTLKFAAIPFVHWPETMATYLVEEKILFPCDAFGGYGAPGTVFDDECSQVEKFEQLRYYSNIVAGFSANTKKAIEKLSGYPIEVVAPSHGLVWRKRP-ERIVELYKKWKAVTLVYATMYG. 265
240 5.000e-65UniRef50_H3NPT7 Uncharacterized protein n=1 Tax=Helcococcus kunzii ATCC 51366 TaxID=883114 RepID=H3NPT7_9FIRM  ali  17  7IADDTWYIGVNDNQTSRFEKLHSLPEGVTYNSYLILDE-KTCLLDTVDWPFAEQFIENIDFLLKDRDLDVVIVNHMEPDHAGALGEIMFRYPNAHFYMTAKAVDFCRNFGFPIDSVKYTEVKENAEL-NLGKHTLKFIEAPMVHWPEVMFTYDETNQILYSADAFGTFGLDGRLFDDEYEAEFMAHARRYYSNIVGKYGRPVLNALAKLDNIKVSMIAPLHGPLLRKN-ISLMIDRYKTWKGVLIVYGSMYG. 265
241 6.000e-65UniRef50_A0A255I5V9 Flavodoxin n=2 Tax=Lachnospiraceae TaxID=186803 RepID=A0A255I5V9_9FIRM  ali  16  4ITESILYVGCNDKDLDLFEGQYSVPNGISYNSYVILDE-KVAVMDTADKRVTDEWMRQLEEALNGRVVDFLIVSHMEPDHAANIKTIVERYPNLKIVGNAKTFNLISQFFDIDISKRKIEVKESDTL-NLGNHTLQFFMAPMVHWPEVMVTYEQSEKILFSADAFGKFG------VLNIEDNWIEEARRYYFNIVGKYGAPVQTLLKKAANLEIAMICPLHGPVL-KEGLEYYLDKYNTWSKILVAYASIYG. 253
242 7.000e-65UniRef50_A0A0U1L2U2 Alkyldihydroxyacetonephosphate synthase n=1 Tax=Sporomusa sp. An4 TaxID=411922 RepID=A0A0U1L2U2_9FIRM  ali  15  37IKKDVYWIGGNDFSTERFENMLPLPNGVSYNSYLILDE-KTAIIDSVDASIRVQFLTNAKYLLQNRKLDYLVINHMEPDHCAALVDLVEMYPDVKIVGNAKIFTFFEQFYGKPCPDNYVTV-GEGDVIDLGRHKLQSFKAPMVHWPEVTVTFEQTEKLLFSADAFGTFGTNGNIFADEVDYEYLADARRYYSNIVGKFGPQVQLALKKLLPLGIEMIAPLHGPIYRTPEIQYIVGKYNAW............. 278
243 7.000e-65UniRef50_A0A126QV22 Metallo-beta-lactamase family protein/flavodoxin n=1 Tax=methanogenic archaeon mixed culture ISO4-G1 TaxID=1452364 RepID=A0A126QV  ali  19  11IRDDIFWIGGDDRTASLFERSMPIPEGVSYNSYVILDE-KTCLLDTCDISVAPKFWKNFRNVIGDRKLDYLVIDHMEPDHGAAIMQILEAYPEVTVIGNTKTFDMMENFYHMRP--KNVLVVENGQELCLGKHTLRFYLAVMVHWPEVMFTYDVGCSTLFSADAFGTFKASGAIYADEVDFDYLSEARRYYANMVGRFGSKIQKVFEKLEGVQIDMICPLHGPIWRGESIGYIMEKYILWKGVLIAYASMYG. 269
244 8.000e-65UniRef50_A0A1G6XQ64 Flavorubredoxin n=1 Tax=Peptococcus niger TaxID=2741 RepID=A0A1G6XQ64_PEPNI  ali  17  4LKDNLYSVGVQNPTLRVFDIIMATKFGTTYGSYLVLGDEKKALIDGSHSGFEHIWFDHIEEITPLDSIDYLVINHTEPDHSYAVAAFLDKNPKVTIIGSVAAINNLK---VITNRDFNSQVVKGEDTLDLGGRRLVFKTTPNVHWPDTMITYCPELKALFPCDFLGSHFCEERLETCVKKELYDIEFENYYRSIMGPFPAAVRNALAYVETLDVDVVCPSHGPTYGTAYLKEALEKYRQWKSVAIFYVSAYGF 264
245 8.000e-65UniRef50_E6W363 Flavodoxin/nitric oxide synthase n=5 Tax=Bacteria TaxID=2 RepID=E6W363_DESIS  ali  17  8...SVQWVGVKDPELEIFDIVVPTEHGTTYNSYLVRGEKVNVLIDVSKANFSEEYFGNLEKILPITDIDYVVVQHTEPDHSGCLLELLKRHPEITVIHSKPCKKFIENLVN---REFKSWSINSGDELDLGGKTLRFFVTPFLHWPDTMMSYLVEEEILFPCDVMGAHFTSERNDDDEDYKTSIEAFKFYYSMIMRPYKEHFLKAYKLIGDLPKKIIAPSHGPVLDRDP-EFFLEWYKRLQKVTIIYASSYG. 269
246 8.000e-65UniRef50_B8LNF7 Uncharacterized protein n=2 Tax=cellular organisms TaxID=131567 RepID=B8LNF7_PICSI  ali  18  86IAPDVTTIRSLDWDRDRFDIEFGLQNGTTYNSFII-NADKLTIIDASHEKFKGLYLSAIKEHIDPSAIEYIIANHTEPDHSGLIPDLLDLAPNATVVGSKTCIIFLQNLVLRPF---KSLVVKGGSTLDLGGHLLEFVMAPNLHWPDTMFTLDHGAGILFTCDAFGMHYCSELLY-DEDLGAIEPHYRFYYDCLMRPNCRSVITALKRIAEKDFSIIATGHGPLLRYN-VAELLNKYETWSKVAVLYVSDYGF 342
247 9.000e-65UniRef50_A0A1C6FB14 Rubredoxin-oxygen oxidoreductase n=9 Tax=Firmicutes TaxID=1239 RepID=A0A1C6FB14_9FIRM  ali  18  7IKNGIYWMGCNDFRTEIFERIFPIPEGVTYNSYFI-DDEMTCVVDAMDKSCRDEFIEDVEYLLKGRKLDYFILQHMEPDHASSAVALLEKHPEAKIVAQAQTFKLFEQFFRKPMPSRYVEVKEGDQLKL-GKHVLTFVKAPMVHWPEVIMSYDITDKVLFSADAFGMFGTVGNVYADQVDFEYLDSARRYYVNIVGKFGPQVVKVLQKAAGIPIEVICPLHGVVFRTPEIQYIIEKYLHWAKVVIAFSSIYG. 266
248 1.000e-64UniRef50_A0A1F3NHQ3 MBL fold metallo-hydrolase (Fragment) n=5 Tax=Bacteria TaxID=2 RepID=A0A1F3NHQ3_9BACT  ali  16  11ITPGVKWIGILDYDIRTFDIVMTTESGTTYNSFFI-DATKKAVVEVAKEKFSGLYLKKLKSVTDPGEIQYIILDHTEPDHSGSLSVLLDIAPYATVVGSGNAIRYLEDIMNKPF---RSLIVKDGDSLDLGNRTLRFISAPNLHWPDSIYTYLEEERVLFTCDSFAAHYCDHRMLSELTP-EYLNTFKYYFDVILKPFSKFMVKAIGKIRPLQIDVICPGHGPVHRDHLWDEYLNLIADVRKVLIAYVSAYG. 269
249 1.000e-64UniRef50_A0A1W9V7N0 MBL fold hydrolase (Fragment) n=9 Tax=root TaxID=1 RepID=A0A1W9V7N0_9CHLR  ali  16  6IKDNIFWVGAVDWDRRLFDDLIPLPDGTSYNAYLIQGSEKTALIDTVEPEMSHILLSRLEN-LGVERIDYVIANHAEPDHSGTIPQILAQHPQAQVVCTPKCKKMLIDMELVPEDRFLT--VEDGETLSLGNKTLEFIHTPWVHWPETMSTYLQEEKILFSCDFLGSHLASTDLYVT-DEGQVYEAAKRYYAEIMMPFRKIIQKNLKKVQ........................................... 211
250 1.000e-64UniRef50_A0A143X785 Flavo-diiron protein FprA1 n=2 Tax=Clostridiales bacterium CHKCI006 TaxID=1780379 RepID=A0A143X785_9FIRM  ali  16  3LNTNLYYVGIQDFDLRVFDIIMETKFGTSYNSYLLKTEAGDVLFETAKAKFFDEYLENIKAYTTLDQIKYVVCSHTEPDHVGSLERLLELCPEITVISSPVAANYLKEIVNHPF---RSKTVKDNEIMEIGQYHFQFLSVPNLHWPDTMYTYIQELKTLVTCDSFGAHYATHHLLLSVENQDDYQEAFLYYTKILSPFKPFLLKAMHKLDGMEIEMILPGHGPVIDTN-IQGMIEAYKKYKSVVIPYVSCYG. 260
251 1.000e-64UniRef50_E6MMH6 Metallo-beta-lactamase domain protein n=10 Tax=Bacteria TaxID=2 RepID=E6MMH6_9BACT  ali  17  23ITDKVTWVGKIDWELRFHGDELSTEHGSSYNAFLIRD-KKTVLMDTVWQPYDKEFVARLKREIDLKEIDYIVMNHNEIDHSGALPELLREIPGTPIYCTKKGEAILRGHYHQDWNYVN---VKTGDTLDLGESTLTFIEAPMLHWPDTMMSYLSGEEILFSNDVFGQHFATESLYNDLVKQDDLWEAEKYYANIINTYSPMASRKMKELMNLSIKMICPSHGVMWKNNPMQ-IIEKYQAWCEATIVYDTMW.. 278
252 1.000e-64UniRef50_A0A1F3TAM9 MBL fold metallo-hydrolase n=2 Tax=unclassified Bdellovibrionales TaxID=404130 RepID=A0A1F3TAM9_9PROT  ali  16  6ISNDIFWVGGKDWNMRNF-HGYETKRGTTYNAYLMLDE-KNVLIDTVKADFFPQMKQRIESITPLDKIDILVANHIEPDHSGGIEKMVEINPSIRIITNKSGLKALGRHYSI--QNWNIELVKTGDEIKIGKRSLTFVLAPMVHWPDSMTTYIKEDQILFSNDAFGQHMATAALFDDENPLDIMEEASKYYANIVWPYAGPVKKVMSGIHDLPIKMIATSHGVIWRK-HISEILRKYTDWNKAVIVYDSMWG. 259
253 1.000e-64UniRef50_A0A1V5UIY4 Flavo-diiron protein FprA1 n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1V5UIY4_9BACT  ali  20  6ISETVYSIGVKHPELDVFDLLMPLKHGTTYNSFLIK-GEKNVIIDTVKLKFFDEFIGNIKQIIDPAAIDYIVIQHNELDHSGSLLKLLELAPKARIVISKAAENFLANSFNS--KLDVTKADDSTEIKIGPSQTLKFVAAPFLHWPDTMFTYYREEKTLFTCDAFGAHYCSSEMSREEYDTDFFAQFKIYYEIIMRVYSTKVVAAYNKIKEMEIDLLLPSHGPFINGTHIKHYLDWSAGVKKAVIVYSSMYG. 268
254 2.000e-64UniRef50_B1L3C8 Beta-lactamase domain protein n=1 Tax=Korarchaeum cryptofilum (strain OPF8) TaxID=374847 RepID=B1L3C8_KORCO  ali  17  8IAEGVILFRILNRVTEKFENFWPIPRGTSYNFYIVRGKDRTALIDGADIRFSDEFFRALEERIKVEEIDYVITQHAEPDHSGTLAEVMRRASGAELLGTKQALAIGASLSNYPLERAR--EIKDNERLELGGKTLRFVVAPMIHWPDTMMTFLEEDRILFTCDLFGSHGASEKVYFDED----YFELADYYASILMPFPAMVANALQKVRALEPRILAPSHGALHR--HVDSILRTYEDWASWLIVIGSQYG. 257
255 2.000e-64UniRef50_A0A1V4YMS6 Type A flavoprotein FprA n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1V4YMS6_9EURY  ali  17  1................MFDELIPLPDGTSYNSYLIKGDEKTALIDTVDPTKTKDLVENLEEL--GLSIDYVISNHAEQDHSGSINTILELFPDSTVITNPRCKDLLMEFHLIPENRFK--IVDDGETLSLGDKTLKFIYTPWVHWPETMVTYLQEENILFSCDFFGSHLATSNLYVT-DRCKVYSSAKRYYAEIMMPFHTMIEGNIEKILQYQVDLIAPSHGPVHQDPEINAYQEWIKTENMVVIPYVSMHG. 235
256 3.000e-64UniRef50_A0A2N5ZFM1 MBL fold metallo-hydrolase n=3 Tax=Bacteria TaxID=2 RepID=A0A2N5ZFM1_9BACT  ali  17  10MTEKIWWIGAIDWGIRNF-HGYRTSRGTTYNAYLILDEKK-VIIDSVKAPFREEMLARLSELIDPSEVDYIISNHAEPDHSGSLEFFVEKCKPEKFFASTMGQKALCDHYGDI--GIEITPVKTGDSINIGENELKFIETRMLHWPDSMFTYADKEKALFCQDGFGLHLATSERFDDQLDEAIVQEAEKYYANILTPFSVQVAKLIEGLLGLDIDILLNDHGPAFRTKK-ELVIDLYKKWSSQVIIYDTMWG. 265
257 3.000e-64UniRef50_A0A239R581 Flavorubredoxin n=1 Tax=Lachnospiraceae bacterium TaxID=1898203 RepID=A0A239R581_9FIRM  ali  18  3ITDTIKYVGVDDRDIDLFESQYIVPEGVSYNSYLILDE-KTAVMDTVDAHKTDEWLANLKEALGGRALDYIVVQHVEPDHSGSILRAIQEYPDAKLVATAKALQMIPQFFEKIDIEDRQIAVKEGDTLELGKHTLNFIMAPMIHWPEVMMSYDSFDKILFSADGFGKFGA----LDFDDPEGWACEARRYYFGIVGKYGASVQALLKKTANLDIEKILPLHGPVLPGTELSYYLDTYNTWSSVFVAYASIHG. 258
258 3.000e-64UniRef50_A0A1W6LM82 Nitric oxide reductase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A1W6LM82_9BACT  ali  15  4IKNNIYYVGAKDWDRKFFDELVPLSEGTTYNAYFIKGSEKNVLIDSVDPEKFDTLLSNLER-LGVEKIDYIVSLHCEQDHSGCIPVILQEFPECKVVTNEKNCGLLQEHLHISPE--QIQVIEEWETLSLGDKTLQFFFIPWVHWPETMAAYLQEDKVLFPCDMFGSHYATSEMFA-KSDAYQLELIKSYYAEIMMPYKKVIVKNLEKIDQLDIDMIAASHGPIYDDPPINAYKDWVSDTNHVVIPYISMH.. 254
259 3.000e-64UniRef50_A0A0S4XQI1 Flavodoxin/nitric oxide synthase n=22 Tax=Epsilonproteobacteria TaxID=29547 RepID=A0A0S4XQI1_9PROT  ali  18  8VSKDVYYIGVSDSDIRTFDIIMKTSNGTTYNAYLIKTTDGFILLDTVKEEFSNTFFEKIESICSYDEIKYIVMHHLEPDHSGALPELVRRVPNAKIFISPMATNMFKSITKIDNMNFET--VWTNKNLTLGDKTLKFLSTPNLHWPETMSSYLVEDKILFSGDVFGSHYYDNRVFDDLVGDFDY-SFKYYYDHIMRPFKSDVLNALKLYDSLDIAIIAPLHGPIIRSNP-QKYISLYRQWKKIVIFYVTSYK. 265
260 4.000e-64UniRef50_G2HAU3 Rubredoxin-oxygen oxidoreductase n=21 Tax=Bacteria TaxID=2 RepID=G2HAU3_9DELT  ali  20  6IKKDIHWVGVVDHNSRDFHGYSLSPQGTTYNAYVVMDE-KVTLFDTVKHEFLPTMLCRLSQVVAPEKIDYIVCNHLEPDHAGALADMVARCKPEKIFCSPMGLKAMEAHFDIT--GWPVQVVKTGDSISLGKRTVTFVETRMLHWPDSMVSYIPEDKLLICNDAFGQNIASTERYADEIDRSALLHAMKYYHNIVLPFSPIVLKTLDAIAKLDIDMLAPDHGLIFRGDEVQFAFDTYRRYKRAVIVFDTMW.. 263
261 4.000e-64UniRef50_A0A1H0M351 Flavorubredoxin n=1 Tax=Clostridium gasigenes TaxID=94869 RepID=A0A1H0M351_9CLOT  ali  14  6LKDNIYWVGVKNPELRVFDIIMETKKGTTYNSYVINDEKVAVL-DAVKDGYYDEFKENLISVIGEKKVDYVIVHHTELDHTGSLIKLIEDYPDMKVVGSRSTLINLKNILNREFNGVEAK-----EEICLGELTLKFIIAPNLHWPDTMFTYVEDKNFLFTCDFTGCHYSPKGKITDNFGEEYFVEMKYYFDCIMGPFKKFVNMGLNKIKDLEIDFIAPSHGPVHV-ANIEGVLNKYETWKKVEIFYITAYG. 258
262 5.000e-64UniRef50_Q55393 Diflavin flavoprotein A 1 n=69 Tax=cellular organisms TaxID=131567 RepID=DFA1_SYNY3  ali  17  19IAKNITAIRSLDWDRDRFDIEFGLQNGTTYNSYLIQ-ADKVALVDSSHEKFRQLYLDLLQGLIDPQRIDYLIVSHTEPDHSGLVKDILQLNPRITVVATKVALQFLDNFVHQPFER--IQVKSGDRLDLGQGHDLEFVSAPNLHWPDTMLTYDPATEILFTCDVFGMHYCSDAVF-DIDLGKIAPDYQFYYDCLMGPNARSVLAAMKRMDNLGISTVANGHGPLLR-HNVGELLHRYRHWKTVVVFYVADYG. 274
263 5.000e-64UniRef50_UPI0009A54067 MBL fold metallo-hydrolase n=1 Tax=Zoogloea sp. LCSB751 TaxID=1965277 RepID=UPI0009A54067  ali  48  1.MRNIPLFNTDDHKFILLESEPGEEDGIRSNQYLVVHGDDGVLLDPGGFGVMPRVLSELLRYVSPDRLKAIMLSHQDPDIVGGLATWLE-ISEAPVYVSSIWMRFLPHYGISSMRRFIGVPDEGMQVELAEGFRLDLVPAHFLHSEGQINVYDPISKVLFTGDIGAAMMPDGEDEPYVDDFAAHLPYIEGFHRRYMASNKAARLWVEAVSQLDIDFIAPQHGPIYRGAAVPAFLDWFRNLECGVDLMVEA... 249
264 6.000e-64UniRef50_G0EFE6 Flavodoxin/nitric oxide synthase n=2 Tax=Pyrolobus fumarii TaxID=54252 RepID=G0EFE6_PYRF1  ali  15  17VTGNVYQIRVDDVETRFFEGIWEIPEGVTYNAYLVDTGEKRILIDTVKSRYALEFLEALRGILDPRDIDAIIVQHSEPDHSGAFPIIYEAAGKPKVYAHPIAKSIIESEYGV--RLEKYEAVRDDTVVDVGDGKLVMALVPWLHWPDTIITFYPEEGLLFTCDVFGVYGVLPHIDDAGSEWALYERYMRYFANIVGAYRDWVVKNLEKLKNWNFSIIAPGHGLVIRKR-IGEVLEAYRAWRKATIIYSTMYG. 278
265 6.000e-64UniRef50_A0A1Z2TLW7 MBL fold metallo-hydrolase n=2 Tax=Thermococcus TaxID=2263 RepID=A0A1Z2TLW7_9EURY  ali  47  5..MNIYLYDDGDHKVYWLGIEEEDEKGILTNQYLVIDGNEAALIEPGGFFVFSRVLRNVSSVIPPTQIKYLMYSHQDPDVVAGLNLWFEYAPLAKLVISELWVRFIPHMAVLSAGRTIGIPDKGMD-FQLGNSTIRAIPSHYLHSPGNFSFYDEKSGILFSTDIGAAAFPEGEWYLFVENFDEHASLMDAFHRRYMSSTKALKAWVRSVRRLNPKVIAPQHGAIFRDENVTKFLDWLDGLEVGIDVFEEFYG. 256
266 6.000e-64UniRef50_A0A1V5VK30 Nitric oxide reductase n=1 Tax=Elusimicrobia bacterium ADurb.Bin231 TaxID=1852873 RepID=A0A1V5VK30_9BACT  ali  17  6LKKNIFWVGAIDWNVRFHGYTYSTKRGTTYNAYLVLD-DKIALVDTVMASFAEDLIKNIEAITDPLKIDYVIVNHVEDDHTGALPKILDIAKNAQVVCTKKCQEGLFRHYYKNWNFK---IVKTGDSIFLGNKTLNFIETPMIHWPDSMFTYIPEDNLLLSNDAFGQHIASSERFDDEIDGCVLMEESKYYANILIPLSFIISAKLSEIIKIKVDMIAPSHGIIWRNNPAQ-IIKAYSGWSSGLIVYETMWG. 263
267 6.000e-64UniRef50_A0A1V5PTL9 Flavo-diiron protein FprA1 n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5PTL9_9ACTN  ali  16  6IKKGIIYVGANDAERRIFDELIELPDGTTYNSYLVSGSEKTALIDSVDPSKKDILLSNLKAA-GIKSIDYVVSQHGEQDHSGSIPDVLAAYPMAKVVTNSKCRGELADLLMI-KEDKFITIEDGGEI-SLGDKTLKFFFTPWAHWPETFVTYIPEDRMLFTCDFLGSHYATENLYAQSND-EILIPAKRYYAEIMSPFRSMIRKNLEKIKVLDVDIVAPSHGPLHKG--MDFITGYYSQWNEVTIAYISMHG. 257
268 7.000e-64UniRef50_R9LTU8 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=R9LTU8_9FIRM  ali  14  7....IQYVGANDRDLDLFESQYPLKNGVSYNSYVILDE-KIVVMDTIDERMSREWLDQLADVLDGRDIDYLVISHLEPDHAANIQTLCQKYPHMKLIGNAQTFNMLPNYFDIEGLQERKIVVKEGELLSIGKNSLQFFMAPMVHWPEVMLTYIPEEKVLFSADAFGKFG------VLDHEDNWVDEARRYYTNIVGKYGVQVQNVLKKLPAIEVETICPLHGPILTED-LGKYISLYQLWEGVLIAYSSIYG. 253
269 1.000e-63UniRef50_A0A1V5I0B4 Anaerobic nitric oxide reductase flavorubredoxin n=1 Tax=Tenericutes bacterium ADurb.BinA155 TaxID=1852922 RepID=A0A1V5I0B4_9BACT  ali  16  9..EGLFYIGGSDRRIHLFENVYPLTNGVSYNSYLYLDE-KTVLLDTVDRSVSGVFYDNLEFLLQGRKLDYLIVNHMEPDHAANIGELLLRYPDVTVIVNAMSDRFLKNFFPKLKA--KVQIVKEGDKLCTGKRTFTFVMAPMVHWPEVMFTYEMSGHVLFSADAFGTFGASGNIYADELNFDYLEDCRRYYTNIVGKYGDQVMAVLNKAAGLDIKMICPLHGPVYHNNILQRYLKWAEDSDGVMIAYSSVYG. 265
