current user: public

If you have questions about the server, please let us know.

Query: TM0016 TM0016 281897 Purified-2001-08-24, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# E-value Template Links and tools%idFirst MRMSLKSWKEIPIGGVIDKPGTAREYKTGAWRVMRPILHKEKCIDCMFCWLYCPDQAIIQEGGIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLSEEGLast
1 3.000e-33UniRef50_Q56316 Pyruvate synthase subunit PorD n=20 Tax=Bacteria TaxID=2 RepID=PORD_THEMA  ali  100  1..MSLKSWKEIPIGGVIDKPGTAREYKTGAWRVMRPILHKEKCIDCMFCWLYCPDQAIIQEGGIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLSEEG 99
2 7.000e-32UniRef50_A0A2H5Y6A1 Pyruvate synthase subunit PorC n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5Y6A1_9BACT  ali  50  207.GMALP-WFELPRGGLILDAGNAIAYRTGDWRTFRPVVEMEKCTHCLYCWLYCPDDAIRVAGGQFLGFDEAHCKGCGICAAVCPPKAIIMVEESRVVA... 302
3 2.000e-31UniRef50_A0A2M6ZSS5 4Fe-4S ferredoxin n=1 Tax=Chloroflexi bacterium CG07_land_8_20_14_0_80_51_10 TaxID=1973942 RepID=A0A2M6ZSS5_9CHLR  ali  25  155....FTGHMATGFGGAIKNLGMGLAGKLAMHSTVVPVMDHDKCTGCGTCRKHCPADAIKLGKGKFSVIDPSICIGCGECIATCPNGAVDIEWNE....... 252
4 3.000e-31UniRef50_A0A101EFG0 Ferredoxin (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A101EFG0_9BACT  ali  30  163....FKGHELTGFGGAIKNIGMGCAGKLKMHSTSKPIISEESCVSCGMCIRNCNYGAIGFGSSGKADINYEICTGCGQCIVVCPSEAIDIDWD........ 254
5 9.000e-31UniRef50_A0A1W9P9M6 Uncharacterized protein n=2 Tax=Candidatus Aminicenantes bacterium 4484_214 TaxID=1968529 RepID=A0A1W9P9M6_9BACT  ali  27  155....FTGHILTGFGGAIKNLGMGCAGKLEQHSNVHPWIKAKACRFCLLCMDFCPASAIVPEENKVRIID-EKCIGCGECLAVCPVGAIRLRWSE....... 246
6 1.000e-30UniRef50_A0A2N2DAM5 4Fe-4S ferredoxin (Fragment) n=1 Tax=Firmicutes bacterium HGW-Firmicutes-13 TaxID=2013774 RepID=A0A2N2DAM5_9FIRM  ali  26  155....VKGHIATGFGGALKNLGMGCSGKQMMHSSLKPRLNWQKCKGCGTCLKWCPVEAISFKDKK-AVIDYELCIGCGECTASCLHEAVKIQWESETSD... 250
7 3.000e-30UniRef50_H1Z0J8 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein n=1 Tax=Methanoplanus limicola DSM 2279 TaxID=937775 RepID=H1Z0J8_9EU  ali  28  155....FKGHIVAGFGGAIKNLAMGCAGKRDQHRVLQPVTDVELCTGCGLCAKICPENAVTIRDEK-AVIDEDLCASCGECISRCPADAISFIWE........ 245
8 4.000e-30UniRef50_A5IL34 4Fe-4S ferredoxin, iron-sulfur binding domain protein n=21 Tax=Bacteria TaxID=2 RepID=A5IL34_THEP1  ali  28  154....FKGHEATGFGGTIKNVGMGRAGKMEQHSESKPYVVEEKCVACGTCAKFCPVGAITVT--KVAKIDYEKCIGCGQCIAMCSYGAMSPKWD........ 243
9 8.000e-30UniRef50_A0A1V4R5L2 Uncharacterized protein n=1 Tax=Candidatus Cloacimonas sp. 4484_140 TaxID=1956163 RepID=A0A1V4R5L2_9BACT  ali  23  154....MTGHEATGFGAAIKNIGMGCAGKLAMHSLSRPSVNHDRCLGCARCVQWCQVNAISIKESGKAHIDEELCAGCSMCISVCPFNAIRIKWN........ 245