270 1.000e-63UniRef50_A0A172WIR6 MBL fold metallo-hydrolase n=17 Tax=Archaea TaxID=2157 RepID=A0A172WIR6_9EURY  ali  50  10......LYDDGNHKVFWLGVEEEDEKGILTNQYLIIDNDEAALIEPGGYFVFERVLRNVSSKIPPTKIKYLIYSHQDPDVVAGMNLWFEYAPLAKIVISKLWIRFISHLAILSGPRTIGIPDEGMEI-TVGNSKIKALPAHYLHSPGNFVFYDMKAKILLSSDIGAAAFPEGEWYLFVEDFDRHAEFMEAFHKRYMSSSKALRAWVRMVRNLDINMIAPQHGAIFEGENVKKFLDWLYNLEVGIDVYEHLFKV 256
271 1.000e-63UniRef50_A0A162RGC2 Type A flavoprotein fprA n=320 Tax=Bacteria TaxID=2 RepID=A0A162RGC2_9CLOT  ali  17  6IAEKTYWIGKVDDR-KVPFHRLILEKGTTYNSYLL-DTEKPTIIDTVDIMYGGEFVKNLQSIIDLNKIHYVVINHVEPDHAGALPSLLNKAKNATIVTTGKGREFLNGMFKL--KNRNYLIIKDGDSLDIGGKTLKFFETPYLHTEETMITYCVEDKILYPCDIFSTHIANYELFNDLAKEDITEDFITYYKLIMGPHRSYVRDMINKIRALDIEIIAPSHGFILRDDA-QKYINIYDKLKKALILFSSMTG. 261
272 1.000e-63UniRef50_A0A2A1ZSC9 Uncharacterized protein n=1 Tax=Candidatus Izimaplasma sp. ZiA1 TaxID=2024899 RepID=A0A2A1ZSC9_9BACT  ali  15  22LKDGIYWIGSVDHELREFDVVLHAKYGTTYNSYLVKGSKKTAIIDTVKHTKIDDYLDKLKDLVDIKDVDYIIINHAEPDHTGSIKKLLELNKDIIVVGSRAALSNLKEITNMEFNEFAVSENK---TLDLGDKVFKFISAPNLHWPDTIYSYLETDNVIFTCDSFGSHY--GMDIPLQSKITNYEEYMDGFHKILLPFKSFMIRAINKIEKLDIDMVCTGHGPILDEDPW-KIINYSKELKEVVIPYVTSYG. 280
273 1.000e-63UniRef50_A0A1V6IK25 Flavo-diiron protein FprA1 n=3 Tax=unclassified Tenericutes TaxID=713063 RepID=A0A1V6IK25_9BACT  ali  15  6VKNNVYYIGVSDRGLRVFDIMMETKHGTTYNSYLIKEEGGVTIIDGVKAGFTDKWLDNIRSLVDIKDIKYLVVQHTEPDHSGAIPALLALNPNIEVYGSFMAMANLKEINNAPFISNVIKPKQ--ELKLSERQSLFFYPVPNVHWPDTIITHDPVNAIAFTCDFLGQHIAPQQLFSKEPNKKIIEEEIKYYDAIMAPFKSDVLKSVATLKSLDVSMVLNSHGYILTKEAVDWAINKYIKWSTVTVVFASAYG. 266
274 1.000e-63UniRef50_A0A2V2GAY4 MBL fold metallo-hydrolase n=1 Tax=Desulfovibrionaceae bacterium TaxID=2049043 RepID=A0A2V2GAY4_9DELT  ali  19  6LKPDIYWVGAVDYNLRNFHHYSRSPLGSTYNAYLVRDE-KTVLFDTVSAHYYDELVEHISAVVEPCKIDYIVCNHLEQDHSGALPRIVELCRPEKIFVSPLGQKSITGIFN--TEGWPIEVVKDGDRLNIGRRNITFLETRMLHWPDSMVSYLEEDKVLISNDIFGQNVATSRRFVDEYDRSLLLRAMKYYYNIVLPYSPMTLKALDRIASLQFDVIAPDHGLIFRQEDIDFVIRSYREFAEQVIAYDTMW.. 263
275 2.000e-63UniRef50_A0A143XLQ8 Nitric oxide reductase n=19 Tax=root TaxID=1 RepID=A0A143XLQ8_9FIRM  ali  17  7VTEHITWIGGNDRRLALFESVYPIPMGVSYNSYFVSDE-KTMVLDTVDKSVSGQFFENIESVRNGRKMDYLVVNHMEPDHAAVIDEFVLRYPEVQIICNEKIAEMMKQFFTFDVDGRTIIVKEGDTI-STGQHTFTFVMAPMVHWPEVMMTYEVTNKILFSADAFGTFGANGQLFADEVDFDYLDEARRYYTNIVGKYATQVQAALQKAASIEINMICPLHGFVWRKN-IGYFLEKYVHWDGVLIVYASVYG. 265
276 2.000e-63UniRef50_Q2PCA4 A-type flavoprotein (Fragment) n=1 Tax=Mastigamoeba balamuthi TaxID=108607 RepID=Q2PCA4_MASBA  ali  12  7IRKDLYWVGALDPKLRIFDVVMTTPFGTSYNSFLLRGSKMTVLFETVKEQFYDEFEQRLNGILEGEKIDMFVLNHTEPDHSGALGRLLDRFPDAQVVATGAAHSNLEHIAHRKYNKVPVTPLTKP--IDIGGYTLKFIIAPFLHWPDTMFTYVEEAKTVITCDFLGSHYCFDGVVDDAMTEEQTRDYVVYYDPIFGPFKQQSLAGLAHLAKLSFDVVCCSHGPVLRS-GIERIVQLYKAWERVVVAYVSAY.. 266
277 2.000e-63UniRef50_D7D7Y0 Beta-lactamase domain protein n=4 Tax=Desulfurococcaceae TaxID=2272 RepID=D7D7Y0_STAHD  ali  17  9IKPGFYILGIDDDKIKYFEGLWYIPEGITYNAYLLKTKDGYVLFDTWKHIYSEEFINELKKIIDPREIKYLVVHHMEPDHSGSIKDLLEINPEILVLGHPLMRGMIESFYNVKPRFK---PVKDNEILEIGEYKLRFIHTPWLHWPETIMTYIENLQALLTCDAFGAYGIFDKIYDTELSPEEQEKHMKYIATVIGHYADWVEKALNKLESLNIELIAPAHGIIWKNPSIKYYRSWSKGLKKIVVVYTSMYRF 271
278 3.000e-63UniRef50_A0A1W9TL72 MBL fold metallo-hydrolase (Fragment) n=1 Tax=Fusobacteriia bacterium 4572_132 TaxID=1971640 RepID=A0A1W9TL72_9BACT  ali  22  6IKKGIYWVGGIDWGIRNF-HGYLTQRGTTYNSYLIVDE-KITLVDTVKYYLVDELLERVASIVDPSKIDYIISNHVEMDHSGGLPRLMEIAENATIITAPNGEKGLSQHY--DTSDWKIKTMKTGDRLELGKRNIDFILTPMVHWPDNMVGYMPEEKILFSNDSFGQHIASSERFDDQLSIEMMEEAKKYYANIVMSYGMQVGKELKQASVLDIEIIAPSHGIIFRKDIVENYVKWSSNIKKALIV....... 253
279 3.000e-63UniRef50_H8I6G4 F420H2 oxidase n=8 Tax=Euryarchaeota TaxID=28890 RepID=H8I6G4_METCZ  ali  17  6ITKGVYWVGAIDWNIR--DYHGYTLPGTTYNAYLVV-GDKIALIDSAYPGFDNQILERIRSVVDPKKIDYLIANHVEKDHSGTLPALTKLLPGAPVYCTANARQGFSKHY-DTTDWNFRIVKSGDTLSLGRDRTLTFLEAPLLHWPDSMFTYLVEEKILFPNDAFGQHIASSQRFDDLGKEETLRHAQKFFANLIIPLAPRVLKKLEEAGRLDIKMIAPSHGVIWRSDIVNAYVNWCNGVDKVTIVYDSMHG. 261
280 3.000e-63UniRef50_A0A1G0RNF5 MBL fold hydrolase n=1 Tax=Ignavibacteria bacterium GWF2_33_9 TaxID=1798430 RepID=A0A1G0RNF5_9BACT  ali  21  5ISPSVKWVGKMDYNLRFHGDQISTHHGSSYNSYLIQDE-KTVLVDLVYAPYATDFISNLETIIDLNSIDHIVVNHSEPDHSGALPYLMERIPNTPIICTASGAKAIKGQYHKDWNF---QIVKTGDKISLGKNELLFIDAAMLHWPDTMMCYLNNENVLFSNDIFGHHFAATSIFDDSRKSEIMDEAEKYYASIIFPFANKAKKKMQQLMNLPLDFICPAHGVVW-KEYIPEILEKYRQLNQVTIFYDSMYG. 261
281 3.000e-63UniRef50_S0FVS8 Nitric oxide reductase FprA n=95 Tax=root TaxID=1 RepID=S0FVS8_9DELT  ali  16  7LANGIYSVGCRDWDIRDF-HGYEIREGTSYNAFLV-TGEQNILIDTVKSHFKDELLANISRIMDPKKIDAVISNHTEMDHSGSLPGIMHKIGEDKLYCSKMGAQNLKNHFNRDYNFK---VVGSGDTVILGNRTFSFLETRMLHWPDSMFTYLPDEKILFSSDAFGQHYAGDQFFDDDIGDEIMPHARKYYANILLHFSPRVQALLSDVAKLDIRMICPDHGVIWRKDP-SRILTAYDRWNKALVIFDSMW.. 260
282 3.000e-63UniRef50_A0A1V6J5T4 Anaerobic nitric oxide reductase flavorubredoxin n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1V6J5T4_9BACT  ali  15  5ILDTLHFIGTNDRNKPLFESNWPLPFGISYNSYLV-TDKQTALLDTIEYGSDRSYFEDLELILNGRDLNYLVILHMEPDHAGMIGEVLQRYPLATIVTNARAIKLL-DIYFPNIDKSRIREVKEGDTLELGHHHLQFVMTPMVHWPESMMAYCTTENILFSQDAFGTFGTDGGIFDDEIDPEYYKDEMRYYTNIIGRFSAQVEKTLQKAASLPIRIICPVHGPVWRTNP-RIVFDWYSQWPGVVLVYATMYG. 261
283 4.000e-63UniRef50_A0A1V6FHI8 Nitric oxide reductase n=1 Tax=Firmicutes bacterium ADurb.Bin080 TaxID=1852880 RepID=A0A1V6FHI8_9FIRM  ali  19  9..KDIYYVGASDYKCGKFENHIPIPGGMAYNSYLLVD-KKTVLFDTSDASVSDKFLENVEGLLLDRKLDYVVVTHMEPDHSSSLKRILEKYVDAKVVYNKKTQTMFKQFFGFTFEEREILVSEGDKL-DTGEHVLEFFMAPMVHWPEVMMCYDHGTKSLFSADAFGAFGSSGNLFDTEVDFNEVEDYRRYYSNIVGKYGPQVLKTLEKASKFEIETILPLHGFMLKKE-IGKIIGLYSLWKGVLIVYASMY.. 266
284 4.000e-63UniRef50_A0A1W9P7P6 MBL fold hydrolase n=1 Tax=Candidatus Cloacimonas sp. 4484_209 TaxID=1968525 RepID=A0A1W9P7P6_9BACT  ali  15  6IKKNIFSVGTIDWDRRLFDELIPLPDGTTYNAYLIKGSQKTALIDTVDPAKENELIDNLKT-MNIDKIEYVISNHAEQDHSGTIPKILEVYTGAKVVTNNKCKTMLMDMFHIPEEKFIT--VNDGDTVSLGDKTLQFVFAPWVHWPETMLTYLKEDKILF------------------------ESAKRYYAEIMMPFRNNIKRNLEKVKELEIDIIAPSHGPIHSEP--QFIIDAYRDWNEVIVPYVSMHG. 234
285 5.000e-63UniRef50_A0A1V2MDC3 Flavoprotein n=6 Tax=Firmicutes TaxID=1239 RepID=A0A1V2MDC3_9FIRM  ali  16  4ITKNLFWVGAKDPTLRVFDIIMTAEYGTTYNSYLLKDQNAFVLFETVKDKFFDEFWARLQEVTNIKDIKYLVVNHTEPDHSGSVSKILALIPDITIISSPTAKKYLENITNKTF---QHVVAKEGSDLNLGTHTLSFKSVPQLHWPDTIYTYIVEEKTLITCDSFGAHYSSDKCFEGKEISAFDKAYKYYFDVIMGPFKPFVLKALAKIENLEIDYVAPGHGLIFDDMNFPKYKHMYKKWASALIGYVSAYG. 270
286 6.000e-63UniRef50_A0A2L1GLI2 MBL fold metallo-hydrolase n=11 Tax=Bacteria TaxID=2 RepID=A0A2L1GLI2_9DELT  ali  15  6LAKGIYWVGAIDWNIRDF-HGYSTNRGSTYNAYLIVD-DKITLVDTVKAKFKGELMHRIRSIIDPKQIDYIVVNHVEMDHSGSLPEVIAEVQPEKLICSKMGQKALLQHFH--REDWPYQVVGSGDEIKLGEHTLSFLETRMLHWPDSMFAYVKDEQLLFSNDAFGEHLATSERFDDEVDAGVLHETTKYYANILTLYSQQVRNLLAKVAKLDIKTIAPDHGVIWRKDP-GRIIASYKRWSRALVIYDTMW.. 261
287 6.000e-63UniRef50_A0A2N1PBN2 MBL fold metallo-hydrolase n=1 Tax=candidate division Zixibacteria bacterium HGW-Zixibacteria-1 TaxID=2013855 RepID=A0A2N1PBN2_9B  ali  16  6IKKDIFGVGAIDWNLRDF-HGYSTEKGTTYNSYLVMS-DKTVLFDTVKAAFADEFIADLKSVLGDRKLDYIVSNHAEMDHSGALPAVMQAFRPEKVICTKACQDALNRHFHGNDWPF--ELIKEGDELNLGNRTVQFFGSAMIHWPESMVSLLKEDKLLISNDIFGQHWATSERYDDEVDQELSRQSAKYYANIFLPTSPAVKKFLEKLKGLEFDMIAPDHGLILRKNSLAAYKAWAEAKPKAVVIYDTMW.. 260
288 7.000e-63UniRef50_A0A174LBF3 FprA family A-type flavoprotein n=11 Tax=Clostridiales TaxID=186802 RepID=A0A174LBF3_9FIRM  ali  17  7VTEDLYWVGANDHRLHLFENIHPIPRGVSYNAYLLLDE-STVLFDTVDWSACRQLLENVEHLLDGRPLDYLLINHMEPDHGASIEEILLRWPKVKVISTEKAFMLMRQFGFRIDDHELIEVKEGDT-QCFGKHTVTFVAAPMVHWPEAMVTFDLTNGVLFSADAFGSFGADGKLFNDEVDFDWLDDARRYFTNIVGKYGPHVQLLLKKAGGIKIKVVCPLHGPVWRSN-LAYLIDKYDHWSRVLIAYASMYG. 267
289 8.000e-63UniRef50_A0A2G6FX22 MBL fold metallo-hydrolase n=9 Tax=Bacteria TaxID=2 RepID=A0A2G6FX22_9DELT  ali  17  6LTEGIYNVGVRDWNIRDF-HGYSTHKGTTYNAFLIVDE-KIVLIDTVKKEFGDKLLENISSIVDPKKIDMVISNHSEMDHTGSLTRIMHFIGEEKVLCSKLGKKNIEAHFGKDK--LNLNPVKSGEEISTGSKTLSFLETRMLHWPDSMFTYAKEDKILFSSDAFGQHYSGWATFDDESEEEWTNHAKKYYANILLPFSGLVKKVISDIEKLEVNMICPDHGLIFRKDQ-AKIIGLYKEWKKAVIIYDSMWN. 262
290 9.000e-63UniRef50_UPI000558823E MBL fold metallo-hydrolase n=1 Tax=Butyrivibrio sp. AE2032 TaxID=1458463 RepID=UPI000558823E  ali  16  7LTDDLTWIGGSDRKITKFENVYKLNSGMNYNSYFL-DAGATVLFDTVGRDASEVFFENLEYCLAGRKLDYIVVNHMEPDHSATLAEILDRNAEAKMIVNAKTLQFIAQFFPGKDYSSRAVTVKDGDELELGSHKFKFVFAPMVHWPEVMMSFDETEGTLFSADAFGSYGTDGSIFADGKNLDLLNEARRYYTNIVGKYGMQTIAAINKVSALDIKMICPLHSYVWRKD-LEKIIGYYKTWKGVFILQGSIYG. 266
291 1.000e-62UniRef50_A0A146KB59 A-type flavoprotein (Fragment) n=1 Tax=Trepomonas sp. PC1 TaxID=1076344 RepID=A0A146KB59_9EUKA  ali  17  1..ENVFWVGVVDWALRFF-HGYTTPDGATYNSYLIKLNDKTVLVDTVKATFWDEFKERIERQVSVTKIDYLVVLHAEPDHSGSVPFIVQANPNVKVVCSTPCRNILKRYYNLEFNFCDCPA------------EFTFKHTALQHWPESIMIYD---KILFSSDLFGQHIASTERFTEEFDLHTLMRAEDYFANILHPFKHLVSKTMADLEKYEFDYVLPAHGLSYRTKNFNEVFQAYKNLCKVLIMYETMYG. 242
292 1.000e-62UniRef50_A0A2N1U1E8 MBL fold hydrolase n=2 Tax=Candidatus Riflebacteria TaxID=1817810 RepID=A0A2N1U1E8_9BACT  ali  21  22ICKDIYWVGALEWKEHFHGHELSIRHGTSYNSYFINDEKK-VLIDLVRCSHADDLIRHIEEFVKIEELDILIINHAEPDHASALPRLLARNPKLEIYASRGGQVSIKRHHPQVENLKT---VKTGDSINIGKRTLRFFEAQMLHWPDSMFTYCPEDKVLFSTDAFGQHFASPERFVDQVDQKGLWEVEKYFACILTLYSSQILKKIDEFSKLDISIIAPAHGLCWRQNPIEKYIEWSKNREAAVIVFDTIWG. 278
293 2.000e-62UniRef50_A0A1S9CSI9 Flavoprotein n=1 Tax=Epulopiscium sp. Nele67-Bin004 TaxID=1764962 RepID=A0A1S9CSI9_9FIRM  ali  16  5ITQNLTWVGIQDADLRIFDIIMETEFGTSYNSYLLKDADEYILFETAKETFVDIYIEKLKSVTELNKIKYLVVNHTEPDHAGSIAKIIELIEDITIIAAPIAITFLKEHTNMSFNSIQ---AKEGTPLTVCGYTLNFKSVPFLHWPDTIYTYVEEDKLLVTCDSFGAHYSHEDILTDTEIKDFDTAYQYYYNMIMGPFKPYMLTALDKIAGLEINYVCPGHGLVFDNNNFEKYRNLYKEWQSVVVAYVSSYG. 267
294 2.000e-62UniRef50_UPI00047C1A3E flavodoxin n=1 Tax=[Clostridium] saccharogumia TaxID=341225 RepID=UPI00047C1A3E  ali  16  3ISKDIRYVGVNDHNVDLFEGQYVVPNGMAYNSYVIMDE-KIAVMDTVDINFTHEWLDNLADVLNDKIPDYLIVQHMEPDHSANIKNFIKIYPDTTIVANAKTFAMMDQFFDLDSSIKRLEVKNGATL-CLGEHTLTFVFAPMVHWPEVMVTYDDKDKVLFSADGFGKFGAND------VEEEWADEARRYYIGIVGKYGAQVQALLKKAAGLDIQIICPLHGPVLT-ENLGYYINLYDIWEGIVIAYTSVYG. 252
295 2.000e-62UniRef50_A0A2A2HHK4 MBL fold metallo-hydrolase n=2 Tax=Methanocorpusculum TaxID=2192 RepID=A0A2A2HHK4_9EURY  ali  17  6IVENIYAVGTISWDLRCFDSIMPTPRGSSNNAYLVKGSEKAALIDTGEAHEEAEFITNLMRA-DQHSLDYIVCLHAEQDHSGLLPLLLEVYPMAKVVTNEVCKGLLMAMHHLEEVEERFIVIGDKETLSLGDKTLKFYLAPWVHWPDTMFAEVVEDKVLFTTDFLSTHYASPTLFQNDDSSEYLEGVKRYYAAIMMPFRAAVREQLALVEEIAPEIVAPSHGPVLKLPA--KIMDLYHDWNSVVVAYVTMHG. 260
296 2.000e-62UniRef50_A0A1V6CM81 Nitric oxide reductase n=28 Tax=cellular organisms TaxID=131567 RepID=A0A1V6CM81_9BACT  ali  16  6IRNGIQSIAMVHWERRLFDSLIPLPDGTSYNAYVVKGRDATALIDSADPVLQDELMEQLR---NGPRIDYVVSQHSEQDHSGTIPLVLEQFPDAKLVCSDKAESLLTTHLGVSEDRLVT--AEDGQTIPLGGKTLQFVHTPWVHWPETMCTYIPEDKCLFTCDFFGSHLATTDLYVT-DEARVYEAAKRYYAEIMMPFRNVITKNLEKIGTLDFDTIAPSHGPVYDKPA--FILDAYRDWNEVVLPYISMHG. 255
297 2.000e-62UniRef50_A0A0U3NPS3 Uncharacterized protein n=1 Tax=Mycoplasma sp. (ex Biomphalaria glabrata) TaxID=1749074 RepID=A0A0U3NPS3_9MOLU  ali  16  17..ENLWYVGSQDHDIKIFDIIMVTDFGTSYNSYIYKTSEGYVLFETVKVLFYDEYIKKIKEVVDLSQIKYILVNHTEPDHSGSVENLAKLIPNIKIIGSKNTIKYLKEVTNIDDLNTVEAVEGKD--LKIGNSTFQFLNVPMLHWPDSIYTYIKEEKILVTCDSFGSHYAFDDILMSKLPQNKWDDYFKYYTAIFSPFKKHVLFAIDKIKRLDYNLICCGHGPVL-DEKIDFVVNKYKEWKIVVIPYCTAYG. 277
298 2.000e-62UniRef50_B0ED61 Type A flavoprotein fprA, putative n=46 Tax=Entamoeba TaxID=5758 RepID=B0ED61_ENTDS  ali  15  94VVKDLYWVGVFDKELRVFDIIMRTPYGTTYNSFLLKSEKGNVLFETCKENFAEECLERIEDVIGKEKIDYIVLNHTEPDHSGSLVHILEKYPEATVIGTMAALNNIKYIGHIKENTKTLNSGKI-KTLDLGNYHLKFLIQPFLHWPDTMMTVIEELKVLVSCDVFGGHYADERVFNDDRIKDMDDAYKHYFDCIFGPFKNYVIKGINMIETQELKAICCSHGPVLRTN-IKENIERYRKWNKVVIAYGSAYG. 360
299 2.000e-62UniRef50_R6GQI7 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=R6GQI7_9FIRM  ali  18  7VNDDYTWVGADGRRLAMFEGVYDVPRGVSFNSYLLTDG-KTVLFDTADASVCRVFLENVAHGLNGRALDYLVVQHMEPDHAADIRDLLVRHPETTVVCSAAAKNMLAQFFG-PGYEGRISVVKEGDTLCTGRHTLHFVAAPMVHWPEVLMTYDETDKLLLTADAFGTFGANGALFADEVDFDYLDEARRYYTNIVGKYGAQVQAVLKKAGGLDIQMLLPLHGFVWRQDILGKYDLWSRYEPEVVIAYASVYG. 265
300 4.000e-62UniRef50_A8R7U8 Nitric oxide reductase n=26 Tax=Bacteria TaxID=2 RepID=A8R7U8_9FIRM  ali  18  7IKDNVYWVGVHDFNCRFHGDLFPIAEGTTYNSYLIVDE-EITLIDTVEEEFFDIMMERIRSVIGDKPIHNVIVQHAEPDHSGGFIKFMQCYPNAKAYASNAGVNIMLKQYFQDYNYRKVKTAD---TLCIGKHTLTFVEMPMIHWPDNMLTYIDKANVVFSNDAFGQHICSYDIFDDAHGLACLDCAKDYYANIVMPYGTQVANKLKQIQEMNIDIIAPAHGIIWRS-YIPEMLSAYADFNKVVIVYESIWK. 263
301 5.000e-62UniRef50_A0A0X3BI35 Type A flavoprotein fprA n=13 Tax=Methanomicrobiales TaxID=2191 RepID=A0A0X3BI35_9EURY  ali  20  8...PGVHWVGAIDWNLREYHGYTLP-GTTYNAYLVR-GEKTALIDSAYAGFENQILGRVASVCDPGEIDYIVLNHIEMDHSGCLPALVRKMPGIPIYCTERAKTGLARHY--DTSGWNIRVVKTGDTLDLGGKTLTFLEAPMLHWPDSMFTYLAEDAILFPNDAFGQHIASAARFDDLGKDEALAHAQKFFANLIIPLAPKVLKKLDEVGKLGIEMIAPSHGIIWRGDILKAYIDWSQGVDKVTIVYDTMHG. 260
302 5.000e-62UniRef50_Q86QZ1 A-type flavoprotein n=10 Tax=Hexamitidae TaxID=5739 RepID=Q86QZ1_GIAIN  ali  17  13MIPGVYWVGIVDWMVRIF-HGYHTDEGSSYNSYFI-DDECPTVIDSVKYPFAEEWLSRIAACCPLDKIKYVVMNHAEGDHASSLKDHYHKFTNATFVCTKKCQEHLKILYGMEKA--TWLIVDDKYTLKIGKRTLKFIPVPLLHWPDSTFTYCPEDKILFSNDGFGQHYATSRRWADECDVSHVMHFKEYTANILGLFSAQMRKALEVASTVEIKYILSAHGVSWRGDAMGLAIAEYDRWKKVTVVLDSMYG. 268
303 5.000e-62UniRef50_A0A1V5L9A3 Nitric oxide reductase n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A1V5L9A3_9ACTN  ali  17  6LADDIYWVGAIDWDIRDF-HGYSTPRGSTYNSYLIVD-DKVCVVDGVRAGFGPEMLRRIRGCCDNRAVDYFVVNHVEMDHTGSLPWLIEQLAPGKIVTSKRGQEALVQHFGPEECERWDILAVGGDEISLGRYTLSFLEAPMLHWPDSMFTYIKEPHVLLPNDAFGQHLAGSRRFADQMDMNVMEEAVTYFANILMPFAGQITKMIQKVMGLEIDILGPSHGVVWRREDIDAIIEAYAAWPCVCLLYDTMW.. 265
304 5.000e-62UniRef50_F0QTF2 Beta-lactamase domain protein n=3 Tax=Vulcanisaeta TaxID=164450 RepID=F0QTF2_VULM7  ali  17  18...DLMILRYNDNETNYFEALWEIPEGVTYNAYLLIDNDTVILFDTWKRGLENDFLNALNSVIDIRDLDYVIIHHMESDHSGSIKALYDKNSDITFIGHPMANKLIRNLYGINPKFK---AVKDGETLSTKNYQLTFIHVPWLHWPETMFTYIPQIRTLLTCDVFGAYTIPKSIFIDDLNDDYISSMRKYFANIIGFYRDNVTKNLDKVLTMNIDIITPAHGAVIKGNIVKRYIDLYREFKKIVITYSSMYGF 274
305 5.000e-62UniRef50_UPI00037F3F79 FprA family A-type flavoprotein n=1 Tax=Allobaculum stercoricanis TaxID=174709 RepID=UPI00037F3F79  ali  15  9.....YSVGCDDYDIDLFESQYKVPHGIAYNSYLIQSETGNLLVDTVDKRKAQEWLENVEEVLNGQPLNYLLIQHLEPDHSGSIDVILNAHPEATVVCSAKAWQMMENFAVSTIAPEKRLTVKEGDTLDLGDRLLHFVQAPMVHWPEVIVTYDDKDKVLYSADAFGKFGTRDA------DEPWEEEARRYFLNIVGKYGNPVQTLLKKAANLDIQTIAATHGPLL-KDNLGHYISLYDTWDGILVLVASIHG. 256
306 7.000e-62UniRef50_A0A0F8Y9B0 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8Y9B0_9ZZZZ  ali  14  10VTDNVYWVGAIDWDVRNF-HGYLTSRGTTYSAFLIL-ADKVTLIDTVKAPFFDEMMARITSVVAPQKIDYIISNHAEMDHSGSLPRTIEATKPEAVFASKMGQKALDAHFHMD---RQITAVADGETLDLGNMKLTFVETRMCHWPDSMVSYLHERELLFSQDGFGMHLASYERFADELPRDILDESAKYYANILLHLSTFINKTLKKIADLGISMVVPDHGPIWRKEDIERIIGSYARWNKALVVFDSMWG. 266
307 8.000e-62UniRef50_A0A1J5N3L2 Rubredoxin-oxygen oxidoreductase n=8 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1J5N3L2_9DELT  ali  19  6IKEGVFWLGAVDWNRRNFHGYSKAHKGTTYNNFLIVDE-KVTLIDTVAEEFWGTLQCNIAQVLGDRKIDYVVANHLEPDHAGCLAKVVEKYQPEKIFTSPMGQKAMKAHFKYEDWPVEVTPT--GTELSIGKRTLSFLETRMLHWPDSMLTYCPEEKLVFSNDAFGQNWATSERWADEVDRYRLEELMNYYANIVLPYSPVVLKTLATIKELEIETICPDHGLMFRGDAIEKYLEFAEQKPKAVIVYDTMW.. 262
308 8.000e-62UniRef50_Q3IXC7 Flavodoxin n=13 Tax=Proteobacteria TaxID=1224 RepID=Q3IXC7_RHOS4  ali  15  22IVPGVHWIGAFDPGLRSFDTLMKTANGTSYNAYTVRGAAGVAVIDTVHADHAETFFARLEAVARYDEITQIVLNHLEPDHSGALPELLRRAPQAEIRLSPRGLPILRALLRDAFETARILPVTTGAEADLGGRRLRFLTTPNVHWPDTQCTYLVEEGILFTCDLLGSHYCDERLFDDRV-GDFRFAMDHYFDRLMRPFRSFVTQALDLIEPLDLTVIAPSHGPVLRTDP-RAYLRQYRRLRTLAILYISAHG. 281
309 8.000e-62UniRef50_A0A0S8K9V3 MBL fold metallo-hydrolase n=11 Tax=root TaxID=1 RepID=A0A0S8K9V3_9CHLR  ali  18  6IKPGSWWIGVNVRSHDLFEGLWPIPHGVSLNSYLVR-GNKTAVVDLVWSGTSTLFLHQLQSGTDPKDIDYIILNHLEPDHTEFLPNLRRMAPQATLLATEKGVELVEHFYGI--SEGVRAVGDGEELDLGGGKKLVFFHTPFVHWPETMMTYEPATGVLFSCDAFGGFGAKGILFDDQDESFYYDEMLRYYANIVANFSRMVLKAIDKLAGIEVSVIAPSHGLVWRTNP-QKVIENYKAEPGITLLWGSMYG. 270
310 9.000e-62UniRef50_A0A1W9N9D0 MBL fold metallo-hydrolase n=6 Tax=Bacteria TaxID=2 RepID=A0A1W9N9D0_9SPIO  ali  17  1..MNVTTVTDGIFRLILFEGLWPIPNGIAMNSYIVKGGNKTAIVDCGWDGVPETLFEQFKQIIDPESIDYVIVNHMEPDHCGWIENFRKIRPNFTVVTSKKAIPLMKGFFDIDESSIM-PVGDGDTLDLGDGRVLAFAEIPNVHWPETIATFDTKSGTLMPCDAFGSFGAIDDAPYDEQIDFFEREATRYYANIVAAFSQPVLQAIKKASPLPIKIIAPGHGIVWRKDPMKIVKDRYANYQKGTVIWGSMYG. 271
311 9.000e-62UniRef50_C7HSM2 Metallo-beta-lactamase domain protein n=23 Tax=Tissierellia TaxID=1737404 RepID=C7HSM2_9FIRM  ali  18  7VYDNIYWVGANDRDLKRFENMFTLPNGVTYNSYIIKDE-KNVLMDGSDSSVIRTYLDNVEKALDGEDLDYIIVQHMEPDHCGSIDFILDKYPNCKFVGNQKTIKFFHQFYPNDKFDEDRFVEEDGDELNIGKRNLKFVFAPMVHWPEVFMTYETTEGLFFSADAFGSFNGHISAKHYIKKDSWVDENRRYYINIVGKQGKMVTNLLKKVSDFEINAILPLHGPVYDKESIEFILDKYDKWAKGVIVFSSMYG. 269
312 1.000e-61UniRef50_P0CY93 Type A flavoprotein fprA n=60 Tax=root TaxID=1 RepID=FPRA_RHOCA  ali  14  28....VHWVGALDPGLRNFDVILKTANGTTYNAYAVRGSEGVAVIDTVKAEFAGDFFARLEAVARYDEIRLIVLNHLEPDHTGAVPELLRRAPQAQVRLSPRGLPMLRALLKDDFERYDIKGVTTGQSVSLGDRICSFFTTPFVHWPDTQCTWLAAERVLFTCDLFGSHYCDGRLFNDLV-GDFRFSFEYYFDRIMRPFRSFVAQVLDLIEPLDFGIIAPAHGPILRSHPRDYLTHTRRLISSWLIFYVSAYR. 285
313 1.000e-61UniRef50_A0A1J0GMY2 Flavoprotein n=2 Tax=Clostridia TaxID=186801 RepID=A0A1J0GMY2_9CLOT  ali  17  6MLSDNIYWVGKVDDRDVPFHRLTLTKGTTYNSYLLMTE-KPTVIDTVDMSFGREFVENLKSIVELEKIEYIVINHTEPDHSGALGSLAIKAKNAVIVCTSLAVDQLKEMYKLHNREF--LVVGDGDTLDIGGKILKFIETPYLHTAETMITYCVEDKILFPCDIFSTHVANYEYFNDMAKEDINDDYIGYYKLIMHPHRRYVQNMIKKIRNLDIKMIAPSHGYILR-DKVQSFIDIYDNMKKALVLYSTMTG. 260
314 2.000e-61UniRef50_R5AVW0 Metallo-beta-lactamase domain protein n=1 Tax=Prevotella sp. CAG:1031 TaxID=1262917 RepID=R5AVW0_9BACT  ali  15  1.MSEIRYVGVFDRYISLFERQYPVEHGITYNSYVI-FGERPVVVDSVDAAFALQWLTNVEKALEGRRPAALVCQHLEPDHSGSLRALLDRYPGMSLIVSSRAASMLPNFLDAEAAGRLITVGEGDTYDLAGGSGLTFMMTPMVHWPEVMMTYLASEKTLFSADGFGSFG-----VPEFPQPCWADEAARYYFNIVGKFGPAVQTVLKKASGLDIERILPLHGPQLSGDALAEALRLYDLWEDVLIAVASIYG. 254
315 3.000e-61UniRef50_A0A174J084 Flavodoxin n=43 Tax=Terrabacteria group TaxID=1783272 RepID=A0A174J084_9FIRM  ali  15  7VTDDLYWVGANDHRLHLFENIHPIPRGVSYNAYLLLDE-QSVLFDTVDWSAYRQLQDNLDHLLGDKPLDWLVVNHMEPDHGASVEQILRRYPKVKVISTEKSFMLMRQFGFHPDEHECVEVKEGDT-HCFGKHTVTFVGAPMVHWPEAMVTFDTTNGALFSADAFGSFIADGKLFADEVNFDWIDEARRYLTNIVGKYGPHIQLLLGKAAGIQIKFICPLHGPVWRKD-LGYFIDKYDKWKGVMIAYASMYG. 267
316 3.000e-61UniRef50_D4TCL6 Flavin reductase-like protein, FMN-binding n=2 Tax=Cylindrospermopsis raciborskii TaxID=77022 RepID=D4TCL6_9CYAN  ali  19  17IAPNTIAIRSLDWDRDRFDIEFSLQNGTTYNSYLIQ-GEETILIDTSHQKFRQLYLETLNNLVDPQTIDYIIVSHTEPDHSGLIEDVLRLAPRATVLASRVAIQFLEGLVHSPFSKRI--VKSGDRVNIGKGHEIEFVSAPNLHWPDTIFSFDRKTQILYTCDAFGMHFCDHRTF-DEDLEAIEADFRFYYDCLMGPNSRSLLNAMKRMGELKIKIIASGHGPLL-YHHLETLTEHYQNW............. 252
317 3.000e-61UniRef50_A2BN01 Putative flavoprotein n=3 Tax=Pyrodictiaceae TaxID=2307 RepID=A2BN01_HYPBU  ali  20  9LYDNLYLIRVEDDETGFFEALWEIPEGVTYNSYLILGQKRTVLLDTVKKPFTLDYLEALSSITELRDIDVIVVHHSEPDHSGALPELLKRVGNVEVYGHPMAKTIIESHYGV-KLNSFKPVREGARLDLGGDEYLVFYQTPWVHWPDTVMSFYEARGVLFSGDVFGSYSPSSVTDEHVEDFTTYIRFMRYLATVAGRYRSWILKTLDKLENVKPKTIAPLHGLVLR-RYIGDFLRLYRSWVSGVVIYGSMYG. 269
318 4.000e-61UniRef50_A0A1Y3TT03 Flavodoxin n=3 Tax=Faecalibacterium TaxID=216851 RepID=A0A1Y3TT03_9FIRM  ali  15  8ITDSVLGISLNDTTLDLFESQYPVPGGVSYNCYLIRDE-KTAVMDTVDARATDLWMETLEAELAGTAPDYLVVSHVEPDHSANVARLAAKYPEMKVVGNAKTFAFLANFFPGAIPADRQVVVKDGDQLNLGAHTLTFVFAPMVHWPEVMVSYESSEKLLFSADGFGRFG---VVADGDSFANWVEDSRRYFLNIVGKYGAQVQALLKKAAGLEIAQICPLHGPVLNGD-LAPYLSLYDTWDEILVASASIHG. 262
319 5.000e-61UniRef50_UPI0002DE601B FprA family A-type flavoprotein n=1 Tax=Peptoniphilus grossensis TaxID=1465756 RepID=UPI0002DE601B  ali  20  9ISNNVFYIGANDRDLSIFEGMIKIPNKVAYNSYIIK-GEKNICVDLTKDTVFGDFISKIYDVIGNSSIDYLIINHIEPDHSSGIKNFISVYPDVKIICNKKTKDLLKSYYNI---YENIIEIEDGECINLGDKEFSFHLTPMVHWPESMVCYYKNESILFSQDIFGSFGANGAVFDDEVEEDYLRDTQKYYINIVGKYSSHAINALGKLKDLDIKIICPTHGVVWRKN-ISKILEVYKDLAQQLIVYGSMYG. 264
320 1.000e-60UniRef50_A0A162MH78 Nitric oxide reductase n=2 Tax=Thermoanaerobacterales Family III. Incertae Sedis TaxID=543371 RepID=A0A162MH78_9FIRM  ali  17  4IQEGIFWVGVNDWQLKDFHGL--TVNGGSYNSYLILS-DKNILIDTVYEKYAEDLLKNIEEIIPAKNLDYIFLLHSENDHSSSLPYILNYAEKAKILCTKKCAGFIKKLYQIPDER--INLIKDNDVISLKNFSIKVYETPMVHWPDTTFAYIPEKNILFSTDFLGTQIPAEPLII-ENVSTIIEESRDYYTFLMRAYWEQAVKGIDKVVDLSPEIVAPSHGPILKGNAVKEMISNYKRWKKVVIAYVSMWK. 255
321 1.000e-60UniRef50_A0A2K2V911 FprA family A-type flavoprotein n=1 Tax=Fervidicoccus sp. TaxID=2060324 RepID=A0A2K2V911_9CREN  ali  17  13..KDITMIRIYDKETQYFEALWEIPEGIEYNSYLMFTEEGGILIDTG-PKDSSAFMEALRSIASPSDIKAIVVNHMEPDHSGALRELLDSNKEIKVVSHPLSFKLMESFYSISPRFK--LEVKDGAEMQLAGESVKFFQLPWLHWPETIVTYSKSRSALFTGDIFGAYSKDPLIGSMQLDPDYLWSMKKYFVNVIGAYRSNVLNAVKKLRDLSPEIVLPAHGSAFSGNRIEELLSLYESWAKNVIAFTSMYGF 271
322 1.000e-60UniRef50_D7JFL9 Flavodoxin n=2 Tax=Bacteroidetes TaxID=976 RepID=D7JFL9_9BACT  ali  15  6ISDALYYVGVNDRKNELFERMISLPHGVTYNSYLLVDE-KVTLFDSVEICYAEESIDKIRRVLGERKVDYMILHHIEPDHSSGIRQYLAVYPDMQLVCTKKAAEMLQGYYGITA---NIKTVDEGEELSLGSHKLKFIFAPMVHWPEVMMSYEQTEKILFSADGFGCFHTLDGAVIDLNIEPYITEMERYYVNIVGKYGLPVQNVFKKLANYSIDTICSLHGPVWQEHKVYDRLSKYEGAEGVVIVYGSMY.. 259
323 2.000e-60UniRef50_A0A1E7HX24 MBL fold metallo-hydrolase n=14 Tax=Desulfovibrionaceae TaxID=194924 RepID=A0A1E7HX24_9DELT  ali  19  6IKDGIHWVGVVDWNCRNFHGYALSSKGTTYNAFYIEDEKK-VLVDTVPADFESQYLCSISNKTELDQIDYIVVNHLEPDHSGCLARMVELCKPEKIFISPMGAKSLKTFF--DCEDWPIVIANSGDEISIGKRTLRFYETKMLHWPDNMFTFIPEAKMLISSDAFGQNWATSERFIDEVSKEKVSDLMAYYANIVNPYSPKVIKTLEFFLNLDIDMLCPDHGLMFRGEDVGFALSKYKTTNKAVIIYDTMWK. 263
324 3.000e-60UniRef50_A0A2P8VZ57 Uncharacterized protein (Fragment) n=1 Tax=filamentous cyanobacterium CCP5 TaxID=2107701 RepID=A0A2P8VZ57_9CYAN  ali  14  24IAPDTTAIRCLDWDRDRFDIEFELRNGTTYNSFLVR-GDKLALIDTSHGKFHDLYLNEIAAQINWADLDYLIVNHTEPDHSGLVKAVLQRAPQVTVVGSKVAIQFLQNLVHQP--FESLMVKSGSELDLGRGHRLEFVSAPNLHWPDTIFTYDTGTRVLFTCDVFGMHYCD-DCLTDEMPHLLEADFQTYYDCLMGPNARSVVMALKRIEKFEVDLIATGHGPLLRADWVDRYRTWSQTQTKVALFYTEDYG. 278
325 3.000e-60UniRef50_Q8DJY2 Putative diflavin flavoprotein A 1 n=332 Tax=cellular organisms TaxID=131567 RepID=DFA1_THEEB  ali  16  19IAPETTAIRCLDWDRDRFDIEFALENGTTYNSFLIK-GERIALVDTSHAKFGDRYLEQLWQLVNPSDLDYLIVSHTEPDHSGLVKDVLVKAPHVTVVASKVALQFLGDLIHQP--FTQQQVKNGDRLDLGKGHVLEFVMAPNLHWPDTILTFDHGTQTLFTCDVFGAHFCNDDPFDSEPELLAP-DFKFYYDCLMGPNARSVLSAFKRLESLPPQLVATGHGPLLR-HHLDQWLESYRNWSQVAIFYAANYG. 274
326 3.000e-60UniRef50_C0QAB9 NorV n=23 Tax=Bacteria TaxID=2 RepID=C0QAB9_DESAH  ali  16  6VVDDIYRLAVNIDENYLFEGIWPIPHGISINSYLIK-GEKNVLIDTQNIMDFPRITEQLEGALAVEDIDIIIINHMEPDHSGWLNEFCKKNTKGVIYCTKKAIPLLEAFGEVPPERAV--AITDGMTLTAGDYELQFFDTPNIHWPETMMTYEKKRGILFSCDAFGSYGGNDTIFDDQLSQEKHKEALRYYANIVATFSPFVLKGLSKLASLDIKTICPSHGIIWRDNP-SVIINHYKREREVTLVWSSMYG. 272
327 4.000e-60UniRef50_A0A1Y3GEE6 Flavorubredoxin n=1 Tax=Methanonatronarchaeum thermophilum TaxID=1927129 RepID=A0A1Y3GEE6_9EURY  ali  14  6ITDRISWVGAIDWDRRLFDELIPLPDGTTYNSYLVKGNEETALIDTVDPTKKETLFNNLMNA-GVEKLDYVVVNHGEQDHSGTLPSLLEKYPECRIVTNSKAEDILTEHLELDEARFKIIGDKDQ--IDLGGTTLEFGLIPWVHWPDTQYTLAIEEKTLFTCDFLGHHYATEQLFN-NDKCHYENSAKRYFAEIMMPFKSRARKNLQKIKEIDVDVIAPSHGPLHNQP--EQIIGYYEKWNKVIIPYVSMHG. 259
328 4.000e-60UniRef50_I3XR77 Flavoprotein n=1 Tax=Desulfurococcus amylolyticus DSM 16532 TaxID=768672 RepID=I3XR77_DESAM  ali  20  9..DNVYWVGARDISRRLFDSLIPLPKGTSYNSYLVVGNSKVALIDTVNPGFENELVERISSVVDPSRIDYVIMNHAEPDHTGSIRHVLTISPSAKLVTTLFGARMAKVFYSVPSDR--ILIVRDSDVIDLGEKTLKFIEAPMLHWPETMFTYLVEDKILFSCDFFGAHVAQGLWDDEVENLRYH--AQRYFGEIMMPFRTNALNALKKIAG.......................................... 213
329 5.000e-60UniRef50_D7DTI2 Beta-lactamase domain protein n=1 Tax=Methanococcus voltae (strain ATCC BAA-1334 / A3) TaxID=456320 RepID=D7DTI2_METV3  ali  17  3ITDRVYQVGV-VDWKASHFHGFDI-HGTSYNSYLILDDKK-VIIDAVKKEYYDAFIENIAKVINPQKIDYIVINHSEMDHSSSLEYLVRD-TGAKVIANKVTKEYLERMY--DTREWHFVVVDTNETLEIGERTLKFIRTPMLHWTDNMVTY-SSDGVLYSNDAFGQHLASSERFADQIDSRSFYEAKDYFASIILPYRMFVGSVLEELSQYEINYICPAHGTVWRGDLVDDIIYKYAVWNKAVILYGTMYG. 255
330 5.000e-60UniRef50_A5GPG6 Diflavin flavoprotein A n=133 Tax=cellular organisms TaxID=131567 RepID=A5GPG6_SYNPW  ali  16  19IASDSTAIRSLDWDRSRFDIEFGLRNGTTYNAFLVR-GERTALIDTSHAKFRDSWIPLLQEQIDPQAIDHLIVSHTEPDHSGLIADLLDLNPEIEIVGSKVALQFLKDQVHRP--FRSRAVKSGDSLDLGANHRFEFLSAPNLHWPDTIFSFDHGSGILYTCDAFGLHYCSEELF-DSDPGAIAPDFRFYYECLMGPNARSVLQAMKRMDGLPINTIAVGHGPLLRQHLLNDYREWSSQRSKGAVLYLSQYGF 281