10 2.000e-29UniRef50_A0A101HU97 4Fe-4S ferredoxin iron-sulfur binding domain protein (Fragment) n=1 Tax=Microgenomates bacterium 39_6 TaxID=1641391 RepID=A0A101H  ali  28  148....VKGHPMFGFGGALKNLGMGGATPRGKHSSTIGKINEDKCVLCGTCIRNCPTGAISKKNNKI-IIDYQKCIGCGECVAVCPQGAVEMKKED....... 239
11 3.000e-29UniRef50_A0A1V6A6B9 Ferredoxin-2 n=1 Tax=Firmicutes bacterium ADurb.Bin153 TaxID=1852883 RepID=A0A1V6A6B9_9FIRM  ali  27  154....FKGHISAGIGGSLKNLGMGCAGKLVQHSDVRPVVKQENCLGCGKCIQHCPASAISFTDEKKAQIDPSACIGCGDCLAMCPVRTIRNKW......... 244
12 4.000e-29UniRef50_A0A2I0CVN2 4Fe-4S ferredoxin (Fragment) n=1 Tax=Methanoregula sp. TaxID=2052170 RepID=A0A2I0CVN2_9EURY  ali  31  73....FKGHIVSGFGGAIKNLAMGCAGKRAQH-NARPFTIPEKCTGCASCMKVCPKDAITVKKKKS-VIDHELCIGCFECMHVCPEHAIEIDWETEIP.... 166
13 5.000e-29UniRef50_A0A259UT74 Ferredoxin-2 n=1 Tax=Sporomusa acidovorans DSM 3132 TaxID=1123286 RepID=A0A259UT74_9FIRM  ali  29  155....FKGHEMAGFGGAIKNLAMGAVGKKEQHAT-KIIVDQDKCIGCGKCCTVCPEKAITL-NNQKAGIALDKCIGCGECLTVCPVKATGMDWQTDLTD... 249
14 7.000e-29UniRef50_A0A140LEB5 NADH-quinone oxidoreductase subunit I n=289 Tax=root TaxID=1 RepID=A0A140LEB5_9CLOT  ali  28  155....FKGHVMSGFGGTIKNLAMGCAGKQIQHSDAKPEVIDKHCIGCSVCAKWCPADAITIQGGKT-KIDLEKCIGCGECTTACHKRAIKVQWKTD...... 247
15 8.000e-29UniRef50_A0A0S8IKB3 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=A0A0S8IKB3_9BACT  ali  30  155....FKGHLLTGFGGALKNLGMGCAGKLVQHSGISPIVYARKCTACGECVKVCPASAISIRKGKSAVIDSSKCIGCATCIAVCPFSAIDVQWET....... 252
16 1.000e-28UniRef50_A0A0A2HRI5 Uncharacterized protein n=9 Tax=root TaxID=1 RepID=A0A0A2HRI5_9DELT  ali  23  155....FTGHLAAGFGATLKNIGMGCAGKLAQHSTAKPKIVKKKCTGCGTCIRWCPQEAIVLEDKKAA-IDSGRCIGCGECLAMCRFDAVKFDW......... 244
17 2.000e-28UniRef50_A0A101I3H4 4Fe-4S ferredoxin iron-sulfur binding domain protein n=1 Tax=candidate division TA06 bacterium 34_109 TaxID=1635277 RepID=A0A101I  ali  29  149....FKGHELTGFGGTIKNMGMGCAAKRGMHSNLTPHVDRNRCKGCFKCLKWCNVNAIENVDG-LANIDKKKCVGCGLCLEVCDYKAINIDWEIESS.... 243
18 2.000e-28UniRef50_A0A135VXR4 4Fe-4S ferredoxin n=5 Tax=cellular organisms TaxID=131567 RepID=A0A135VXR4_9ARCH  ali  26  154....FKGHEVTGFGGAIKNVAMGCSPKKGMHSQVVPYVDRKRCTGCGACIEWCPRRAIALHS--MAQIDARLCIGCCECVGVCARNAIRIVWNEE...... 245
19 2.000e-28UniRef50_X1A0V2 Uncharacterized protein n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X1A0V2_9ZZZZ  ali  31  154....FKGHELTGFGGAIKNVGMGCASKRGQHSGVFPEIIKEKCTGCKLCVNRCSFNAISLI-NKIATIDEKKCKGCGDCLVVCKSSAIKIRW......... 243
20 3.000e-28UniRef50_U7UFI2 PF04015 domain protein n=4 Tax=Bacteria TaxID=2 RepID=U7UFI2_9FIRM  ali  28  154....FKGHEAAGFGGAIKNLGMGRAGKMEQHSAGKPYVQQEYCIGCHKCEKICAHDAVHVTDGKSF-ITEEICVGCGRCIGVCPVDAIAPVWNEAY..... 247