331 5.000e-60UniRef50_A0A0A1UBK7 Type A flavoprotein fprA, putative (Fragment) n=2 Tax=Entamoeba invadens IP1 TaxID=370355 RepID=A0A0A1UBK7_ENTIV  ali  13  8VVPKLHWVGVMDYDLRVFDIIMTTPFGTSYNSFLLQTAKGNVLFETCKENFAAECLERIEHVIGKEKIDYIVLNHTEPDHSGSLVHILAKYPEATVIATPAALNNVKYIGHIKEDTKTLSAPKI-KTLDLGDIHLKFIIQPFLHWPDTMMTVIEELKVLVTCDVFGGHCADDRVFNDDRIADMDEAYKHYFDCIFGPFKPYVLKGINLIETEELKAVCCSHGPVLRTN-IKENIERYRQWNKVVIAYGSAYG. 274
332 6.000e-60UniRef50_A0A174R411 Beta-lactamase domain-containing protein n=7 Tax=Bacteria TaxID=2 RepID=A0A174R411_9BACE  ali  17  8VTDSIYWIGANDFVTPRFDNLVPLPQGISYNTYFI-DDEKTCVLDGIDNACRDIFMDNLSYLLKGRALDYIIINHMEPDHSGSLLALAEAHPKAKIIASPQAIKMFEQFFHVSFKDRTILSDEKM-VLDLGVHKLRFIKAPMVHWPEVTFTYDETDKVLFSADAFGTFGAHGSIFADAVDYAYGVEGRRYYTNTTGKYGMQVLSVLKKTAALPIDIICSLHGPVLRTEKDKAYIDHVKKWASFTLFFASAYG. 268
333 7.000e-60UniRef50_A0A1F9MQP3 MBL fold metallo-hydrolase n=11 Tax=Bacteria TaxID=2 RepID=A0A1F9MQP3_9DELT  ali  17  6IKKDIYWVGAVDWNIRDF-HGYSTDKGTSYNAYLIKDE-KIALFDTVKKELKGDLIHHLYQVLDPSKIDYIIVNHVEMDHSGSLRELIDLIKPEKIFCSPMGKKALLEHFH--REDWPYQVVATGDFISLGTRTVQFLETKMLHWPDSMFSYIPEDKLLISSDAFGHHWATSERFDDEVDSELMMHASKYYANILMIFSPIVQKLLAQLKDLQIEMIAPDHGVIWRTSP-ETIMVAYDRWNKAVIIYDTMW.. 261
334 1.000e-59UniRef50_A0A0F9D592 Uncharacterized protein n=5 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9D592_9ZZZZ  ali  15  6IMKDVFFVGYVDWELRNF-HGYTTHRGTSYNSYIVKGVKK-VLIDTVKRPFFERFLKKIKTVCNPEEIDFLIINHVEPDHSGSFPLILEHNPNTEIISSKIGLENLKLHYHEEVGEKIRTVKEGDVIDIGNGKKITFVPVPMIHWPDSMVSFENGDNILFSNDAFGQHIAVSQIWDEENDFFIMEEAEKYYANILLYLSNLIVKALQKLGSLPIDVICPSHGICWKK-HIPDIMKKYQQWSKGLIIYDTMWG. 270
335 1.000e-59UniRef50_A0A1Q9MTA0 Metallo-beta-lactamase family protein n=1 Tax=Candidatus Lokiarchaeota archaeon CR_4 TaxID=1849166 RepID=A0A1Q9MTA0_9ARCH  ali  17  6LTDNIYWIGAEVHSEDLFEGIWPTPKGVTLNAYVVK-GDKTAVIELVWGGASLTLLQNLKELIAPKDINYIILNHLEPDHTGFTYTLRKLAPNAEIVCTEKGAALVNGFYGIN--DKVRNVKSGDTLNLGQGKELVFAEIPNVHWPETMVSFEKSTGILFSSDAFGSFGSRGSIFDDEQPPYWEAEMLRYYANIVATFSPSVLKAIDALGGLDVKMIAPSHGLIWRGAPVNKYIRYANAEPEVCVVWGSMYG. 270
336 1.000e-59UniRef50_A0A1V5INC5 Flavo-diiron protein FprA1 n=14 Tax=cellular organisms TaxID=131567 RepID=A0A1V5INC5_9BACT  ali  17  5LSEKVRYIGVDDTALDLFEGQYMIPDGISYNSYLILDEKVAVL-DTVDDCKADEWKENLREALDGRNPDYLVVHHMEPDHSALTGWMLEEFPSIKIVGSARAIQMMPQFFDGISLEGRTAAVKEGDILDLGSHKLRFIGAPMVHWPEVMVSFDEYDGTLYSADAFGKFGALGKCFYGRDDDDWSCEARRYYFNIVGKFGAQVQMLLSKVSPLQISSIRPLHGPLLE-DNLEEYVNLYDIWSKVFIACASMHG. 262
337 2.000e-59UniRef50_C0QTH2 Beta-lactamase domain protein n=2 Tax=Aquificales TaxID=32069 RepID=C0QTH2_PERMH  ali  47  1..MDKILFDSKNHKFILLGFAESKEEGIPSNQYLIVHNNKGIILDPGGFGLFPILLSRILKYTKLNNIKAIILSHQDPDICGGLNIWLEM-TNAKAYISKLWLRFIPHYDIKRTDQIYGIPDEGMDLEVDERLKLKIIPAHFLHSPGHVNVYDPVSKILFTGDIGAGLLPCSENKLFVEDFEEYVKCIDSFHKRYMASNEALRKWVKRVEKLDVDIIAPQHGYLFKGENVDKLLKYLYDLKCGVDLF...... 245
338 2.000e-59UniRef50_Q97GC0 Flavo-diiron protein FprA2 n=24 Tax=Terrabacteria group TaxID=1783272 RepID=FPRA2_CLOAB  ali  17  6IKDNIFSVGVLNPSLRIFDIIMKTEYGTSYNAYLIK-GKKNVLIDTVHGRFFDEYLENIKSVIDPSSIDYVIMNHCEPDHSGSLARLYEVAPQIKVIASNAGKIYLKNITNKETLDVK-AVKTNDTLDIGNGKVLKFAIAPFLHWPDSMFTILEEDKIAFTCDFLGCHFCEPRMFDTKITYMPKYEFKEYYDAIFSPFKPYVVKGLDILDALDLDFIATSHGPILTREGLQKYRDLSSEIQSTTIFYCSAYG. 266
339 2.000e-59UniRef50_A0A149W090 Diflavin flavoprotein A 1 n=45 Tax=root TaxID=1 RepID=A0A149W090_9PROT  ali  48  1.MRNITLHRSSTHKFILLESEPGDEGGIRSNQYLIMEGGAAVLLDPGGFGVMPRVLAELLRHTSPDNLKAIMLSHQDPDIVGGISTWLEL-THAPVYVSRIWLRFLPHYGIKTMERFIGVPDEGMACTLAPGFDLHLLPAHFLHSEGQINVYDPVSRILFSGDIGAAMLPDDLDYPFVDDFSRHLPYIEWFHRRYMCGNRAARFWVDMVSKLDIEMIAPQHGPIYRGQSVKDFLSWFRELECGIDLMT..... 247
340 2.000e-59UniRef50_A0A2G6GVW8 FprA family A-type flavoprotein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2G6GVW8_9BACT  ali  14  7VSEHIHWVGVNDRSTTFFERVWPLDNGMAYNSYVIVD-DKSVLVDTVHEANTLELIGRLERVLDGRSLDYIIINHMEPDHSGALPMIASRFPGVKLIGNKLTKRMIDEYYPNAAEF---MEVVDGDELDLGHHKLKFVITPWVHWPETMMTLETTTMTLFSADVFGTFGADGQIFDDEFDASAYEDEMRYYSCIVGKYSKFAQRALAKLDGVPVKTICATHGPIWRENPINKYDVWSRQEGEVTIAVASMYG. 261
341 3.000e-59UniRef50_V6LG61 A-type flavoprotein 6 n=1 Tax=Spironucleus salmonicida TaxID=348837 RepID=V6LG61_9EUKA  ali  19  8LTDQIYWVGAIDWSVRQF-HGYFTEDGTSYNSYLLMDE-QPTLIDTVRETFSTEYIERISLVCSLDKIKNIVIQHAEPDHASALPYLLKKTPNATVFCNKKCQEFLLAFQFIDQDTK-ITIVDNEYRLNIGKRTISFKQTPLLHWPESMCSFIKEEGILFSQDIFGQHLASTERFTDLIQEKVLLRTKEYLCNIMGHLQVQLKTALALVDSNDFQMILPAHGLAFNNEIIQKVVKIYRDFKKIVILYDSMYG. 265
342 3.000e-59UniRef50_Q9F0J6 Rubredoxin-oxygen oxidoreductase n=29 Tax=Deltaproteobacteria TaxID=28221 RepID=ROO_DESGG  ali  18  8...DGFHLVGAIDWNSRDFHGYTLPMGTTYNAYLVEDE-KTTLFDTVKAEYKGELLCGIASVIDPKKIDYLVIQHLELDHAGALPALIEACQPEKIFTSSLGQKAMESHFHY--KDWPVQVVKHGETLSLGKRTVTFYETRMLHWPDSMVSWFADEKVLISNDIFGQNIAASERFSDQIPVHTLERAMRYYANIVNPYAPQTLKAIETLAGVAPEFICPDHGVIFRGAAVQKYVEYAEQKPKVVIFYDSMW.. 263
343 3.000e-59UniRef50_UPI0009E19819 FprA family A-type flavoprotein n=1 Tax=Candidatus Stoquefichus sp. SB1 TaxID=1658109 RepID=UPI0009E19819  ali  14  3VTDSIKYIGVYDQELDLFEGQYPLRNGVTYNSYIIID-DKIAIMDTVDRRGKDIWLENVEKALNGREPDYLVVSHMEPDHGACVQYIAEKFPNMKIVGNVKTFAMIDEYFDLNENTKRVQVKEGDTLQL-GYHTLQFMMAPMVHWPEVMMTYELQEKVLFSADAFGTF------EKMSEDEAWVEEGRRYYTNIVGKYGLQVKNVLKKVKNLDVQMICPLHGPVLKEEIMQ-YVRYYDLWSTVLIACASIHG. 252
344 4.000e-59UniRef50_A0A256ZGS9 MBL fold metallo-hydrolase n=3 Tax=Archaea TaxID=2157 RepID=A0A256ZGS9_9CREN  ali  16  9VMKDLYVLRIDDEKTRFFEALWDIPEGITYNAYLLISE-KVVLFDTWKHTYAEEFVGALKSVVEPRDIDFIELHHLEPDHSGSLPKVLKENGRAVVLANPLAKGMISSFYGITPKFK---PIKDGDTLNIGKHTLKFIYAPWLHWPETMMTYIEELKTLLTCDVFGGFSIPPSLYDDSDEAKYLDHARKYVVTVVGHYKDFIVKGINKLQGLDIGVIAPSHGLIWRHKPKEKYLKWALGKPKVLAVYSSMYGF 268
345 4.000e-59UniRef50_A1AT16 Beta-lactamase domain protein n=1 Tax=Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1) TaxID=338966 RepID=A1AT16_PELPD  ali  17  6IIGDVYRLSVNIDKNYLFEGIWPIPHGISINGYLIKSE-KNVLIDTQDIMDFPRFTEQMGEVLGIEDIDIIVINHMEPDHAGWLREFCRRNKKATIYCTQKAVPLLEAFASVPPERAV--AITDGMILEVGDYELQFFDTPNIHWPETMMTYERKRGLLFSCDAFGSYGEENTIFDDQLSADTHDEALRYYANIVATFSTFVLKGLEKLQGLDVRVICPSHGIIWRENP-AVIIDHYRREREVTLVWSSMYG. 272
346 7.000e-59UniRef50_F4GM78 Beta-lactamase domain protein n=3 Tax=Sphaerochaeta TaxID=399320 RepID=F4GM78_SPHCD  ali  14  6LAKNIWRVHTRIGTHDLFEGIWPLPEGVLINAYVVKGSRKTALIDFVWENGESDLTGQMEEIVKVADVDYVVINHMEPDHTGALVDFRKKNKTAQIYCTKKAEPLVHHFLRVTD---NIHVIEDGEELDLGDRTLVFYETPNIHWPETMMTFERESGILFSCDAFGSFGLFDHTFEDELSEDEREEGERYYSNIVSTFSTFVQKGLAKLAPLPITMVAPSHGVLWRKD-IERLFSWYGKLEEITLVWSSMYG. 269
347 1.000e-58UniRef50_A0A1E2VB41 MBL fold metallo-hydrolase n=20 Tax=Oceanospirillales TaxID=135619 RepID=A0A1E2VB41_9GAMM  ali  50  7.....ILYEDDEHQLIWFGWEDPEESLVQSNQVLVTHGDQAYLFDPGGAFIFSDVVAELNKYVALDQIRYILATHQDPDVLSSVTLWLK-ATQAKLLVSRLWVRFVSHFGFNDVSRLVPIEDKGRKIRLAEGGEILLLPAHFLHSEGNFSFYDTRSNILFSGDIGAAVFPKGERYLFAEDWEQHRGYMEGFHRRYMGNQAALAKWVAMIRQYPVEMIVPQHGAIIPKPMIEPFLQWLEGLQCGTDLLDEYYGF 255
348 1.000e-58UniRef50_A0A2N6FNI8 MBL fold metallo-hydrolase n=3 Tax=Bacteria TaxID=2 RepID=A0A2N6FNI8_9DELT  ali  16  1..MKAVKITDGIYCLPVFEGMWPMPNGISINSYVIK-GEKTALIDLVEGNIPAEFMEELDSLLKPEDIDLVVINHMEPDHTSWLIDFHKRNPNVQFYVNKKTVPLLKSFFGIT--ENVNIVNDGDRLDLGGGKVLRFFETPNIHWPETMMTYEESSGVLISCDAFGSYGTLDGVYFDDQLSTFSDEALRYYANIVSSFSTFVSKGITKLADLDVKVIAPSHGIIWRENP-QAIIDSYTREPEVTVIWSSMYG. 270
349 2.000e-58UniRef50_A0A1V6A9W0 Nitric oxide reductase n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1V6A9W0_9BACT  ali  20  7..EGIYWVGANEWKSHFHGHELSIKHGTTYNSFFIDDEKK-VVIDSVRDSKCDEWFKNIEEFCKIEELDILIVDHAEPDHSTAIPRLLERNPNIQIYVSNGGKISVSRFF--PMAVNNLKVVKTGDSIKIGKRTLKFFEAQMLHWPDTMFTYSDTDKVLFSADAFGEHLSTSKLFNDEIENEGLWEAEKYFANILTLYSQPILKKIDAFLQLELKMIAPSHGIIWRDNPVEKYIHWAKGECEGVIIFDTIWG. 262
350 2.000e-58UniRef50_A0A192ZIW4 Cytosolic flavoprotein A n=1 Tax=Stygiella incarcerata TaxID=1712417 RepID=A0A192ZIW4_9EUKA  ali  14  33IAPDVFWVGARDPELRIFDVVMFTEYGTSYNAYIVRGEKKTALIESVKPAFFDSLMKGIEDVLGKDKVDYIVLDHTEPDHSGVAMKLLEKFPEATVVATQAGLNYVQEISNVRLDASRQFVATAGSSIDLGGKTLQFIPAKNLHWPDSMFTFVPEVNVLFTCDFFGAHFSMEALKKDAGDQTIEPSYRYYFDMIFSPYVAYVIEGLAKVESIEVHTICPSHGPMMRDTAVRRIIDLYHDWDTVIIAYVSAYG. 313
351 3.000e-58UniRef50_D3R1F9 Metallo-beta-lactamase domain protein n=2 Tax=Mageeibacillus indolicus TaxID=884684 RepID=D3R1F9_MAGIU  ali  15  6ITDNVYSVGAQHFDRELFDALMPLHYGTTYNSYFIQGTKANALIDPVEPEKIADLLKNLED-LQVKKIDYIINLHTEQDHSGGTPFMLQRWPDAQLVGTAKVAELAELHLHLPKE--KYMLVKDNDKLELGGKTLVFRSIPFAHWPDNTTAFLEEDNIIFTSDLFGSHLACGSMYNDDVKLQI-RAARDYFAEIMMPFSTQCAKYTKWVKELNPSIIAAAHGPLWRNPS--DILDKYEEWRKTVIGYVSMH.. 256
352 4.000e-58UniRef50_Q8Z0C0 Putative diflavin flavoprotein A 2 n=214 Tax=cellular organisms TaxID=131567 RepID=DFA2_NOSS1  ali  16  26IAPNTTAIRCLDWDRDRFDIEFGLQNGTTYNSYLIR-GEQTVLVDTSHQKFRQLYLETLKGLINPKAIDYIIVSHTEPDHSGLVEDVLQLAPRATVLASKIALQFLEGLVHDPFSKRI--VKSGDRIDIGKGHEIEFVSAPNLHWPDTIFSYDRKTEVIYTCDAFGMHFCDNRTF-DEDLEAIEADFRFYYDCLMGPNARSLLNAMKRMGDLKIKIIANGHGPLL-YHHLDVLTECYQSW............. 261
353 4.000e-58UniRef50_Q2PCA7 A-type flavoprotein (Fragment) n=4 Tax=Entamoeba TaxID=5758 RepID=Q2PCA7_9EUKA  ali  16  10..ENLYWVGALDTDLRIFDIIMTTPFGTSYNSFLLKTTEGNVLFETVKEDFAKECLGRIADVIGEDKIDYIVLNHTEPDHSGSLVHFLEKFPEATVVASFAALTNIKFIGHISKKTKTIDTLKRKQLKL-GQYTLNFFVQPFLHWPDTMMTVVQELKVILPCDVFGAHCADPRVFNDDRIKDMDEAYKHYFDCIFGPYTSFVLKGIDIIENKEINAICCSHGPVLRKN-IRENIERYRAWDQVVIAYGSAYG. 274
354 8.000e-58UniRef50_A0A218P0Z4 MBL fold metallo-hydrolase n=8 Tax=Thermococcaceae TaxID=2259 RepID=A0A218P0Z4_THECE  ali  16  16.....YIMRIDDDRIRYFEATWDIPEGITYNAYLMKTGDAVVLFDAWKGEYTEEFLETLKKLVDPKEITHIVTHHTEPDHSGAIPALLEANGRAKLIGTTFAKRFMEGFYGKKVVENFHAIK-DGEEMRIGGRTFRFITVPWLHWPDTMITYVVEDKLIFSCDAGGGYGMPDAIDDSDEKQEYLPHVTKYVVTVIGHYHKYIVQNIKKLRSLGIRMILPGHGLIWRRSP-TRIFEHYEAIGKVLVVYDSMYGF 275
355 9.000e-58UniRef50_A0A174XS08 H(2)O-forming NADH oxidase n=3 Tax=root TaxID=1 RepID=A0A174XS08_9BACT  ali  18  60ITNKIYYVGVNDRNKHRFEGLWPLPNGVSYNSYII-DDEKVALVDTVEVDFFTQFLENIHEVIGDREIDYLIINHMEPDHSGSIALIKKYYPNIKIVGNKKTLGMLEGFYGVTDD---VVEVKNGETLSLGNHELSFVLIPMVHWPETMVTLDAKNKVLFSGDAFGCFGAGGIIDTEINCETFWLEMVRYYSNIVGKYGIPVQN................................................. 261
356 9.000e-58UniRef50_A0A1V5HES0 Rubredoxin-oxygen oxidoreductase n=19 Tax=Bacteria TaxID=2 RepID=A0A1V5HES0_9BACT  ali  18  13ISEHVYWVGAVDWDLKEF-HGYLTQRGTTYNAYLVL-ADKITLIDTVKKPYYDEMMARIASVIDPADIALIVSNHAEADHSGCLPETIAAVRPERVLASPKGVQTLQDLFGLGD---RVEAVTPGGWLDVGGLPMQFVETRMVHWPDSMVSYLGGDGILFSQDAFGMHLAGSERFADDYDATLLHEAEKYYANIVLPYSAQVGKVLDAVPTLDIRMIAPDHGPIFRTPDIGWILTQYRRFPRAVVVYDTMW.. 268
357 1.000e-57UniRef50_Q47HD0 Beta-lactamase-like protein n=21 Tax=root TaxID=1 RepID=Q47HD0_DECAR  ali  42  1MKTTKTIFQDGNHKWVAIVRDPEKPNLIDTNEYLVTHGEQGILLDPGGAEVFPAVFSALSSEFDPSALAAIFASHQDPDICSSLALWLEFNPKMRCYVSWLWASFIPHFGGTADTFITIP--DEGTDISLAGLILRAVPAHYLHSSGNFNLYDKVAKVLFSGDVGAALLPPGEDGLFVENFDTHIRHAEGFHKRWMGSNEAKRRWCERVAQMDIDMLCPQHGAIYQGADVQRFINWFDELQVGIV........ 244
358 1.000e-57UniRef50_A0A1V4W8Z9 Nitric oxide reductase n=53 Tax=cellular organisms TaxID=131567 RepID=A0A1V4W8Z9_9DELT  ali  21  6IKPDIYWVGAIDWAVRDF-HGYITPNGTTYNNYLIND-RQVTLVDSVKHDFASSTIENIKGVVDPSKIVNLVINHIEPDHASAISSLMAVMPNAVIYITERGKKGLERYT--DTSGWTFKVVKTGDTLNTGSYNLLFLETPMLHWPDSMVTYVREAKLLISQDAFGQHLATAARFDDEFLECASLFELEYYANILMPFGQLVKAKIGDIAGLEIDMIAPDHGIIWRKDP-GKIIKMYSDMAEGVVIYDTMW.. 264
359 1.000e-57UniRef50_E8T3K8 Diguanylate cyclase n=6 Tax=Bacteria TaxID=2 RepID=E8T3K8_THEA1  ali  29  13.............DIFWVGYV-VPNDPFQCHVYLIRNGDESILIDPGSMITFPVVLEKIFQVTPLRNIKYIIFHHQDPDIVGCYATLEQLFPRDRVVTHWRTKTLLKHYMWKSP---FYLVDKHDWKLKAGDRELEFVFTPYAHFPGAFCTFDKKTKTLFSSDLFGAI--SDKFFLFATDDEEYYQGVELFHKHYMPSRAILNYALDKVESKNPELIAPQHGSIIKKEMIKPIISRLRTLECGLYVLDS.... 245
360 1.000e-57UniRef50_A0A2D5GF55 MBL fold metallo-hydrolase n=3 Tax=Oceanospirillaceae TaxID=135620 RepID=A0A2D5GF55_9GAMM  ali  49  10..ESKILYEDDEHQVVWFGWEEGADAFVQTNQCLVVNHDKGYLFDPGGTYVFHHVLENIMRVINPRQIRYLFATHQDPDVCSSIPYWMK-TTDADLLISRLWLHFVSHFGLEDVDRVTPVPDGGGRITLDSGDYIAMIPAHFLHSEGNFSIYDSRSGILFSGDIGAAIFPTGERYMFVDNFESHLKYMEGFHKRYMHSNQVCARWVELVRKLDIKMIVPQHGAIFPQEQVENFLSWFSELRCGGDYIEQIYR. 260