21 3.000e-28UniRef50_A0A1G4FNB1 Anaerobic sulfite reductase subunit C n=118 Tax=Bacteria TaxID=2 RepID=A0A1G4FNB1_9FIRM  ali  25  156....FKGHESTGFGGTLKNIGMGCAGKMEMHSSGKPHVSHSKCVGCGTCIKNCAHDAITLKD-HKATIDHNKCVGCGRCIGVCPMDAVQ............ 242
22 4.000e-28UniRef50_X1R5M6 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1R5M6_9ZZZZ  ali  30  171....FKCHLLSAFGGAIKNIAMGCASKEGMHSSIVPYVDKAKCISCGVCVTYCPVEAINIVE--VASIDKKKCIGCGSCISVCNEGAIKITWDIEL..... 263
23 4.000e-28UniRef50_A0A2H5V1L3 Pyruvate synthase subunit PorC n=1 Tax=archaeon HR02 TaxID=2035438 RepID=A0A2H5V1L3_9ARCH  ali  38  255................IANLGNSALRRTGNWRIFKPVVDPEKCTGCMVCIIYCPDSCITLNENNKAVIDYDNCKGCMICLRECPLRAISSVRE........ 331
24 4.000e-28UniRef50_G2SJU6 Pyruvate/ketoisovalerate oxidoreductase, gamma subunit n=2 Tax=Rhodothermus marinus TaxID=29549 RepID=G2SJU6_RHOMR  ali  47  204....LPPYYALPIGGVIT-PEIRWFPKTGGWRNERPVFNEALCVNCLLCWAHCPEPAIVVHDRLMEGFNYDYCKGCGICVAMCPTGALTMVPE........ 291
25 4.000e-28UniRef50_C5CI04 4Fe-4S ferredoxin iron-sulfur binding domain protein n=9 Tax=Bacteria TaxID=2 RepID=C5CI04_KOSOT  ali  30  153....FKGHEQTGFGGTIKNVGMGRSGKLEQHSNSKPIVKEVNCVACGMCERHCPVGAITIE--GVARIDYDICIGCGQCIAMCNYGA--MVPKWDSSTE.. 246
26 5.000e-28UniRef50_A0A256ZA03 Pyruvate ferredoxin oxidoreductase n=1 Tax=Thermoplasmatales archaeon ex4484_36 TaxID=2012523 RepID=A0A256ZA03_9EURY  ali  50  223...................PGSFVENKTGSWRTFKPVFNRDKCVMCLLCWFYCPEGAIKVDGGKTLEFDFDYCKGCGICAEECPTKAIEMVRD........ 297
27 5.000e-28UniRef50_A0A151ATY1 Periplasmic [Fe] hydrogenase large subunit n=26 Tax=root TaxID=1 RepID=A0A151ATY1_9THEO  ali  31  154....FKGHELTSFGGTIKNLGMGCGGKQMMHSDVLPKVQEEKCIGCGRCRRWCPAGAITVNEK--ASINAGLCIGCGECTVTCPERAIK............ 239
28 6.000e-28UniRef50_A0A1F8QBF8 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1F8QBF8_9CHLR  ali  49  216..............AAVTAPRSAVEYRTGSWRYSRPVFDPEKCTGCGFCEMYCPDTCIIVENKKYYA-DYDYCKGCGICAHECPEEAIQMMVEE....... 294
29 7.000e-28UniRef50_G4RMU3 2-oxoacid ferredoxin oxidoreductase, gamma-delta subunit n=12 Tax=Thermoproteaceae TaxID=2267 RepID=G4RMU3_THETK  ali  48  209..YELVGWDKIPEGG-LTYPGSSLRYKTGSWRVEKPIIDHSKCIMCRKCWMFCPDDAVRVVRVKAIDFSYEYCKGCGICADVCPTGAIQMVRE........ 310
30 7.000e-28UniRef50_A0A1D7XA32 Electron transport complex subunit RsxB n=18 Tax=cellular organisms TaxID=131567 RepID=A0A1D7XA32_MOOTH  ali  29  154....FKGHELVGFGGTLKNLGMGCAGKQMMHSDVLPRVEEEECIGCGKCRRWCPAGAITVTEK--ATINGELCIGCGECTVTCPRRAIK............ 239
31 9.000e-28UniRef50_A0A2H5XK41 Pyruvate synthase subunit PorC n=1 Tax=bacterium HR18 TaxID=2035413 RepID=A0A2H5XK41_9BACT  ali  50  204.RMLLPYH-KLPIGGVIT-PEIRWFPKTGGWRNERPVFHETLCVNCLLCWAHCPEPAILVHNRRMEGINYDYCKGCGICATSCPTGALSMVPE........ 293