361 2.000e-57UniRef50_A0A2D4YUT9 Diflavin flavoprotein A (Fragment) n=5 Tax=Cyanobacteria TaxID=1117 RepID=A0A2D4YUT9_9SYNE  ali  15  17IGDDTSTIRSLDWDRSRFDIEFGLRNGTTYNAFLVR-GERTALIDTCHEKFRESWIPLLKQQIDPMSIDLLIVSHTEPDHSGLIGDLIDLNPDIEIVGSKVALQFLVDQVHRP--FKSRAVKSGDELDLGSHHRFEFISAPNLHWPDTIFSFDHGTGILYTCDAFGLHYCSDDVF-DRDPGAIAPDFRFYYDCLMGPNARSVLQALKRMDGLEISTIAVGHGPMLRSHWVNDYREWSGQRSKGAVCYLSQYGF 279
362 2.000e-57UniRef50_Q50497 Type A flavoprotein FprA n=139 Tax=Euryarchaeota TaxID=28890 RepID=FPRA_METTM  ali  18  1MKAAAKRISDGVYWTGVLDWDLRNYHGTTYNAYLVCGDEGVALIDNSYPGTFDELMARVEDALGMERVDYIIQNHVEKDHSGVLVELHRRFPEAPIYCTEVAVKGLLKHYPSLREAEFMTVKTGD-VLDLGGKTLTFLETPLLHWPDSMFTLLDEDGILFSNDAFGQHLCCPQRLDREIPEYILMDARKFYANLITPLSKLVLKKFDEVKELRIQMIAPSHGQIWTDPM--KIIEAYTGWERVTVIYDTMHG. 268
363 2.000e-57UniRef50_Q9WZL4 Uncharacterized protein n=60 Tax=cellular organisms TaxID=131567 RepID=Q9WZL4_THEMA  ali  16  15....IYVLRIDDDRIRYFEAVWEIPEGISYNAYLVKLNGANVLIDGWKGNYAKEFIDALSKIVDPKEITHIIVNHTEPDHSGSLPATLKTIGDVEIIASNFGKRLLEGFYGI----KDVTVVKDGEEREIGGKKFKFVMTPWLHWPDTMVTYL--DGILFSCDVGGGYLLPEILDDESVVERYLPHVTKYIVTVIGHYKNYILEGAEKLSSLKIKALLPGHGLIWKKDP-QRLLNHYVSVAKGTVIYDSMYGF 266
364 2.000e-57UniRef50_V6LPN7 A-type flavoprotein n=1 Tax=Spironucleus salmonicida TaxID=348837 RepID=V6LPN7_9EUKA  ali  19  10MLPNVFWVGAIDWTIRIF-HGYHTDEGSSYNAYLIKD-TIPTLIDCVKEPFWEEFLERVSAVIPLDQIKQIIVNHAEGDHTSALPLVMPKFPNATIITNKVCKEHLCILYPSLKSC-SWQLVDNSKTISTGSRTLGFLLVPNLHWPDSMFTLDATNNILFSNDGFGQHIASTDRWADQVQDIEHLMYLEYTANILGPFRAPIRTALKAAATLKIEYILTAHGCSWRGDPLREYSLYAHRLQKLLIVFDSVYG. 267
365 3.000e-57UniRef50_A0A0N8Q4N5 Flavo-diiron protein FprA1 n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0N8Q4N5_9GAMM  ali  39  1.MKSTDLYQGKHHKWIVFGRDQGKEKIIDTNQYMIVTNQQTMLLDPGGIELFSAMLAGILSHTELEKVTTLFASHQDPDIISSLGLWDKTIPNAKLYAPWLWEGFIRHFGMDNIEYKSIP--DEGQELRLDGVTFRFIPAHFLHSSGNFHVYDADAKILMSGD-IGAALEEPDAPMFVEDFAKHADKMRYFHQRWMPSNSAKKNWIARVRELDIDMMAPQHGRIFKGEAVQEFLEWFDNLEVGIV........ 242
366 5.000e-57UniRef50_U4JXQ1 Putative Metallo-hydrolase/oxidoreductase n=87 Tax=root TaxID=1 RepID=U4JXQ1_9VIBR  ali  41  1.MQTKVLFNQGTHRWIVFGRDPEKPDGIDTNQYMITHRDEAILLDPGGIELFSAMLGCVVKEVPVENITHLFASHQDPDIISSLGLWDQALPKAKLHSPWLWEGFIKHFGMENVDYMPIP--DEGKTLSLAGLELQFVPAHYMHSSGNFSVYDPQAKILMSGD-IGAALDAVDALMFVQDFDAHIPKMEYFHRRWMPSNRAKTAWIEKVSKLEIDMLCPQHGGIFKGDDVKRFLMWLDGLDVGV......... 241
367 8.000e-57UniRef50_A0A2J4G9U3 MBL fold metallo-hydrolase n=6 Tax=Thermofilum TaxID=2268 RepID=A0A2J4G9U3_9CREN  ali  39  2....ITLYSDEKHKVVVF-RGFTPRGHVQTNQIVIADSGEGLLADPAGRVVFSKLVSEVSLVVPAPKVKYVFFSHQDPDIVGAAASWYTALPNAKIVLPELWARFVPHLFPVNPTERFHLVPDEGAELRLGDCSLKLVPAHFLHSPGNFQIYDPCSRILYSGDLFASLMPEGQEYDFVSDLQAHIQYMEPFHKRYMAGNKAIQAWLSRVKALDIDLIVPQHGAIIRGDNVEKALKWLEQLKCGLDLL...... 246
368 8.000e-57UniRef50_F2LXZ7 Beta-lactamase domain protein n=1 Tax=Hippea maritima (strain ATCC 700847 / DSM 10411 / MH2) TaxID=760142 RepID=F2LXZ7_HIPMA  ali  25  13..............IFWVGAVIPQDQ-FQCHVYLIRNGDESILIDPGSRITYDITKKKIEQLVKLKDIKYLICHHQDPDIIGCIDQLIKDTGKAEIITHWRAWALLKH---CDWDAKLYEVEENGWKLKAGDRLLKFIFTPYMHFPGAICTYDTETKVLFSSDIFGGFTPEFELFA--KNSEDYFEKLKPFHEHYMPSNSILRNGLSNIEKFDIELIAPQHGSIIKKEFIKPIIEKMKKLECGL......... 238
369 1.000e-56UniRef50_A0A1Y1RZH9 MBL fold metallo-hydrolase n=14 Tax=Bacteria TaxID=2 RepID=A0A1Y1RZH9_9SPIO  ali  52  13.....VLYEENDHKVIWLGWDADVSSGIQTNQYLIVNSGKGILLDPGGVHLFSRVVSVVSRFISLDDVESIFFSHQDPDVSSGIALWLGV-TKAQVYIHDIWRRFVPHFGLVDQSRITPLEDEGGSI-NLGSVSLKLIPAHFLHSAGNFSLYDPRSKILFSGDIGTAVFPEGREYPEVEDFENHTRLMEPFHARAMGSNQAAARWISMCRKLDVSILAPQHGAMMRGELVRKFYDWFGNLNCGIDHLKSLTG. 258
370 1.000e-56UniRef50_A0A1W9VAF6 MBL fold metallo-hydrolase n=1 Tax=Spirochaetaceae bacterium 4572_59 TaxID=1971727 RepID=A0A1W9VAF6_9SPIO  ali  16  1..MKTVKIADGIFRLGIFEGIWSIPDGTSINSYIVR-GDKTAVLD--LTQDQEDFIGSMTAQMDPENIDYIIVNHMEPDHSGWLREFRKKNPSMEIFCTKKAVALVEHFCGIT--DKVHPIENGETLDLGQGKVLQFFETPNIHWPETMMTYEQSEKILFACDAFGSYGKEDAVFDDQLSDDEHDEALRYYANIVASFSVFVERGLKKLEGLDIRMIAPSHGIIWRENPVERYSRYASYLPEITVIWGSMYG. 270
371 1.000e-56UniRef50_A0A139DSP8 MBL fold metallo-hydrolase n=2 Tax=unclassified Deltaproteobacteria TaxID=45456 RepID=A0A139DSP8_9DELT  ali  18  8..DKIYWVGAVDFGIRDF-HGYRTSSGSTYNAYLIIDE-KITLVDTVKKEFLPELLSRISKIVAPEKIDQVVVNHAEMDHSSALPGLMEVIGRDKIYISKLGEKIMKAQF--PSVEINYKTVGTGDSLSLGKLSLDFLETRMVHWPDSMFSFCPQLGVLFSQDGFGMHLATTRRFNDEVSRSVWYEALKYFANILTPYTITIAKTLQAMSGLKIKVILPDHGLIWRGEIVGLYAKWVKQEPKAVIVYDSMWK. 264
372 1.000e-56UniRef50_U2JIS6 Metallo-beta-lactamase domain protein n=1 Tax=Peptostreptococcaceae bacterium oral taxon 113 str. W5053 TaxID=1321784 RepID=U2JIS6_9F  ali  19  6MGKDIYHIGASDRRINRFENMIPLNNGLGYNSYLMADEDAVILVDSIDGAVLREWQDNIKDILQDRPIDYMLIQHVEPDHCAGIVATIKEYPNMKVYGSAKCFTLLNQFYQLNADTDRVVIVKEGDILETKNHKFQFIPAPMVHWPEVFMTYDLIEKRFFSADAFGSFKASGNYWADEVDMNEWWDELRYYINIVGRQGASVQKLFKKLEGIEIKEIMPLHGVCFKGENITKVLDKYDKWSSVVQVYASMYG. 270
373 1.000e-56UniRef50_A0A1V3SV96 MBL fold metallo-hydrolase n=13 Tax=Leptospirillum TaxID=179 RepID=A0A1V3SV96_9BACT  ali  45  1.MAVEVLHEEKDHTFFWLGDESGLEEGVQANQYLIVDGGQGLLIDPGGFGVFSRVLVNLSHHIDPQSIRDIFLCHQDPDVGGSLASWFEMTP-ACVHVSELWIRFLLHYGVNDVHRFRGIPDGGGSLTFPSGRKVDFIPAHFLHSPGNFHLFDHSSGILFTGDIGAAVYPKGQTPTFVTNFEEHVRYMEGFHGRYIPTNQVIQAWLARVRKLPVRMIVPQHGSIFREESVGKFFEWIGGIRCGLETM...... 246
374 1.000e-56UniRef50_UPI00036C8A35 response regulator n=1 Tax=Anaeromusa acidaminophila TaxID=81464 RepID=UPI00036C8A35  ali  26  1MSKDSQKPISLDNGVYWVGAAANQMPL-NCNPYLIVAQEEAVLIDPGSPLDFPQVWNKVTQLIPIEKLRYIVLQHQDPDFCASVPLWEQYCFQGQLVAHWRAIPIIKCYGVRSEFYNISQQEH--RLVFGQDHLLQFYPTPYLHSPCAFATYDPQSRTLFSSDLFGVLTEEAPLFADEWDGLNYLEAMKAFHEHYMPSSDILGSAMEVFSQLDLERIAPQHGSVIRRD-LPVYIETLRHLACG.......... 239
375 1.000e-56UniRef50_A0A2M8D4A8 Diguanylate cyclase n=1 Tax=Acidobacteria bacterium CG_4_9_14_3_um_filter_49_7 TaxID=1973888 RepID=A0A2M8D4A8_9BACT  ali  27  1MKPDAAKSVKLADNIYWVGNEIPDDQ-FQCHVYLIVNGEDSVLIDPGSRITWSETRKKIQEHLPLESIKYLVCHHQDPDITGAVDFLNREAPDRVIICHWRTKALVVHYDWKLS--FYRPEDHDWQLELPGGRQLQFIFTPYLHFPGAICTFDKASGILFSSDIFGAFTEKFKLFA---KDESYLEQMRPFHEHYMPSQEILNHGLNQIEKFKIRMIAPQHGSIIREDLVQPMMKALKELDCGLFLM...... 243
376 2.000e-56UniRef50_A0A1G1F4B6 MBL fold metallo-hydrolase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1G1F4B6_9BACT  ali  20  6IKPGIFWVGAIDWAVRDF-HGYITPNGTTYNNYLIKD-KHITLVDTVKHDFSDYTIDNIRDIVDPAKIENIVINHIENDHMTSIDRIMALAPKAVIYITERGKKGLDRFF--DASRWNIRLVKTGDTLSTGSKTILFLETPMLHWPDSMMSYVKEDKLLISQDGFGQHIASTARFDDEYCDQYSITALEYYANILMPFGPLIKAKLAEIQKLEIDMIAPDHGIIWRKDPVKMYLDMANGKARVVIIYDTMW.. 264
377 2.000e-56UniRef50_A0A2N7Q625 MBL fold metallo-hydrolase n=6 Tax=Bacteria TaxID=2 RepID=A0A2N7Q625_9DELT  ali  55  13ISNGEVLFEESGHKFIWLGWDESDIKGVQVNQYLIISNGKGTLLDPGGVHVFPKVVANVSRYIDLNDIKNIFYTHQDPDVSSGIAMWL-SITNANVYISKLWVRFLPHFGITDFSRIIPIEDNGGKIDS-----FEAIPAHFMHSPGQHVLYDPASKILFSGD-IGAAVFGSKTYLFVENFDSHVSLMEGFHKRYMASNAVCKNFVNRIRKYDINMIAPQHGAIFKKEEAKTFLSWLESLRCGSDIIDEI... 257
378 2.000e-56UniRef50_A0A2G6G7N8 MBL fold metallo-hydrolase n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2G6G7N8_9FIRM  ali  17  24...............ILFESMWKMPNGVTLNSYIVR-GEETAVIDCGWDGYPESLFKLLKECVKLESIKHVVVNHVEPDHSGWLKDFKKIHSDFTIYCTREAKSLLEMYYG---EFKNIVAVKNGEELDLGGRVLEFIKTPNVHWPDTMMTFDRESGTLFSCDCFGEFGILENHLDSEHKPKELEDRIRYYSNILGLFSMNVSKAISQIKNYDVKIIAPGHG-IIYKENTEYIIDKYEKVKNALIIWGSMYGV 272
379 3.000e-56UniRef50_F3KDX8 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=F3KDX8_9GAMM  ali  31  3.KSDVNEVIAITREIYWIGF-YEESSKLHCNPYLLLDDDEAVVFDPGSIPDFPVIMRKVIDLINPSQISTIVTSHQDPDVCGNLAVFEDVVPDLRIAAHLNTIRLIQH--QALKSELYAVDQHDFKITLKSGRELEFIFVPFLHSPGAIVTYDPKSKSLFTGDIFGAVDDNWSMFAGGDNFPQV---MASFHQAYMPANSHLKKAMEKLEKMDIERILPQHGSVIEGDQVQVAIDFLKELPCGLDLIED.... 246
380 4.000e-56UniRef50_A0A2R7Y3N9 Uncharacterized protein n=1 Tax=Desulfurococcaceae archaeon NZ3(B) TaxID=1973259 RepID=A0A2R7Y3N9_9CREN  ali  14  13IQKDFYMIKAEDTSIKYFEGLWEIPEGVTYNSYVLIGDEGSAVFDTVSRGFTKEFIEVLKSLIDVKDVKFVVVHHMEPDHSGALPELIKELNQAEVLGHPLTGRLIESLYGLKPRFR---PVKDGEVVKLGQHKLTFIHTPWLHWPETMLTYVEDLKYLVTCDVFGAYSIPKHVEIDVNQLPTEYEYRKYFANVIGYYRENILKNLNKLKQLNVEAIAPSHGSILKGENVEKALTLYESWSKVTVVYTSMYG. 274
381 4.000e-56UniRef50_A0A0S2K6K0 CDP-abequose synthase n=8 Tax=Pseudoalteromonas TaxID=53246 RepID=A0A0S2K6K0_9GAMM  ali  40  1.MKSTELYSSASHTWIVLGRDESPEKIIDTNQYLIKSAQEAIILDPGGVELFSPMLASILRHIDLEHVTTLFASHQDPDIISSLGLWDKTIPNAKLYAPWLWEGFIRHFGMENIEYVP--IKDDGGEVRIGSATLKFVPAHYLHSSGNFNVYDPQAKILMSGD-IGASLEHGEVPMFVEDFAKHVKHMEYFHRRWMPSNKAKNNWVSRVKELDIEIMAPQHGRIFKGEAVQEFLEWFAKLDVGI......... 241
382 4.000e-56UniRef50_E3E7C7 Flavoprotein n=77 Tax=Bacillales TaxID=1385 RepID=E3E7C7_PAEPS  ali  18  7LAKDIYWVG-KIDNREVPFHRLLLSKGTTYNAYLLKTG-KPTIVDTVDMAFGREFAEAVAELIDPLDIQYIIVNHTEPDHSGGLAALASKAANATIVCTEIAVPEIQQMYKL--QHRNFLVIKDGDQLDIGGKTLLFKETPYLHTEETMITYCIEDKILFPCDIFSTHVAVEHLFADEAGFDITEDFIGYYQAIIHPHRRYVRTLIEAVSDLDIEMIAPSHGFAIRHD-IAKFIDLYASMKKVAIVYATL... 258
383 6.000e-56UniRef50_A0A0B7GUG1 Metallo-beta-lactamase domain protein n=19 Tax=Treponema TaxID=157 RepID=A0A0B7GUG1_TREPH  ali  17  6LTDSVYCIHADIHDTARFEGLWMLPQGVSINSYIIL-GEKVALIDIVWDNSLESYKKQLANLLSFEKIDYVILNHLEPDHADLLATVHAANPNVEIIASAKGIAMVEKFFKI--SGNLRIVKNEDTLDLGKGKILQFFETPNIHWPETMMTYDVNEKILFSCDGFGSYGCIRQIFDDLHSEKELDEALRYYSNIVASFSNFVLRGIAKLQSLDIRMIAPSHGIVWRKNT-QRIIELYKKEKEICIIWGSMYG. 272
384 6.000e-56UniRef50_A0A2D0I6Q6 MBL fold metallo-hydrolase n=10 Tax=Campylobacterales TaxID=213849 RepID=A0A2D0I6Q6_9HELI  ali  43  1MNTETLLFDDTHHKCIMFEDEEHAEHSLSVNQFLIIQNDSAVLIDPGSESIFSELYEAISRHINPDKIKYIFFSHQDPDVAGAIAQW-SVATSAKLVISNLWVRFMGHYGLMDMNRIVGLEDHGAQI-SFGNDYLRFIPAHFLHSPGNFSLYDSRSKILFSGDIGAAIASPQNLNKKVDDFEEHRPFLEGFHHRYMASNLFCRAWVECVRRVDVMTIAPQHGSLFHGENAARFLEWFENVEGGMEQCKTLYGL 253
385 7.000e-56UniRef50_H2CK13 Stage II sporulation protein E n=2 Tax=Spirochaetes TaxID=203691 RepID=H2CK13_9LEPT  ali  25  26............PDIFWVGNVLE-NDPFQCHPYFIRNGKNSVLIDPGSMLQLEKIIEKITMACDLSDVRYIILHHQDPDLCAAVPHLEKLIPDLEIITHSRMSVLIKHYGIDAP---YYNIDQHNFVIDAGGRTLRFYTTPYCHSPGAFVTYDETSKVLFSSDIFGGLEDSWHFYADEN----YFKSIEGFHMAYMPSRDILNYALRKIEALDLELIAPQHGSVIRKPYIAPLIEQMKQMECGLYI....... 253
386 7.000e-56UniRef50_A0A146KGW0 A-type flavoprotein (Fragment) n=1 Tax=Trepomonas sp. PC1 TaxID=1076344 RepID=A0A146KGW0_9EUKA  ali  16  1.....VFWTGVIDWSIRHFHGYETANGTTYNSYLINDA-QPTLVDTVHHKFFDEFVARLTSVVQLDQIKYLICLHAEPDHSSAMPLIVPYLTSATILCTERCKTTLLKLYPTLQ-FARFQIVNAKSEISIGLKTLKFIPTPMLHWPEQMWCLCQ--NYLFSSDAFGQHQAVAEHFSDEIDLQCMYLAKEYYANILAPYQSQVGRALEVASQLTVNHVFTAHGVSFRNEHIQHVFKLYQQLQKIVLIYDTMYG. 250
387 1.000e-55UniRef50_A0A1V2M4V0 Flavoprotein (Fragment) n=1 Tax=Epulopiscium sp. SCG-D08WGA-EpuloA1 TaxID=1712377 RepID=A0A1V2M4V0_9FIRM  ali  18  2...............................................KNNFTDEFIENIKKHVDPSKIDYIVVHHTEPDHSGSLYKVLEYAPNATILASAIAIKYLKSIINKPF---KSQIVKDGDFISVGDKTIKFLSVPMLHWPDTIYSNIVESKILLTCDSFGAHYASKKTFYAELDEQYGLAFKYYFDVIMGPFKPFVLKALDKIANLDIEYICPSHGLIVDKTNIAEFKRLYKEWSSIIVPYVSAYG. 215
388 2.000e-55UniRef50_A0A2D5XDQ4 MBL fold hydrolase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A2D5XDQ4_9ARCH  ali  30  27.....IEISEGIYWLGFYDKN----AAFHSNPYIIKDGDEVVIIDPAGITEYPQVASKIFSMVNPSQITHIVLHHQDPDLCAAVPMLENAIENLKLVTHSRASVLIHYYG--VKSDFYLVDKNNYTLTLKSGRRLKFMTTPFMHFPAAIVTYDETSKILFSSDIFGGLSKDWKLYATEG----YQEQMAAFHRGYMPSNKFLRSFIEKIKPLNIEMILPQHGSIIKGDMVSKCMNFLKSLKCGIDLASSLYG. 268
389 2.000e-55UniRef50_Q5JIR0 Hydrolase, metallo-beta-lactamase superfamily n=33 Tax=cellular organisms TaxID=131567 RepID=Q5JIR0_THEKO  ali  41  14..KDHVLYRDEEHTVVYLGTQEGGED-VDVNSYLIVSRGRGFLLDPGGYKIFSKVLANASKYVDPRNIEYIYICHQDPDVAGSLPLWRE-ISNAKIVTHWLWTRFLPHFGFEDSKSVTHELPDEGETLNFGATTLEFIPAHFLHSPGHFTVYDRRSKFLFTGDIGIALLDDP--YIVVENMERHIQAMRPIHERLMASNRAIKAWLNRVRHLDVEAILPQHGAIIPKRHIPRFYDFLENLKCGVDLL...... 254
390 2.000e-55UniRef50_R9A2K9 Metallo-beta-lactamase domain protein n=13 Tax=Bacteria TaxID=2 RepID=R9A2K9_9LEPT  ali  42  1MKKIQTIYSDNDHKWSVIARDPAKPSLIDTNEYLIESDGMGLLTDPGGSEIFPEVFSALVEVFPASQIKNIFASHQDPDIVSSISLWLEVNPAIRCYVSWLWTGFLPHFGG-NAETFIPMPDEGMEIIH-QNIKLRSIPAHFLHSAGNLNLWDPKAKILFSGDIGAALLPIDETDLIVKDFDKHIHYMEKFHKRWMASEQAKVAWCERISHLKPDMLCPQHGSVFQGPDVERFINWFSELKIGMDALE..... 247
391 2.000e-55UniRef50_A0A1M4NBK4 Nitric oxide reductase n=12 Tax=Bacteria TaxID=2 RepID=A0A1M4NBK4_9CLOT  ali  17  6IADGIHMLTMNVDKI-LFEGMWELANGVTLNSYIVQ-GEKTAIVDGGWDGIPETLYKNLEEIVDPQSIEYLIVNHMEPDHSGWISNFRKIKDNFTVICTDKAAKMVSSFYG---EENIRVVKEGDTLDLGNGKVLSFHTVPNVHWPDTMYTYEQSTKTLFSCDMFGSFGCFDDELTPEEIDFFESEAIRYYSNVMGTFTASVKKAIDKAKTLDVKTIAPGHGIVYRSNPMDNYIRYAKYSEEVTILWGSMYGM 269
392 3.000e-55UniRef50_A0A1G3MY24 MBL fold metallo-hydrolase n=22 Tax=Bacteria TaxID=2 RepID=A0A1G3MY24_9SPIR  ali  18  7..NPKVWVHADIESKDLFEGIWPIPEGVSLNSYLVK-GQKTALVDCSAP---EELKKQLADAVDLTKIDYLILNHLEPDHTGWLAEFKKINPTVEIIATAKGVELVKSFYKINDGLR---AVKSGDVLDLGGVTLCFEEVPNVHWPETMATFEPESGVLFSCDAFGSYGKGNRVFDDEYYAEDHEESLRYYANIVASFSLFVKKAIEKLVKLPIKVVAPSHGLIWREKPIDRYLKFANQEKEICVVWGSMYG. 269
393 3.000e-55UniRef50_A0A1M4SC59 Metallo-beta-lactamase superfamily protein n=6 Tax=Bacteria TaxID=2 RepID=A0A1M4SC59_9THEO  ali  26  6.VDKAVKLDEGIYWVGYFDESASL----HCNPYIIDDGEDVVFIEPGSVPHYPIVLNKVVSIIDIRRINYILESHQDPDLCASIPKFEEVIKDLKVVTHSRAAILMAHYG--FKAPFYYVDQNEWKLTLKSGRTLRFIFTPYCHFPGMFVTYDEKSKILFSGDIFGAFSYDWNLFA----NKYYIEAMKAFHENYMPSKEILNRAMEKIEQLDIKMICPQHGSIIDKD-IQKYIDALKELDPGDYMY...... 242
394 4.000e-55UniRef50_I4D921 Diguanylate cyclase (GGDEF) domain-containing protein n=7 Tax=Bacteria TaxID=2 RepID=I4D921_DESAJ  ali  29  1MNTNVVEIAEDIFWV----GGSDQEGGLHCNPYLLIDGDEAVLIDPGSVLDFDYVFENVCSIVPLAKIKYIVLHHQDPDLCASVPLFEQKGAVFEVVTHWRTQTIVKYYGI--KSKYYSVNEHDFRLTLKSGRVLGFVQTPYLHFPGAIATYDYSSKTLFSSDLFGAFSYGWSLYAGED----YLEKMKTFHEHYMPSNDILRPVMEVFLGMDISMIAPQHGSIIRNN-VTKYIKALRDLECG.......... 232
395 4.000e-55UniRef50_A0A192ZJF7 Flavoprotein A/ ferredoxin n=2 Tax=Stygiella incarcerata TaxID=1712417 RepID=A0A192ZJF7_9EUKA  ali  19  173.VSDKVYCIGAVDWSLRDFHDFQVREGGTYNSYFIKD-DFVAVIDPVKYTFADGWVERIKSLLGKKEPDFIIVNHAEPDHSSGIVSFMRAFEGPTVVCNKLCKESLEKLYPEPSSWNYRIVKSGDELKLSKDRTLHFLNTPMVHWPESMFTYDAKDGILFSMDAFGQHYPSSARFDDEVPSIEHQDAKTYYANILFRLSKPIKATLKKLSSFELQVIAPSHGVVWRKEILQKYVEWVSHKPKVVIAYDTMW.. 436
396 5.000e-55UniRef50_U1FIS3 Metallo-beta-lactamase domain protein n=1 Tax=Treponema socranskii subsp. socranskii VPI DR56BR1116 = ATCC 35536 TaxID=1125725 RepID=  ali  49  10....IVLYEDDDHKFIWLGSESKYRKGVQTMQYLIIDHGKGVLLDPGGVHLFSRVVTAVSRFISVEKIDTIFFSHQDPDVSSGIALWLG-ITHAKVYISNLWIRFLPHFGIVDTNRIIGIPDSGMDIMLAPDSRMHCVPSHFMHSPGHFGLFDERSGILFTGDIGAAVFDETNETVYVGDFNEHIPLIKDFHVRYMAANKIVRRWVEQVRLLNPAMLAPQHGAIYKDENVGNFLNWLGNLQCGIDLIDTLF.. 256
397 5.000e-55UniRef50_A0A1G6QJ65 Metallo-beta-lactamase superfamily protein n=1 Tax=Geotoga petraea TaxID=28234 RepID=A0A1G6QJ65_9BACT  ali  50  3IIEPKVLFENEDHKFILLGIEDSQKQGVTTNQYLVVHKDEGVLLDPGGVHVFPMVLSNVVEFISPQKIKGIFYSHQDPDVSSGISLWANSI-NSKFYVSGLWERFLPHFGVFDNSKIVPIKDNGGKITFSDGYSMDIIPTHFLHSIGNFTVYDSISKILFSGD-IGTAVIEAKGNVFVDNFQDHIKNIEGFHKRYMTSSKACKVWSKLIKNYDIELMAPQHGLLYKKQEYKEFLKWFENLKCGIDIIENIYGV 253
398 5.000e-55UniRef50_A0A2N1R3Y5 MBL fold metallo-hydrolase n=29 Tax=Bacteria TaxID=2 RepID=A0A2N1R3Y5_9SPIR  ali  51  10....VVLFDDGDHRFIWLGGEAKTRKGVQTMQYLIIDKGRGVLLDPGGVHLFPRVVAAASRYISIDRIDTIFFSHQDPDVSSGIALWLGV-TSAKIYIAELWIRFIPHFGIVDQARIVAIEGVGKSIRLASGAELTFVPSHYMHSPAAYSLFDRRAGILFTGDIGGAVFPDGAETLYVDDFKAHVKFIEGFHRRLMASNSVTKRWVENARRLAPTMLAPQHGALYRGDSVGAFLDWLSALRCGVDDLDALYRM 258
399 5.000e-55UniRef50_M1R7N1 Metallo-beta-lactamase family protein n=1 Tax=Hydrogenobaculum sp. HO TaxID=547144 RepID=M1R7N1_9AQUI  ali  47  1MVNCIKLYDDGNHKFILLKGMRLSGDYIWTNEYMIVEKNYAVLIDPGSIYSFFQVYDSILDYVSSDDIKIVFYSHQDPDLASGITMLMA-NTKADVYISKLWKRFISHFGIKDMTKIKEIPDNGMSIILPSGNEIEFIPAHFLHSVGNFSLYDKKSGILFSGDIGASIVTNEEEGIFVEDFDEHLPKMESFHKIYMQSNIVCRRWVEQVRKRNVNMIAPQHGKIFKGENVNKFLNWLYQLRCGLDILDDIY.. 250
400 1.000e-54UniRef50_A0A2H5WJK7 Diflavin flavoprotein A 1 n=25 Tax=root TaxID=1 RepID=A0A2H5WJK7_9BACT  ali  51  11...........DHKVAFYE-ELTPASAVQANQYLIIHKGEGVLLDPGGHKVFSKLLSDISVLIPPSNIKYIFLSHQDPDIVASINGWL-MTTKASAYISKLWMRFLPHFGLDTQEDRVLPIDDGGTKVNLNGCELLILPAHFLHSPGNFQVYDPCSKILFSGDLGASLGQD---YFFVEDFDAHIKYMEGFHRRYMASNKILKFWVNMVRQLDIETIAPQHGAIFKGEMVDKFLNWLENLEVGVDLMTQ.... 245
401 1.000e-54UniRef50_A0A1N6QYD2 Flavorubredoxin n=5 Tax=Spirochaetes TaxID=203691 RepID=A0A1N6QYD2_9SPIO  ali  16  6VTENTWRLSANVTDI-LFEGMWPIPEGVSMNSYIVK-GEKVAIIDGVWDGTPQVLFDQFAQMIDYNDIDYVVINHMEPDHSGWLEDFKKIRPDFKIVTTAKAQALLKAFFEIDNE--VMVVKSGDTLDLGNGHVLAFEEIPNVHWPETMATFDTKTGTLFPCDAFGSFGAITDSPYDEEIDFFERQASRYYANIVGPFSGPTQKAIAKTEKLPVKIIAPGHGIVWRSNP-QKIIDDYKRYEEITVIWGSMYG. 269
402 2.000e-54UniRef50_A0A2N0XPV2 Flavoprotein n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A2N0XPV2_9VIBR  ali  40  1.MQAKVLFNQGSHRWVVFGRDPEKPDGVDTNQYMITNRDEAILLDPGGIELFSAMLGCVVKEVPIENITHLFASHQDPDIISSLGLWDQALTKAKLHSPWLWEGFIRHFGMEKVEYAPIP--DEGRNLNISGMEIQFIPAHYMHSSGNFSVYDPQAKILMSGD-IGAALDAIDAPMFVQDFDAHIPKMEYFHQRWMPSNRAKTAWIEKVSKLEIDMLCPQHGGIFKGDDVKRFLIWLGKLDVGV......... 241
403 2.000e-54UniRef50_F9ZZV4 Metallo-beta-lactamase family protein n=25 Tax=root TaxID=1 RepID=F9ZZV4_METMM  ali  37  1MKMTKIY--EGAYQWIMYGRDYKPDNIIDTNQYLVRTENRCLLIDPGGVELFAPMLAAVLHHAPVEEITDLFASHQDPDVISSLGLWDQALPHAKLHAAALWEGYLRHFGC--ESIQYMPISDNGGVINLGSVELQVIPAHYLHASANFNIYDPQAKILFSGD-IGAAFEAPDQPVFVEKFDAHIEKMRFFHQRWMPSNQAKRAWIERVRSLDVDILAPQHGRMFKGDDVKRFLDWFEALQVGI......... 240
404 2.000e-54UniRef50_A0A2E9QA82 Uncharacterized protein n=1 Tax=Spirochaetaceae bacterium TaxID=1898206 RepID=A0A2E9QA82_9SPIO  ali  25  51............RDIFWVGI-YLENDPFQCHPYFINNGRESILIDPGSMLQRQDIIKKIEMACDLRDIKYIILHHQDPDLCAAVPYLEKLIPDLQIVTHSRMSVLIKHYGLQ---SGYYNIDQNDFQLKAGNRLLQFYTTPYCHSPGAFVTYDQETKVLFSGDIFGGLEDSWHFLADEN----YFQHIEGFHMAYMPSRDILNYALRKIESLDIELIAPQHGSIIQKKYIPGLLEKMKQMECGLYI....... 278
405 3.000e-54UniRef50_UPI000470DC97 FprA family A-type flavoprotein n=1 Tax=Paenibacillus massiliensis TaxID=225917 RepID=UPI000470DC97  ali  16  7ISKDIYWVGKIDDR-EVPFHRLLLTKGTTYNSYLLKTG-KPTVIDTVDMEFGREFAEHITGLIDPLDIQYIVINHTEPDHSGGLAALAARAVNATIVCTEVAVPEIQQMYKL--QHRSYLVVKDGDTLDIGGKTLLFKETPYLHTEETMITYCLEDKILFPCDIFSTHVAVNSLFADEAGFDVTEDFIGYYKAIIHPHRRYVRTLIEAVKDLDIQMIAPSHGYILR-HNINNFISLYADMKKVAIVYTTL... 258
406 3.000e-54UniRef50_A0A1V4SDV7 Anaerobic nitric oxide reductase flavorubredoxin n=7 Tax=Firmicutes TaxID=1239 RepID=A0A1V4SDV7_CLOHU  ali  17  5.IKDKIFWVGKIDDRKVPFHRLILERGTTYNSYLLMTE-KPTVIDTVDIEFGREYVENLRKLIDPAQLEYIVINHVEPDHAGALPALAAAAKKAKIVTTELGGRLLKDMFRLHHREFI--LVKDGDSLDIGGKTLRFFETPFLHTEETMITYSVEDRTLFPCDIFSTHIAAGELYNDLAEEEYVEDFKLYYKLIMSPHRPYVENMLDKLKGLSIDVIAPAHGYILREDA-GSFIRLYQEMKKVTIVFSTMTG. 259
407 3.000e-54UniRef50_A0A2P1PNS4 MBL fold metallo-hydrolase n=7 Tax=Xanthomonadales TaxID=135614 RepID=A0A2P1PNS4_9GAMM  ali  38  1..MPTELFHQGTHRVVAFNDLVRGDDGVQANQFLIQHGDQSMLLDPGGALLYTPLSLALSRYVQLKQLNYIFASHQDPDVIGSADRWLTYTP-AKIICSKLWGRFVPHHYMETGADRYLLLPDEGAEIVFGDTTLKCLPAHFLHSVGNFCVYDPISKILFSGD-VGSSMVTDEPYAPVTDFRSHVRTMEGFHRRYMASNRACRIWTQMVRQLDIQLVVPQHGLPMAGDAIPAFFDWMEELRCGVDLMT..... 247
408 3.000e-54UniRef50_A0A1M5QK53 Diguanylate cyclase (GGDEF) domain-containing protein n=1 Tax=Clostridium grantii DSM 8605 TaxID=1121316 RepID=A0A1M5QK53_9CLOT :  ali  32  1..MDIKYGCEEIYNIYWVGS-YDKLNGLHCNPYLIIDGDEAILIDPGSVIDFEIVYKNVTSLIDIEKLKYIVLSHQDPDICSSTPLFEKKGVNAKIITHWRTGTIADHYGI--KSKKYIVNENRYEITLKSGRKLKFIPTPYLHFPGAIVTYDAESKILFSSDLFGAISTKWSLYADE----SYMEVMKTFHEHYMPGNQILRPVMEVFLKMDISMIASQHGSII-KENVKNYIMELRDLQCGVLL....... 237
409 3.000e-54UniRef50_A0A1B9F5J8 Diguanylate cyclase (GGDEF domain) n=1 Tax=Dissulfuribacter thermophilus TaxID=1156395 RepID=A0A1B9F5J8_9DELT  ali  23  16.............DIFWVGCVIPQDS-FQCHVYLINNGDESILIDPGSVITFSETIKKISEITQLKNIKYLICHHQDPDITSCISRLEKLINDKFIVTHWRAQALLKHYQWETPFWLIDQ--NDWQLNLKNGRRLRFIFTPYAHFPGAFCTFDETTKTLFSSDLFGGFTKTFSLFAQDEN---YFEEMKVFHEHYIPSKEILYNALVQIERYNPELIAPQHGSIIKKELIQPMINRLKELECGL......... 242
410 4.000e-54UniRef50_D3PAW3 Uncharacterized protein n=1 Tax=Deferribacter desulfuricans (strain DSM 14783 / JCM 11476 / NBRC 101012 / SSM1) TaxID=639282 RepID=D3  ali  27  14.............DIFWVGHEL-PDDPFQCHVYLILNGKGSILIDPGSKITFKYALEKIEQIIPFSYIKYFICQHQDPDITASLEIIRDLLDDAVIVSHWRAIALLKHYNLNIP---MICVEKENWKLNAGGRELEFIFTPYCHFPGAFCTYDKKSKVLFSSDLFGGFTDRFKLFAEDIN---YFDSIAAFHEPYMPSKEILVHSLKKIEQYDIDLIAPQHGSIIRRDLIKPIINKMKNLDCGLFLLTQ.... 244
411 9.000e-54UniRef50_V6LVZ9 A-type flavoprotein n=1 Tax=Spironucleus salmonicida TaxID=348837 RepID=V6LVZ9_9EUKA  ali  18  8MLPDIYFVGATDWSVRKF-HGYDTAEGSSYNSYLILD-QFPTIIDSVKAPFSMEQITRIEQIVPLDAIKYLVINHAEGDHTSALPILVPYLQNATIVCNQKCKDYLIKMYPTIQHQDFQIIDARSELV-IGKRILKFIPQTMLHWPESMWTYSAYDEIIFTNDGFGQHIASCDRWADELPLTRVMHLLRYIANILGPFPGPIRKCIDSLKNLKVSYLLTAHGLSWRNEFIKYPLEEYNAYDKILIIYDTMYG. 264
412 1.000e-53UniRef50_F7MRY9 Lactamase (Fragment) n=1 Tax=Clostridium botulinum C str. Stockholm TaxID=929505 RepID=F7MRY9_CLOBO  ali  19  1.................................LINDE-KVVIIDSVKDGFWNKSIESIKQIIGNKKVDYIVVQHTELDHSGSVIKFIEEYPHATVIGTIATLNYLKEIVNKDFKGKNINEIKE---LNTGSNTLKFISVPNLHWPDTMITYIPEQSILFTCDITGAHYCNGCIESDLDNAEYVREFQYYFNCIMSPFKKFVLSALDKIKDLKINMIFPSHGPIHKDKNVEKVLELYRLMATVQILYASAY.. 223
413 1.000e-53UniRef50_A0A2A2TD57 Flavin oxidoreductase (Fragment) n=1 Tax=Calothrix elsteri CCALA 953 TaxID=987040 RepID=A0A2A2TD57_9CYAN  ali  17  12IATDTRVFRSRSWARLRFEIEYALAKGTTANCYLI-EGEKIALIDPPGETFTEIFLKALQERVDIKKIDYVILGHVNPNRAATLKALQEIAPQITFVCSNPGAINLR--SALENPDLPILVKRGEETLDLGGHHLEFVPTPNPRYPDELCTYDPQTEILYTDKLFGAHICGDQVF-DEGWQSFLEDRKYYFECVMAPHARQVETSLEKLSDLKVRMYAPNHGPLVRYGLIDTYREWLQQENTVALIYASAYG. 267
414 2.000e-53UniRef50_A0A1W1BZC2 Histidine kinase n=2 Tax=hydrothermal vent metagenome TaxID=652676 RepID=A0A1W1BZC2_9ZZZZ  ali  27  4.KMDFEYPVEIAPRCWWVG-MYMQDDPFQCHPYLIENGDESILIDPGSMLEFDHVIKKISQTTALSNIKYIVLHHQDPDLAAAVPAIEKLIDDLQIVSHSRMSPLLKHYGISSSYYEVD--KHNMQLKTKNGLCITFIATPYCHSPGAFVTYEPKNKILFSGDIFGGIEASWSFYAGED----YFEQAKQFHSEYMPSREIFNYTLNSIEALEIDLIAPQHGSIIQKPYIERLINQMKQLECGLYI....... 243
415 2.000e-53UniRef50_A0A1D3TT19 Diguanylate cyclase (GGDEF) domain-containing protein n=1 Tax=Anaerobium acetethylicum TaxID=1619234 RepID=A0A1D3TT19_9FIRM  ali  32  14..............IYWVGGN--LEENLQCNPYLIVDGDEAVLIDPGSVLDFEAVYENVCSVVPLEKIKYVILHHQDPDFCASVPLFEAKGCRFQIVTHWRTSTLLVYYGI--KSDFYIVNKNRFMLTLASGRVLEFVQTPYLHFAGSIATYDRQSGTLFSSDLFGAFSKSWSLYAG----DDYVEGMKAFHEHYMPSNRILRPVMSMMMEMELNMIAPQHGSII-NRDVKKYIRILRDLDCG.......... 233
416 2.000e-53UniRef50_A0A0F9AY92 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9AY92_9ZZZZ  ali  21  1..MSTVEVRNGIHWVGAVDHGYITPRGSTYNNYLIID-HEPAVVDATHREFIDQSIDNIKSLVDISKVRHLVLNHIEPDHAGGLFELLALMPEARIYCTKKAVEAMERMFDISSWDIRQ--VKTGDTISTGTKTLMFLETPMLHWPDSMMTYVKEDKVLISQDGFGQHLASAQRFDDEFVKCSSMSELEYYANILMPFGSLITRKLKEVQDLEIDIIAPDHGIIWRSHP-EKVLQMYGDMASG.......... 250
417 3.000e-53UniRef50_A0A2A4WR12 Flavoprotein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A4WR12_9GAMM  ali  39  1.MKAISLFQEGSHQWICFGRDPEREKIIDTNQYMVMSNDQSIVLDPGGIELFSQMLTSVLKYTSLENITALFASHQDPDIISSLGLWDQCLPKAKLYSPWIWESFIKHFGMNNIQFE--GIPDEGSDFHLGNTTLNFIPAHYLHSSGNFNVYDSKAKILMSGD-VGAAMDKDEAPFFVEDFDAHIPKMEFFHRRWMPSNKAKDDWIARVRKLDIEIMAPQHGGLFRGEMVQEFLDWFERLDVGI......... 241
418 1.000e-52UniRef50_A0A0G1T0F2 Uncharacterized protein n=11 Tax=Candidatus Azambacteria TaxID=1752741 RepID=A0A0G1T0F2_9BACT  ali  30  15.....IEIHDGIYWVGFHD----EKTKLQCNPYLIIDGEEAVLIDPGSVLHFPVVARKIFSLVKPEQISHIILQHEDPDICGAIPLYVEMIPDLKVVCAMPAYYFIIHYDIKSPYYLSD--ANNNLLTLKSGRILRFVDAPYLHTPGVIMTYDEKSKILFSSDVFGSLEAEWRLFADENYPPRLSKLMELY----MPSKEAVLYTLKKMDKMSIEMIASQHGSIIKSEPVKKYIEICKNLNYGLYL....... 250
419 1.000e-52UniRef50_Q2VZD5 Uncharacterized flavoprotein n=16 Tax=Proteobacteria TaxID=1224 RepID=Q2VZD5_MAGSA  ali  43  1.MKCVTLFRQDDHCWQMFGQDPKPDNIVDTNQYLVRSGDSAILLDPGGMEVFPAMLAALTREVPVSHLKALFLSHQDPDIGSSLPLWRRVCPDIKIYLSWLWSSFTAHFDR--EATFTTIPDEGMEISLTPDLRLRFVPAHYLHSSGNFNVYDPKAKVLFSGDIGAALIPKDSGSMFVADFASHVQYMEAFHRRWLGSAQARDAWCAQVSKLDIDFLAPQHGLVFKGDDVKRFIDWFAGFEIG.......... 244
420 2.000e-52UniRef50_A0A1I5RV87 Diguanylate cyclase (GGDEF) domain-containing protein n=1 Tax=Hydrogenimonas thermophila TaxID=223786 RepID=A0A1I5RV87_9PROT  ali  27  9.INDPVEIAPKIWWVHVLDGDP-----FQCHVYLIDNGKESVLFDPGSKLTWPYTRKKILQLMPLENIKYIVCHHQDPDITSGITDMLDEIGGRFLVTHWRVYELLEHY---DWGIDFYEIQDNGWKLKAGDRTFNFIFTPYMHFPGAFCTYDPETKILFSSDIFGGFTKEFHLYA--KDAKSYFESMVPFHTHYMPSKQIVNHGLDNIEKYEIDLIAPQHGSIIKKEMIPYIIKHLRELECGIYL....... 246