32 9.000e-28UniRef50_A0A2I0N6T7 4Fe-4S ferredoxin n=1 Tax=Thermoplasmata archaeon HGW-Thermoplasmata-1 TaxID=2013852 RepID=A0A2I0N6T7_9EURY  ali  30  153....FKGHPDVGFGGAIKNVGMGCGNKAGMHSDLSPWIDVKYCMGCGRCVRDCPAGAISTNDKGKAEIDTDKCWGCADCIASCPKTAIKTRWDTE...... 247
33 9.000e-28UniRef50_B8E3B5 4Fe-4S ferredoxin iron-sulfur binding domain protein n=3 Tax=Bacteria TaxID=2 RepID=B8E3B5_DICTD  ali  28  154....VKGHMSAGLGGAIKNVGMGCAGKQMQHAQFKPNPNPNLCIGCRRCVDHCPTGALEMVDKKSKLTRPELCIGCGECAVVCPTSAIKILWNE....... 246
34 1.000e-27UniRef50_V4K1S7 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family n=13 Tax=cellular organisms TaxID=131567 RepID=V4  ali  51  6....LPSWREMPIGGVIVNPGNSLEYKTGDWKVLMPVIDQEKCTRCRICWYVCPDSAIKELDKPYYDVDYDFCKGCGMCAQECPVKAIDMVPVE....... 106
35 1.000e-27UniRef50_I0A011 2-oxoacid:ferredoxin oxidoreductase, delta subunit n=2 Tax=Fervidicoccus fontis TaxID=683846 RepID=I0A011_FERFK  ali  50  15................ISYPKEGAAGKTGEWRTERPIVDIKKCTRCMLCETYCPVNAIRVEKDTGATINYEYCKGCGICMNVCPVKAITMVPE........ 91
36 1.000e-27UniRef50_A0A1G9QZ68 Uncharacterized protein n=1 Tax=Halarsenatibacter silvermanii TaxID=321763 RepID=A0A1G9QZ68_9FIRM  ali  29  155....FKGHDLTAFGGTFKNIGMGRSGKQMMHSTVEPSIDAEECVKCRECVKYCPEDCIIINKDESYIIEED-CIGCGECVISCNYDAISIVWE........ 245
37 1.000e-27UniRef50_X0XI74 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0XI74_9ZZZZ  ali  27  143....FTGHILTGFGAAIKNLGMGCAGKLEQHSVVHPRVNQEVCKFCGTCFDYCPADSI-VEKNGKAFIKEDKCIGCGECLVVCTAGAIKLTWDND...... 235
38 2.000e-27UniRef50_A0A284R0S6 Related to NADH-ubiquinone oxidoreductase subunit 8 n=1 Tax=Armillaria ostoyae TaxID=47428 RepID=A0A284R0S6_9AGAR  ali  30  107MWIVLENFFRQPY--TIKYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIESETKYDIDMTKCIYCGFCQEACPVDAIVETQNQEFATE.. 215
39 2.000e-27UniRef50_Q42599 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-A, mitochondrial n=273 Tax=Eukaryota TaxID=2759 RepID=NDS8A_ARATH  ali  30  80LSLTLKYFFD--PKVTINYPGPLSPRFRGEHALRRYPTGEERCIACKLCEAVCPAQAITIEAEERYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFATE.. 188
40 2.000e-27UniRef50_Q51803 Pyruvate synthase subunit PorD n=187 Tax=root TaxID=1 RepID=PORD_PYRFU  ali  44  19........EKMTPGAIVYIPGSSVINKTGSWRVFKPEFNRDKCVRCYLCYIYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPTKAIEMVRE........ 103
41 2.000e-27UniRef50_A0A1M6RKS8 Pyruvate ferredoxin oxidoreductase, gamma subunit /pyruvate ferredoxin oxidoreductase, delta subunit n=2 Tax=Rhodothermus profund  ali  45  203.SRALPPYYALPIGGVIT-PDIRQFPKTGGWRNERPVFNETLCVNCLLCWAHCPEPAIVVRNRRMEGFQYDYCKGCGICVAMCPTGALTMVPE........ 293
42 2.000e-27UniRef50_A0A2R4WZY2 Pyruvate synthase n=6 Tax=cellular organisms TaxID=131567 RepID=A0A2R4WZY2_9EURY  ali  47  14..............GAVAQPNTSLVNKTGSWRQFRPVIDADACIGCGQCDTYCPDQAAKQVDDQLYGIDLDYCKGCGICAEECPTDAIEMIRED....... 93
43 2.000e-27UniRef50_D5U0L3 Pyruvate ferredoxin oxidoreductase, delta subunit n=16 Tax=root TaxID=1 RepID=D5U0L3_THEAM  ali  49  5.....RGWKELPLGGIAYRL--STDVKTGDWRALKPVVDHNKCTKCMLCWLFCPDMAIVW-DGEKIQVNYDYCKGCGICAHECPVKAISMIPEFEEV.... 93
44 3.000e-27UniRef50_A0A1W9GC87 Uncharacterized protein n=2 Tax=Nitrospira TaxID=203693 RepID=A0A1W9GC87_9BACT  ali  31  203.RLRVPTYEPPTRGTAISAAANSLLRETGGWRTFRPVLVPDKCNGCWLCFVYCPDGVISMTKDNRPVIDYDHCKGCQICVQECPTHALVAEREKEGEA... 300
45 3.000e-27UniRef50_D9TTS0 4Fe-4S ferredoxin iron-sulfur binding domain protein n=17 Tax=cellular organisms TaxID=131567 RepID=D9TTS0_THETC  ali  27  155....FKAHEIAGFGGAIKNLAMGCAPRAGQHSTVSPKVGK-NCTACQTCIKNCPEDAITLVDGKAY-IDPDKCIGCGECITMCQYDAIKPQWGTDM..... 247
46 4.000e-27UniRef50_A0A1G0KCR6 Uncharacterized protein (Fragment) n=1 Tax=Gammaproteobacteria bacterium RIFCSPLOWO2_12_FULL_52_10 TaxID=1798305 RepID=A0A1G0KCR6  ali  39  117LRRERWGWEEVTPGAVIREQFTSRDNITGLWAKNVAVIDPDKCNVCQQCGIWCPEDAIKFNPGKMDLVDYDYCKGCGICDFVCPTKAISMIDE........ 213
47 4.000e-27UniRef50_X0VY61 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0VY61_9ZZZZ  ali  40  131....LPSWRELLPGFIVAEAGNASQYRTGDWRSQHPEFDYQKCNKCGLCYIFCPEGCIEPKEDGYFEANLYYCKGCGICEHECPKDAITMVEET....... 220
48 4.000e-27UniRef50_A0A1G1CBG5 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium RIFOXYB12_FULL_65_16 TaxID=1798581 RepID=A0A1G1CBG5_9BACT  ali  29  157....VKGHCLSGMGGAIKNIGMGRAGKLAQHHEGYPLFDHEKCRGCGVCARRCPTEAIQV--RKKAEIDAPRCIGCGECLVLCPHDAIGFSWDAE...... 248
49 4.000e-27UniRef50_A0A1V6K2A3 NADH-quinone oxidoreductase subunit I n=5 Tax=FCB group TaxID=1783270 RepID=A0A1V6K2A3_9BACT  ali  27  149....FKGHLLTGFGGAIKNLGMGCAGKLYQHSSVKPVVRPKKCVSCGLCAAHCPAGAISLEVGPAFISDA-LCIGCGECIQRCPEGAAGVDWNQD...... 241
50 4.000e-27UniRef50_C0QUF4 Pyruvate synthase subunit PorD (Pyruvate oxidoreductasedelta chain) (POR) (Pyruvic-ferredoxin oxidoreductase subunit delta) n=9 Tax=c  ali  44  1MSYELKPWHEIPIGSIVTEAGSSKINHTGSWRMLRPVLHTDKCTHCLICWIFCPDDSIPVTPQERFETDFEYCKGCGICATECPYDALEMVPEMEIKLKE. 100
51 5.000e-27UniRef50_A0A1V4M4F9 4Fe-4S ferredoxin n=1 Tax=delta proteobacterium ML8_F1 TaxID=1775671 RepID=A0A1V4M4F9_9DELT  ali  29  149....FKGHMNAGFGGAIKQLAMGRGGKLEQHSGISPVVNPSKCIACGLCVDKCDFDAITLEE--VAVIHDEPCVGCAGCIAVCPEGAITNRWD........ 238