421 2.000e-52UniRef50_A0A1S7LHC7 Uncharacterized protein n=1 Tax=magneto-ovoid bacterium MO-1 TaxID=451514 RepID=A0A1S7LHC7_9BACT  ali  29  14............DDIIWVGY-HDEEASLHCNTYLLLDGDEVILIDPGSIPYFPVIARKIIEVVEPQRISTIIVTHQDPDVCGNLPDVVER-SDLIIVAHPTTTWLIKYYG--VKSQLVPVDEIGYRVITEKGRILEFIPTPYLHSPGAACVYDHQTRTLFTSDLFGGVDEEGDGWSLFAPSN-YMEMMEPWHQSTMPNNHTLRRGMEILQQYDVARICPQHGSVIEGEEVKQAIALLKELPCGLDLME..... 248
422 2.000e-52UniRef50_A0A2I0N147 Flavoprotein n=1 Tax=Clostridiaceae bacterium JG1575 TaxID=1658742 RepID=A0A2I0N147_9CLOT  ali  17  5IADGVQLVSLNVENL-LFEGMWEMPHGVTLNTYIVQ-GEETAIIDCGWDGIPETLYELLDQAVSLESIRHLVVNHMEPDHSGWIEDFQKLHKDFEIWATKEAAAMIRSFYR---FEGTIHEVKDGDTLDLGGKILRFTKAPNVHWPDTMMTLDESTGCLFCCDAFGAFGKLDQHLASEHSNESLREQLRYYAGILGTFATFVGKGIDKAQALPVRMICPGHGLIWDGEEMERIYNDYRRYESVAIVWGTMYG. 268
423 3.000e-52UniRef50_A0A258TLD9 Flavoprotein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A258TLD9_9PROT  ali  39  1MKRLETLYSEGRHQWLVIARDPDRPNLIDTNEYLVVHGNEALLTDPGGLEIFPVVFAALAAGFDPRQVRWLFASHQDPDVISSLSLWLEFNPALRCYASQIWDSFLPHFGG--DEHTFIGLPDAGAKIPLGGIELEAVPAHYLHSSGNLHLYDAKAKILFSGDVGAALLPVEESALFVTDFDRHIRHADGFHRRFMGSREAVLNWCERAAAMPIDLLCPQHGAIYQGADVMRFINWFSELEVG.......... 242
424 3.000e-52UniRef50_E8T373 Beta-lactamase domain protein n=5 Tax=Desulfurobacteriaceae TaxID=558314 RepID=E8T373_THEA1  ali  35  15LSSPVILYEEGGHRVAWVGSAEETM--FRCNAYLIGSEEVHLLLDAGGNQHFEQVVKRVERLLDPSKVTHLVFHHQDPDVAGSVSRWLEINPDAVIVTTPRTKVLLPYYSIDPARVKWLDVLDDTTIKLPAGGRALFISAPFLHFPDAFVTYDTRSKILFSGDIFAAIQKKWELV--VSNWKRHQIEMSYFHIYYMASNKALRFFVNKVKDFPVEAIAPQHGSIIPKELVADAFEFLRTLKCGTDLL...... 264
425 3.000e-52UniRef50_I3TFJ5 Beta-lactamase domain protein n=1 Tax=Thermogladius calderae (strain DSM 22663 / VKM B-2946 / 1633) TaxID=1184251 RepID=I3TFJ5_THEC1  ali  15  33..............TKFFEALWEIPEGVSYNAYVVDYGQGVILVDGWKTGYGPLLVDKLRQLGVLDRLSHVVVNHMEPDHSGSLPEVLEAKKGVRVLGHPLTRKLIKDFYGLEPDFK---PVADGERMSVGSLTLRFSHVPWLHWPETIVSQVEELGVLFTCDIFGSFGSHRAVALRELGEEQRREARKYFADVVAHYRDFVVKASGKLKE-AIELVAPGHGLVLDRAEASGLLDLYLDWSKVLLLYASMYG. 278
426 3.000e-52UniRef50_H1S4C1 Beta-lactamase-like protein n=2 Tax=Cupriavidus basilensis TaxID=68895 RepID=H1S4C1_9BURK  ali  37  339.TMAITLYDAGGHTCLLFSDLVEEEHGVQTNQFLIVDAGHGALIDPGGHMTYGELYLAISRYFPPKQLDYVLASHADPDIVASVGRWLT-ASDSRILISRVWARFLPHFCQAGKTQGRIVTIPDGMPIALGNCTLLAVPAHFLHSEGNFQFYDPISKILFSGDLGAAMTSAQEAGAVVSDFAAHTHAMLPFHQRYMSGNRACRLWANMARGLDIEWIVPQHGPSFRGKAVAQFIDWVSTLECGLDLLSQ.... 589
427 6.000e-52UniRef50_A0A2N0V2A3 MBL fold metallo-hydrolase n=82 Tax=Proteobacteria TaxID=1224 RepID=A0A2N0V2A3_9GAMM  ali  40  1MRMTKIY--EGAYQWIMFGRDHKPEKIIDTNQYMVRTANRCLLIDPGGIELFAPMLAAVLHHAPVEEITDLFASHQDPDIISSLGLWDQALPNAKLHASALWEGFLRHFGCETIEYVPIP--DHGGVINLGTTELQIVPAHYLHASANFHIYDPHAKILMSGD-VGAALEPPGTPVFVDNFDMHVDKMRFFHQRWMPSNQAKRAWIDRVRKLDIDILAPQHGRMFKGDDVKRFLDWFEALQVGI......... 240
428 9.000e-52UniRef50_A0A1M6JZ50 Diguanylate cyclase, GGDEF domain n=5 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1M6JZ50_9FIRM  ali  31  3IIEHIYHVGDL-----------KTLNGLECNPYLLIDGEEGVLFDPGSKLDFEIVLENIKKLIDIDKIKYIVLHHQDPDFCSSVPLFENAGVKAEIVTSWRTMTLVQYYGIQ--SEYYLLEEHEHELVMGSGRVLRFLPTPYLHFAGAFATYDTKTEVLFSSDLFGAFSNNSTLYAD----DEYMDKMLAFHEDYMPSNSVLRPVMDTLSRISITMILPQHGSIINKE-IPKYIKALRTLECGTLL....... 230
429 9.000e-52UniRef50_K9U1W3 Flavin reductase domain protein FMN-binding protein n=24 Tax=Cyanobacteria TaxID=1117 RepID=K9U1W3_9CYAN  ali  14  17...DTTIVRSRSWARLRFEIEYALAKGTTANSYFIQ-GDKTALIDPPGETFSQIYLEALQQRFDLKSLDYVILGHVNPNRAATLKALLEVAPQITFVCSNPGAKNLR--TTMESEDLSILVMRGDETLDLGGHLLQFIPTPNPRYPDHLCTYDPQTEILYTDKLFGAHLCGEQVF-DEGWEIFNEDRRYYFDCVMAPHARQVETALEKLAELPVRMYGVGHGPIVRYGLIE-LTQAYRQWSKVALLYASAYG. 269
430 1.000e-51UniRef50_F0S2R7 Diguanylate cyclase n=1 Tax=Desulfurobacterium thermolithotrophum (strain DSM 11699 / BSA) TaxID=868864 RepID=F0S2R7_DESTD  ali  26  1.MDNIVEIAENTYWV----GSYIQDDFFQCHSYLIKNGKESILIDPGSLITFEETLKKLKYLINLDDIKYIVCHHQDPDLVSALPEIEKVFPDREIITHWRTYFLLRHYNLLTPFYLVDQ--HEFKLELENGKELKFILTPYMHYAGNIVTYDPETKVLFSSDIFGGWIEK--NWSLFAKGEEYIEAIKTFHETYMPCKKIILHSIEKLKKLDIEVIAPQHGSIIKGKDIKKIMLAVENFEYG.......... 242
431 1.000e-51UniRef50_A0A1D2W8T0 MBL fold metallo-hydrolase n=6 Tax=Euryarchaeota TaxID=28890 RepID=A0A1D2W8T0_9EURY  ali  17  1MKAESIKIKEGVYWVGVLDWDLRTYHGTSYNAYMVFGEDKAALIDNSYPGTFPELIARVEDACKKEKVDVIVQNHVEKDHSGVLTDLHKKFPEAPVYCTEIAVEGLKKHFPGVSDVNFVTVGTGDAL-DLGGKTLAFLDAFLLHWPDSMFTLYAEEGILFPNDAFGQHLCFPQLYDNEIPDYVLMDAKKFYANLITPISKLVLKKFQEVTDLQIKMIAPAHGQIWTDPMIGAYSDWAKCEDKITIIYDTMH.. 268
432 3.000e-51UniRef50_UPI0003013AE3 MBL fold metallo-hydrolase n=1 Tax=Pararhodospirillum photometricum TaxID=1084 RepID=UPI0003013AE3  ali  24  14...NAIEIAPGLWWV----GHYLPGDPFQCHVYLLDHGDQSVLFDPGSALTFRHTLRKIEQVLPFDRIRYFVCHHQDPDITGALPLVDQLVPDAVVVTHWRAEALLRHYGLALPFWR---VDDHGWRLDLGGRILRFVFTPYAHFPGAFVSFDEATGTLLSSDLFXGFTEG---FSLVARDESYFEALRPFHEHYIPSRDVLQNALNAVRELPLQAIAPQHGSILPEPLIGPLIERMMSLECGLFLLA..... 250
433 5.000e-51UniRef50_Q96YJ5 Uncharacterized protein n=16 Tax=Sulfolobaceae TaxID=118883 RepID=Q96YJ5_SULTO  ali  49  5..EPNIIFEDDKHKFIWLGLDESEEKGILTNQYLIVHEGKGYLLDPGGYFVFERVYQNVTRFVKPENIVTILYSHQDPDVIGSLNLWVDLAPNATFYVSALWERFLPHLGAELKGRIVDIPDEGMSIDF-----IRAIPAHFMHSPGNFHYYDTYAKIYFSGDL-GAAIFKDKWYLFVEDFESHIKLMEPFHRRYIASKKAIDIWLKKIEGLEINVIAPQHGAIFEGENAKKFIQWLRNLDKGLDLME..... 246
434 5.000e-51UniRef50_A0A1T2KUJ9 Uncharacterized protein n=1 Tax=Solemya elarraichensis gill symbiont TaxID=1918949 RepID=A0A1T2KUJ9_9GAMM  ali  24  21.............RVWWVGYTI-PDDHFQSHAYLIEQGDQSVLIDPGSPITFDQTLRKIEEIIPFSHIRYFVCHHQDPDITAALPEIDARLERAVVVTHGRAAVLIKHYGLDIPFWPFWHIEENEWSLQLEDRELRFVFTPYAHFAGAFCIFDNISKVLFSSDLFGGINEEFELFA---ESESYAESMRLFHEHYIPSREVMGFALTRIQEYPIETIAPQHGSIIRGGLVEYCINTLRKMDCGLYLLA..... 260
435 7.000e-51UniRef50_A0A1F6GBI6 Flavoprotein n=3 Tax=Candidatus Lambdaproteobacteria TaxID=1817794 RepID=A0A1F6GBI6_9PROT  ali  42  1MKKYHVLFERGEHRWTVLYMDPKKPDILDSNEYLISHRDDHILLDPGGFAVFPAVLSTLVQVVDPMKINRVFASHQDPDIASSLSLWQEINPQIKCYISWLWKSFVPHFGGT--EETYISIDDKGMVIDLGGYKLDVIPAHHCHSAGNFHLFDRQAKIYFSGDIGAALLPDDQRHLFVQNFEAHIPHIEYFHRRWLGSNDHKNAWCARVAELDIQLLCPQHGSIYKGEQVKQFISWLRGLNVG.......... 242
436 7.000e-51UniRef50_Q53H82 Endoribonuclease LACTB2 n=119 Tax=Vertebrata TaxID=1261581 RepID=LACB2_HUMAN  ali  19  13...........NRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPA-IPEYISCLKQALTNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTP-GHTDDHMALLLEEENAIFSGDCILGEGTT-----------------------VFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAKIQQYISHRNIREQQI......... 224
437 1.000e-50UniRef50_L0A9W5 Putative flavoprotein n=1 Tax=Caldisphaera lagunensis (strain DSM 15908 / JCM 11604 / IC-154) TaxID=1056495 RepID=L0A9W5_CALLD  ali  18  10IAENLYLLRVSDNDTKYFEALWEIPEGIMYNAYLIKTKEGNVLIDGWKKPYSEKLLELLKEDLKDLKI--IIVNHTEPDHSGSIKDILEYTKNKPLVGTKMAGDLLKSFYKIDINFKQ---VEDGEEIKVGEYTLKFFTTPWLHWPDTMVTYVKELKFMFTCDIFGSYGIFDSVYADEINFDNYEPFIRYTSTVIGAYKNYIVKNIDKIKNLEIKMILPGHGLLWRDP--EKIIDYFYKIKKVTIIYNSMYGL 266
438 1.000e-50UniRef50_A0A2A4TBT0 Flavoprotein n=1 Tax=SAR324 cluster bacterium TaxID=2024889 RepID=A0A2A4TBT0_9DELT  ali  38  1MKKTTVIYEQGEHKWTVLHHNTTRKNIISTNEYLIQHGEQSIVTDPGGTEVFPEVMATLASLTNLDTIGRVFCSHQDPDIFSAIGLWLKMKPELKVMLPKMWLGFMLHFAGI--KENFDLLPDEGSTFDLNGVTMQAISAHYCHSSGNFNLYDPAANILFSGDVGAALLPHESTELFVEDFDAHIQYIELFHKRWFGSNEHKNQWCERVSEINPSILCPQHGMLYRGENVKRFLDWFYHLKVGNIEY...... 246
439 1.000e-50UniRef50_A0A1W9UJ04 MBL fold metallo-hydrolase n=1 Tax=Anaerolineaceae bacterium 4572_32.2 TaxID=1971624 RepID=A0A1W9UJ04_9CHLR  ali  40  1..MATEIFNDGVHRCIRFDDLTGEGE-VQSNQFLIIHEGKGALLDPGGSKIYSALVAEMTSFLPLSKLEYIILSHQDPDVGAGLNGYL-LITDAVICFPEIWTRFIPAFCKSFTEGRVISVPDKGMRLDLNGSPLMLIPAHFLHSSGNNQVYDPVSKTLFSGDLGTSLLPPDAQYQEVSDFEAHTQYMDPFHRRYMPSEKICQRWAAMVQSLDIERIAPQHGAMFTGQAVSQFIEWVANLRCGVDLL...... 245
440 2.000e-50UniRef50_F7AH34 Lactamase beta 2 n=7 Tax=Eutheria TaxID=9347 RepID=F7AH34_HORSE  ali  20  14............RVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPA-VPEYISCLKQALTNTAIQEIIVTHWHRDHTGGIRDICKSISNDTVYCIKKLPRNPHKEEIIGDGEQQYVYLKDGDVIKTEGATLRVIYTP-GHTDDHMALLLEEENAVFSGDCILGEGTT-----------------------VFEDLYDYMNSLRELLKIKADIIYPGHGPVIHNAEAKQYISHRNMREQQILTI...... 227
441 2.000e-50UniRef50_A0A2X4ZQ68 Anaerobic nitric oxide reductase flavorubredoxin n=1 Tax=Klebsiella oxytoca TaxID=571 RepID=A0A2X4ZQ68_KLEOX  ali  14  2.......VGQRDWEVRFHGTEYKTLRGSSYNSYLIR-EEKNVLIDTVDHKFSREFVQNLRGEIDLADIDYIIINHAEEDHAGALTELMTQIPDTPIYCTANAIDSITGHHHHP-EWNFNVVKTGDSLDIGNGKQLIFVETPMLHWPDSMMTYMTGDAVLFSNDAFGQHYCDEHLFNDEVDQELYEQCQRYYANILTPFSRLVTPKITEILGFNP....................................... 208
442 2.000e-50UniRef50_A0A0F3GWS1 Sensor histidine kinase n=1 Tax=Candidatus Magnetobacterium bavaricum TaxID=29290 RepID=A0A0F3GWS1_9BACT  ali  25  22............DRIWWVGHYMKGDT-FQCHPYLIENGDQSVLIDPGSLVTYKQTLEKIEEIIPFSNIRYFVCHHQDPDITAALPTIEKLITDAVIVSHWRAVALLKHYDLKTP---FWLIEEHDWKLDIGGRPLKFVYTPYLHFPGAFVTFDTKEGVLFSSDIFGGFTDKWSLFA---KDERVFDGIRLFHEHYMPSREILIIGLTKLEALPIKMIAPQHGSIIPPHLVDFISSKLKGIDCGLYLLSE.... 253
443 2.000e-50UniRef50_A0A1G3UDZ2 Histidine kinase n=6 Tax=root TaxID=1 RepID=A0A1G3UDZ2_9HELI  ali  27  7.TSEAVLIAPNIYWV----GMHLKDDPFQCHPYLIKNKNESILIDPGSMIEFDETIRKVKSIIDIKSIKYIVLHHQDPDLVAAVPEIEKLINDLLIVTHSRMSLLIKHY--LVTSDYYEIDKNENTLTTQTGFTLDFLTTPYCHSPGAFVTYEPNSKTLFSGDIFGGIDESWEFYADET----YFDKAKQFHQEYMPSKDIFNYALGKIEKLDINLIAPQHGSIIEKTYIKKLIKDMKNLDCGLYI....... 243
444 4.000e-50UniRef50_A0A1M6QRG2 Flavorubredoxin n=27 Tax=Bacteria TaxID=2 RepID=A0A1M6QRG2_9FIRM  ali  15  1..MKITDIAEGTYQLILFEGLWDIPKGVTLNSYIIK-GEKTAIVDCGWDGVPESLFSLLKELIEPASIKYLIVNHVEPDHSGWIEAFKKINNDFQILCSKKGKELLGAFYGLT--ENITVVGDKDSFDLGKGHVLSFAEIPNVHWPDTIGTFDHGTEVLFTCDAFGSFGCDGRIYAEEFSKEELKEYLRYYSNIVATFSPQVKSAIRKIREIPAKLIAPGHGLMWKDTKIDAYDDYADAREEITLIWGSMYGM 269
445 5.000e-50UniRef50_A0A165IQK6 MBL fold metallo-hydrolase n=10 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A165IQK6_9GAMM  ali  39  1MAQVDTLFSENGHEVLRF-ADLVVGEGVQANQFCIRHNDRAALIDPGGDLTYTPLTIALSRRVNLDGLEYILASHQDPDIIASLPRWL-MHTRCQVVVSRLWARFLPHLASSYVTARILGVADEGKVLPFAGTELWVLPAHFLHSVGNFSFYDPLSGILFSGDVGASLGGEEGR---VDNFADHCHSMQGFHRRYMASNRACRLWVAMVRKLSPRMIVPQHGGYFEGDKVGHFLGWLAQLECGVDLLDS.... 252
446 6.000e-50UniRef50_A0A146KFJ5 A-type flavoprotein (Fragment) n=1 Tax=Trepomonas sp. PC1 TaxID=1076344 RepID=A0A146KFJ5_9EUKA  ali  15  1..DDIFWIGA-IDWSLRHFHGYITDDGSTYNAYLLMDE-HPTVIDTVKVAFREEMYERICKVIDPLKVEYIVMNHAECDHSGSLQYISEKLPNAMIITNAICANHLQILYPDIPKSKYKTP----TSLSTGKFNLKFFPVPLLHWPDSMFTFCPEKELLFSNDGFGQHYSSSERFFDQNKGQVIKLMKEYTANILGHCQKPLQNALKSVQNLSIKTILTGHGVSWRGEDV....................... 224
447 6.000e-50UniRef50_A0A1W1BV17 Beta-lactamase domain protein n=1 Tax=hydrothermal vent metagenome TaxID=652676 RepID=A0A1W1BV17_9ZZZZ  ali  34  12.KDAVLLLEDGQHKIYWVGT--TSSKALRSNIYLIKDRNEGIIIDCGSRGQFQETLERIKQVMPISYITRIFANHQDPDVTSAMADWLKLNPNIEIIASPSTNTLIEHYLPDGETYNYFNTERSPTLTLDSGAVLEFIPSPFMHFAGAVSVYDRHTKTLFSGDIWAAISLEWKLIL-EDDFDEHIENMDFFHQGYIGSNKAARNFLINFKDKEVKHIMPQHGSIILEENVNKAFSYLKNLKCGMDYY...... 254
448 7.000e-50UniRef50_L8JHC4 Sensor histidine kinase n=13 Tax=Bacteria TaxID=2 RepID=L8JHC4_9GAMM  ali  26  21............PRVWWVGHV-QEDDPFQCHVYLIEQGDESVLIDPGSKLTFANTLRKINEVIPFTSIKYFICQHQDPDITGAIPLIEQLLKDAVIVTHWRTKMLLKHYGFDIP---FWLIEEHDWQLPLADRTLNFCFTPYAHFPGAFTTFDPLSGVMFSSDLFGGLTDEFVLFAED---ESYLEAMKPFHQHYIPSNDILQYVLSEIEQYPMQMIAPQHGSIIRKPLIPYMIDGLKSLDCGLYLL...... 250
449 7.000e-50UniRef50_A0A0H5SMW6 Bm6764, isoform b n=3 Tax=Onchocercidae TaxID=6296 RepID=A0A0H5SMW6_BRUMA  ali  21  14..DSISQLSTNVYRI--LGQNPGPFTLQGTNTYLIGTTKERILIDCGDTG-VEQYIDCLKKALGNNTIKLIICTHWHGDHVGGITDIFKHVTNGPIPVHK-----LRRMDSPEVDNIKFDYILPGSIITAPGVTLKCI-ATPGHTSDHLSLYFEEEGSLFSGDCILGEGSS-----------------------VFEDLYDYMHSLETLSKLNITRIYPGHGSVVEKEKIYEYIAHRKKRE............ 222
450 7.000e-50UniRef50_Q6XKE2 Hydrogenosomal oxygen reductase n=1 Tax=Trichomonas vaginalis TaxID=5722 RepID=Q6XKE2_TRIVA  ali  18  20VADDVLWIGVNDWDLREF-HSMQSPVGTSYNSYLIQSS-EPTIVDAVKYTMAHAWIDRLKSIGDLKGIKRIIVQHAEPDHSSGTAMLVKEAPHIEVVMTKQCYNTMARFY--DVSKWNVKIVKLGEKINLGDRVAVMAGVPMAHWPESAVTYLPAQKILFSSDCFGQHIASNKRFVDEVDQGLFLTEIKYYANILQRLGKPVLKALATASKLPLDIVLPAHGVGFRKEDLEQAIKLYTQWPKVSVIYDNWYG. 279
451 9.000e-50UniRef50_H2CA41 Adenylate/guanylate cyclase n=2 Tax=Leptonema illini TaxID=183 RepID=H2CA41_9LEPT  ali  27  36.....IEIADGIYWIGFADF----EAGFSNNPYLVADGNEAVLFDPGPGHFRDIVYSKIRQIIDPAKIRYIVVHHQDPDLCGLIPFLEQLHPELTVMAHPRTALFLPYYGI---RRPIVPVGDGDQLQLASGRRIQMIHTPYVHFAGSMVSYDINTESLFSSDIFAVFNRNWSLFAD----TSYIEHAKSFLEHYVESEASLQFAYERFKKLSLKRILPQHGGIIVDE-IDQFLDLLKE.............. 260
452 1.000e-49UniRef50_Q30P17 Histidine kinase n=9 Tax=root TaxID=1 RepID=Q30P17_SULDN  ali  27  7.TSEAILIAPNIYWV----GMHLKNDPFQCHPYLIKNGDESILIDPGSMIEFDETVRKVKTLMDMKDIKYIILHHQDPDLAAAVPEIEKLINDLLIVTHSRMSLLVKHY--LIKSNYYEIDKMDHKLVTSSGFRLDFLTTPYCHSPGAFVSYEPTSKTLFSGDIFGGIEESWDFYADET----YFLKAKLFHQEYMPSKDIFNYALAKIEKLDIELIAPQHGSIIEKKYINKLIQDMRELDCGLYI....... 243
453 1.000e-49UniRef50_M1E8U8 Flavodoxin/nitric oxide synthase n=3 Tax=Thermodesulfobium TaxID=227388 RepID=M1E8U8_9FIRM  ali  14  5LADSLYDVGALDWEIRDFHGVY-TPQGSKYNSFLLLDE-KIAIIDSVKECFGKETICKIKEIIKERDVDYLVSLHTEPDHAGSITEYFKEFKNIKLVCLEKNYEFIKNFLP-DLDGSRVLVLKSGESLSLGEKTLVLKSLPMTHWPDTTSAYIPEKGWLFTSDFFGSLISISRPFYDQLQSDIYPFIRDYFAFLMRPFESLTKKALDYYKSLNPTMILPAHGPFYRREDIKYIFDVTEKLNKVIVVYTTMW.. 259
454 2.000e-49UniRef50_A0A073IIH4 Uncharacterized protein n=1 Tax=Porphyromonas sp. 31_2 TaxID=658663 RepID=A0A073IIH4_9PORP  ali  17  1..............................................................MDGRSLDYLVVNHMEPDHAGSIRLLRQQYPDVQIVGNNKTFGMLEGYHGIKEG---LFEVKEGDTLNTGRHELVFYMAPMVHWPEVMVTYDVTDKIVFSADAFGTYGTGGVIDTEMNVEHYWEEMIRYYSNIVGKYGSPVQRALQKLSGLDIQTICSTHGPVWR-EYASKAIDIYDRMEGVVIIYGSMYG. 194
455 2.000e-49UniRef50_H3BCJ0 Lactamase beta 2 n=20 Tax=Eumetazoa TaxID=6072 RepID=H3BCJ0_LATCH  ali  18  14............RVIRVLGCNPGSMTLQGTNTYLVGTGKRRILVDTGEPG-VPEYISCLKQALNNTTVQEILVTHWHVDHVGGITDVCNSLSNEVIICRKKKKKLPAEPPAYRERKQNKNIVLTEWLISAQNPSCRIVYTP-GHTDDHVALFLEEENALFSGDCILGEGTA-----------------------VFEDLYDYMKSLEKLLDLKVDLIYPGHGPVVQDAKIKAYIAHRNMREEQI......... 224
456 2.000e-49UniRef50_A0A2B4S2Z2 Beta-lactamase-like protein 2 n=3 Tax=Eumetazoa TaxID=6072 RepID=A0A2B4S2Z2_STYPI  ali  20  27............RVLRILGCNPSPMTLQGTNTYLVGTGKSRVLIDTGSGGSSE-YIAKLKEVLSDSQIQEVLITHWHPDHVGGIVDILKSIDNGHVKISKLPQEGVTEEISSNTEHRYNYLKDGEEIV-TEGATLKVLHTP-GHTTDHMIVYLKEENAVFSGDCILGQGTA-----------------------VFEDLYTYMKSLEVILNLSPCLIYPGHGPVIEENKIKEYIQHRNTREKQI......... 237
457 2.000e-49UniRef50_UPI0004173488 response regulator n=1 Tax=Chrysiogenes arsenatis TaxID=309797 RepID=UPI0004173488  ali  27  16.....VEIANGIYWV----GEYLPGDPFQCHPYLIVNGTHSILVDPGSVLEREALLRKVQQLVPLDHIQFIILHHQDPDLCSLVPELETLIGDLHIITHSRMTVLLKHYGIRSP---YYCIDKEGFGINAGGLELTFHTTPYCHSPGAFVSYATREKVLFSSDLFGGADISWSFYADET----YFEKIVSFHSAYMPSRDILNYSLRKIEALDIDLIAPQHGSIIRRPLIAPLITRMKGMECGLYI....... 247
458 2.000e-49UniRef50_UPI000A174540 MBL fold metallo-hydrolase n=2 Tax=Alteromonadales TaxID=135622 RepID=UPI000A174540  ali  35  1.MRTHKLFENNSHTWLMFGRDEEKPNIIDTNQYMVISNKNALLMDPGGIELFSAMLSVVIKQLPADKVTHLFASHQDPDIISSLGLWDQALPSATLHSPWIWESFIKHFGMNNISYSAIP--DEGSSLKIDQVTLDFIPAHYLHSSGNFNVYDAEAKILMSGD-IGAALECVDAPLFVDNFDEHISKMKMFHQRWMPSNRAKNDWISRVRKLNIEMMCPQHGRIFKGDDVKRFLDWFEALEVGIIA....... 243
459 2.000e-49UniRef50_K1SVU0 Metallo-beta-lactamase domain protein (Fragment) n=1 Tax=human gut metagenome TaxID=408170 RepID=K1SVU0_9ZZZZ  ali  17  9......................................................FVENVKAALNGKTLDYIVVNHMEPDHAGSLRLICDLYPDAALVATKKAVDMMAQFFGDELKNEKIVVKEGDTV-SLGKHELSFYTAPMVHWPEVMVTYESFEKVLFSADAFGTFGANGNIFNDEYDIDWLPDYRRYYTNICGKYGMQVQSLLKKALTLDIQMICPLHGPIWRSNLV-YIINKYDIWSKVMIAYASIYG. 214
460 2.000e-49UniRef50_A0A2M8B9Z6 Diguanylate cyclase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M8B9Z6_9DELT  ali  25  39.....YEIAEGVWWV---GCNIEGDE-FQCHSYLIEHGDQSVLIDPGAPVSFVETLGKIAKVTPFENIRYFVCHHPDPDITAALPQIDGLLTDAFLVSHWRAYSLLKHYELKHLSPF--LIEKEGWRLDLNGRVLEFRFTPYAHFPGAFVTYDTQTKTLFSSDLLGGFSGGFQLFAKDL---GYFEQIRPFHEHYMPSNEVLRNAISNFSDLELDRIAPQHGSIIERPLIEPILAQLAQLECGLYLMA..... 274
461 2.000e-49UniRef50_H0VAH2 Lactamase beta 2 n=42 Tax=Opisthokonta TaxID=33154 RepID=H0VAH2_CAVPO  ali  18  14............RVVRVLGCNPGPMTLQGTNTYLVGSGSRRILIDTGEPST-PEYINYLKQALVNTTIQEILVTHWHFDHSGGIGDICKSITNDTAYCIKKLPRNPHKEEIIGNGAQQYVYLKDGDVIKTEGATLKVLYTP-GHTDDHMALHLEEENAIFSGDCILGEGTT-----------------------VFEDLYDYMNSLKLLLEVKANIIYPGHGPVIHNAAIQQYISHRNNREEQI......... 224
462 3.000e-49UniRef50_A0A109C2M7 MBL fold metallo-hydrolase n=5 Tax=Bacteria TaxID=2 RepID=A0A109C2M7_9BACT  ali  44  1..MDRVLYDDGRHKYILIGADSADEKSIPSNQYMICHDEVSVLLDPGGFGMFPILVSRVLKYSKMENIKAIFLSHQDPDVGGGINVW-EQITDARIYVSALWIRFIPHYELKNMENIVGIHDGATEVIIGDDFKINVITAHFLHSPGHFNYYDPVSKVLFSGDIGAAVLPCSNDSVFADDFQSVLHCIEPFHTRYMSCNKALRKWVKEVETYDVEVIAPQHGYLFRGQAKEDFLKWIYDLKCGVDLI...... 245
463 3.000e-49UniRef50_UPI0003B6E9AB diguanylate cyclase n=2 Tax=Hippea TaxID=84404 RepID=UPI0003B6E9AB  ali  26  13..............IYWVGSELKNDK-FQCHVYFINNDDESILLDPGSRLTYPIVKSKIKKITNLKNIKYLICHHQDPDIVACVDDLIEDINDLTIITHWRAWALLKHYDWKIKLYE---VEENGWKLKALNRRLEFIFTPYLHFPGAFCTYDTKTETLFSSDLFGGFTEEFELFA--KSAEDYYEKLKVFHQHYMPSSTILNHGLDNIEKYPLKLIAPQHGSIIKEEFIKPIIKKMRNMECGI......... 238
464 4.000e-49UniRef50_B8D497 Beta-lactamase domain protein n=4 Tax=Desulfurococcus amylolyticus TaxID=94694 RepID=B8D497_DESA1  ali  14  13LTSNLYLLRFKDTSTKYFEGLWEIPEGIMYNSYVYTSNEGAIVFDTWKMGLGNEFLEALRNIVDLRDVRYIVVHHMEPDHSGILKTLVEKA-DPIVLGHPLVKNMAESFYSVSMKFR---PVKDGEEIVFDDEKIIFYHTPWLHWPETIMSYITSWKILLTCDAFGSYGVFKEVWADELSGEDYERYLKYFANVIGIHYEWVVKNLEKLRGVTPNLVLPSHGLLLRGDPLDYMYKKYKSWGHGLLIYTSMYGF 274
465 4.000e-49UniRef50_UPI00054DAE70 diguanylate cyclase n=1 Tax=Hippea jasoniae TaxID=944479 RepID=UPI00054DAE70  ali  24  8..KNPVEIGDDVFWV----GSYIPDDQFQCHVYLIRNKDESILIDPGSLITFDQTKRKIEQLIKLEDIKYFICHHQDPDIVASLSEFFKVIENRYVVTHWRAWALLKHY---NWHVNLYEIEENNWQLLAGDRLLKFIFTPYMHFAGAFCSLDVKTKILFSSDIFGAFTNGFELFA--KDSDDYFTKLRAFHEHYMPAREIVNSGLDNIEKHKPELIAPQHGSIIKKELIDSIIEKLRGLSCGL......... 243
466 5.000e-49UniRef50_A0A1V1X0I8 Uncharacterized protein n=1 Tax=Desulfobacterales bacterium PC51MH44 TaxID=1869304 RepID=A0A1V1X0I8_9DELT  ali  27  16..............VYWVGT-YDDQDNFQCNAYIIVINGRGIIIDPGSVLYFENLIRKVDELVGLRHVSHIIAQHQDPDVCGNIAMLVDAITNCKIWTHTRTAILIRHYG-ADLKFEYSNQLPDGRLILEGGHIIEFIHTPYLHSPGALATYFHADKILFSSDIFGGVMKDWQLFAD----DNYLNKITSFHEEYMPAKEFLLYAMTKFERYDIELIAPQHGSILNKKQSLEMIEAFKNFECGL......... 244
467 6.000e-49UniRef50_I3KCD2 Lactamase beta 2 n=7 Tax=Bilateria TaxID=33213 RepID=I3KCD2_ORENI  ali  18  14............RVVRVLGCNPGPMTLQGTNTYLVGTGKRRVLIDTGEPA-VPEYISSLKQALKQTSIQEIIVTHWHHDHTGGVEDICRDITGSEVRVSKLPR---SNKAREAAGSKEYTYLKDGDVVETEGATLK-VLFTPGHTDDHMALLLEEERALFSGDCILGEGTA-----------------------VFEDLYDYMKSLQILLDSEADLIYPGHGPVVQDAKIRHYISHRDQREQQILA....... 223
468 7.000e-49UniRef50_A0A1I1RAM6 Metallo-beta-lactamase superfamily protein n=1 Tax=Thiohalospira halophila DSM 15071 TaxID=1123397 RepID=A0A1I1RAM6_9GAMM  ali  37  1..MTVKLFEAGEHRCIAFEDLVRCDDRVSANQFLVVDNGRAALIAPGGTLPYNRLFMEVSQHFFVKHLDYVIASHQDPDIVASLNKWM-VATDAQVIVPAIWARFIPHFANPGRTERLIPIPDGGMDIRLGESVLKALPAHFLHSEGNFHFYDPVSRILFSGDVGAAMVDPEDLAEPVSDFEAHRQYMEPFHRRYMNSNRACRFWVNMVRGLDVEAIVPQHGPHFRGRKVNRFLDWFEELECGVDLMTQA... 259
469 8.000e-49UniRef50_X1BVS6 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1BVS6_9ZZZZ  ali  18  1..............................................VKRPFFNYFLENIKSVINLDKIDFLIMNHVEMDHSGSFPLIIKYLPNAQIIASKKGVEILRDHFHKEVDDNIRAVKEGDTLDIGNGKKFTFVPIPMIHWPDSMVSFMTDENILFSNDAFGQHFATSSRWDDENDFDIMEEAVKYYANILLHVSKLISNVLPKVGSLPIEIICPSHGVCWRK-HVGDIVERYKKWSAGIIIYDTMWG. 220
470 1.000e-48UniRef50_A0A2E6BK07 MBL fold metallo-hydrolase n=3 Tax=unclassified Gammaproteobacteria TaxID=118884 RepID=A0A2E6BK07_9GAMM  ali  15  1MSQSSVWYDCG-FNVTCIDTGLFRDGLAAC--YLIEHDGEAALVDTGTRNSLPRIMQTLADHISPEQVRWIMPTHVHLDHAGGAGALMDEMPEATLVVHERGARHMITPEKLPVPEQRVCIAADGDSFDLGSRRLQTLNTA-GHARHHYVVWDEHSSGLFTGDTFGVSYPELNTGRG-------SRFIFPPSTPVQFDPTAWHESLTRLMKLPVERVFLTHFGMHEDPA-----ELAALLHEQIDVYA..... 254
471 1.000e-48UniRef50_A0A1F7U7W9 Uncharacterized protein n=1 Tax=Candidatus Uhrbacteria bacterium RIFCSPHIGHO2_02_FULL_60_10 TaxID=1802392 RepID=A0A1F7U7W9_9BACT  ali  28  6.TDKAVEVAANTYWVGF----YDPKANFHCNPYLLVDGDDAIIIDPGSIPHFPTVARKVSSIIKFSRISRIIIHHQDPDLASNITVFEKLIKDLRVVTTRR-VSFLTDFYG--FKTPYRMVEEGD--LNFGGRNLQFHRTPYLHSPGAFTTYDPKTKTLFSSDIFGAFSEGWDLYAGED----YPEKMWTFHHTYMPPGDILKNQMKEFEKLEMDRICSQHGSVIEKKWVDFNINALKEIKTG.......... 236
472 2.000e-48UniRef50_A0A2M7L2S7 Uncharacterized protein n=1 Tax=Zetaproteobacteria bacterium CG_4_10_14_3_um_filter_54_28 TaxID=1974114 RepID=A0A2M7L2S7_9PROT :_  ali  32  7..EDAIKVADDIYWVGFSD----EKAHLHCNPYLLIDGDEAVLLDPGSLTDFPKVMRKVLELVNPGKISLLVAQHQDPDVCSNIPVVEDIIDRARVAAHTNSIRLIRHYGIQ--SAFYAVEEHDYAITLNSGRVLEFMFTPYCHSPGAIVTYDTKTKSLFTSDIFGAVSGDWSLF---VNDESSFFRMDSFHQLYMPSNQVLTHSLERMRRWDIERILPQHGSVIEGDLVARAFEHLKGLPCGIDL....... 249
473 2.000e-48UniRef50_E2QXB6 Lactamase beta 2 n=38 Tax=Amniota TaxID=32524 RepID=E2QXB6_CANLF  ali  19  14............RVVRVLGCNPGPMTLQGTNTYLVGVGTRRILIDTGEPA-ITEYISCLKQALTNTTIQEIIVTHWHHDHTGGIGDICKSINNDTAYCIKKLPRNPWKEEIIGDGTQQYVYLQDGDVIKTEGATLRVIHTP-GHTDDHMALYLEEENAIFSGDCILGEGTT-----------------------IFEDLYDYMNSLKVLLKVKADIIYPGHGPVIHNAEAKEYISHRNTREQQI......... 224
474 2.000e-48UniRef50_A0A2D9F4R8 Uncharacterized protein n=5 Tax=Rhodospirillaceae TaxID=41295 RepID=A0A2D9F4R8_9PROT  ali  39  1.MRSEVVFRDGSRSWTVFGQNGKPPDLVDTNQVVVRAGNEAVLIDPGGVEIFPAVFDAVEREVPLADIRHVILTHEDPDAGSSLPLWREVCVDLKVHVPWLWLGYVTHYDR--EADFVAVPDEGMEIRFGDNGRLHLIPAHYLHSPGNFSVFDPVSKVLFSGDIGGALVPPDDRDGFVVDFDRHVQYLTGFHQRWMGSPAARDDWIRRVRDVAPEIIVPQRGLVFTGEDVDRFLNWFETLEIGT......... 244
475 2.000e-48UniRef50_A0A2H0Y5U6 MBL fold metallo-hydrolase (Fragment) n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2H0Y5U6_9BACT  ali  15  6ILPDIYSVGVVDWNVRFHGRTYTTKRGSTYNAYLIIDE-KIALVDTVYGPFRDELIENIGKIVPVEKIDYVIANHVEIDHSGALPAIMKLCPKAKVLGTQKCKEGLYKHYYGNWDF---QVVHTGDKTKLGKRTLDFIEAPMIHWPDSMFTYCPEEQLLMPNDAFGQHYATSERFDDETDQCA...................................................................... 185
476 3.000e-48UniRef50_A0A151CIJ7 Histidine kinase n=3 Tax=unclassified Epsilonproteobacteria TaxID=34035 RepID=A0A151CIJ7_9PROT  ali  25  7.....IEIAKGIYWI----GMYLPDDPFQCHPYFIENGKDSILVDPGSMLEFDAVVRKINAISSMKHIRYIILHHQDPDLAASVPEMEKLINDLQIITHSRMVPLVKHYLIQSD---YYEIDRHAHQLQCGDLELHFITTPYCHSPGAFVTYEPRTKTLFSGDIFGGIEESWEFYAE----DDYFEKARQFHAEYMPSRDIFNYALNKIEALDMELIAPQHGSIIKKPQIPGLIEQMKALECGLYI....... 238
477 3.000e-48UniRef50_A0A1J4JGD8 Hydrogenosomal oxygen reductase n=1 Tax=Tritrichomonas foetus TaxID=1144522 RepID=A0A1J4JGD8_9EUKA  ali  19  22VAKNVLWIGCNDWDLREF-HSMRSPVGTSYNSYLIQSS-KPTIIDAVKAPFYDQWVSRLQSIYDLHGISYILMQHAEPDHTSALPILLQRFPHIQLLCTKENYDTLSRFY-CNKNWNYKLVKLGEQIQL-GDKTVVMAGIPMAHWPEQAVTYIPDQKILFTSDVFGQHIATTKRFVDEIDQCFYNELKSYYANILLRLRNPVLKALKTAASLPIDMILPSHGVGLRREDIARATKIYADFANQV......... 266
478 3.000e-48UniRef50_A0A2N5CI87 MBL fold metallo-hydrolase n=10 Tax=Burkholderiales TaxID=80840 RepID=A0A2N5CI87_9BURK  ali  34  1..MSKVLYESNGHVCLAFTDLVDDTHGVQSNQFLVVDHGHAALIDPGGQMTYSELYMTISRYFPPKQLDYVLASHADPDIVASVGRWLT-ASDSRVLISEVWARFLPHFCQTGKTAGRIVPIPDGMVVPLGKSSILAVPAHFLHSEGNLQFYDPVSKILFSGDLGASMTSSDEASGEVTDFDAHAVRMLGFHRRYMSGNRACRLWAAMARTLDIQWIVPQHGPSFRGEMVARFIHWIEQLQCGLDLLD..... 249
479 4.000e-48UniRef50_T1G1F2 Uncharacterized protein n=6 Tax=Protostomia TaxID=33317 RepID=T1G1F2_HELRO  ali  19  17............RVIRILGCNPGPFTLQGTNTYLIGTGNKRILLDTGESNNAN-YLENLVSILKNSTIKEVIITHWHGDHIGGVPAVFNRFNDSSLKINK--FKRLSKPDEKLENNIPINYLENNSVLSVDGATLKTIYTP-GHTDDHMSVLLHEENALFTGDCVLGEGT-----------------------CVFEDLHSYMNSLELIKSLNPSVIYPGHGAVVRDPHVSAYIANRNNREQQIV........ 226
480 4.000e-48UniRef50_W2TR01 Metallo-beta-lactamase domain protein n=3 Tax=Strongylida TaxID=6308 RepID=W2TR01_NECAM  ali  16  43..DDVVYISPNI--VRVLGQNPGTFTLQGTNTYLVGSEKKKLLIDAGEANNM-RYIGKLKESLGDATIEGIICTHWHHDHTGGCPSVRDHFRTSR----GEKPPVYRRKYKTNKNLSECTYVEEGYVFKQDGITLRVIDTR-GHTSDHISLFYEEEGVLFSGDCILGQGTS-----------------------IFEDLSDYMRSLKKLLELPCKIICPGHGPVIAKAKIKEYIEKREKRERQILDY...... 258
481 5.000e-48UniRef50_A0A1M5QKE6 Diguanylate cyclase (GGDEF) domain-containing protein n=1 Tax=Clostridium grantii DSM 8605 TaxID=1121316 RepID=A0A1M5QKE6_9CLOT : &nbs