52 5.000e-27UniRef50_A0A1W9PJA8 4Fe-4S ferredoxin (Fragment) n=1 Tax=Thermotoga sp. 4484_232 TaxID=1968524 RepID=A0A1W9PJA8_9THEM  ali  29  50....FKGHVSTGFGGTLKNVGMGCAGKLEQHSTSKPYVDEKRCVACGVCEKNCPVGAIKVE--KHAVIDYDVCIGCGECVAVC.................. 129
53 5.000e-27UniRef50_A0A1R1MNB3 Ferredoxin n=4 Tax=Bacteria TaxID=2 RepID=A0A1R1MNB3_9BACT  ali  50  1....MKGWRDLEIGALITEPGNSAEYKTGEWRAWRPVFNRENCIDCMICWVFCPDSSIIVKDKKVVGIDYDHCKGCGICAHECPKKALVMKPEYLFREED. 104
54 5.000e-27UniRef50_A0A2H6K4G4 Formate hydrogenlyase complex iron-sulfur subunit n=11 Tax=Bacteria TaxID=2 RepID=A0A2H6K4G4_9BACT  ali  24  153....FKGHMVSGFGGTLKNLGMGRPGKQMMHSGIHPRVTARECEGCARCLKWCPEGAITLKKEKVALIDSGACIGCGECVASCFTGAIAINWKTDPA.... 255
55 5.000e-27UniRef50_L0A8W8 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family n=7 Tax=Archaea TaxID=2157 RepID=L0A8W8_CALLD  ali  50  12.....KTYFLVP----ISKPDYGSSGKTGSWRTERPVVNEEKCTKCLYCWLYCPEDTILRREDDMVYVDYDYCKGCGICAAVCPVNAIDMVPE........ 95
56 6.000e-27UniRef50_A0A2D6LZW1 Pyruvate synthase n=1 Tax=Candidatus Diapherotrites archaeon TaxID=2026736 RepID=A0A2D6LZW1_9ARCH  ali  45  18........IELNLGAVIKKPGSSMDYHTGSWRTFRPVIIQEKCIKCSTCWRVCPDAAIFVDKKGRYNVNYDYCKGCLTCVKECPVDAINKELEEK...... 104
57 8.000e-27UniRef50_P80269 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial n=33 Tax=Eukaryota TaxID=2759 RepID=NDUS8_SOLTU  ali  31  87LMLTLKYFFEKKV--TINYPGPLSPRFRGEHALRRYATGEERCIACKLCEAICPAQAITIEAEERYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFATE.. 195
58 9.000e-27UniRef50_A0A1V1P9L6 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein n=7 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V1P9L6_9DELT :_  ali  26  147....FKGHELSGFGGTIKNLGMGRKGKLKQHSSISPKIVKKKCKACGECLKHCSQFALSIVDKKAA-IDKNKCIGCGECILICPEEAIQVAWNQEIP.... 241
59 1.000e-26UniRef50_A0A2H0P449 Pyruvate ferredoxin oxidoreductase n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2H0P449_9DELT  ali  44  1..MTQMTWKGLPLGNIVTEPGSARKYRTGDWRSQRPIWNKEKCIKCGACYMYCPEGAISMAVDGYPYVDLFYCKGCGICARECWTACFKMMPEDEAKTKEG 99
60 1.000e-26UniRef50_A0A235BZ58 Uncharacterized protein n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A235BZ58_9BACT  ali  28  151....FKGHELTGYGGAIKNLGMGKADKLFIHSGVHPFVNQKRCNLCGVCVQWCPEDAISL--GDYATINPERCIGCATCLSVCPQNAIKINW......... 239
61 1.000e-26UniRef50_A0A1V4XIP6 Pyruvate synthase subunit PorD n=18 Tax=root TaxID=1 RepID=A0A1V4XIP6_9DELT  ali  32  152....FKGHLASGFGGAIKNLSMGRAQKQRMHADVHPILDKKKCNRCGVCVEICPTGAAGIEGDEYPTYDLDLCIGCAQCIGLCPEVALEIIWETD...... 245
62 1.000e-26UniRef50_A0A1Y4DCX0 4Fe-4S ferredoxin n=1 Tax=Desulfovibrio sp. An276 TaxID=1965618 RepID=A0A1Y4DCX0_9DELT  ali  27  155....FKGHEMAGFGGAIKNLAMGCAGKRDQHGT-KVQVNHEKCIGCGSCVRHCPEHALSIVDGKS-TCDRSKCIGCFECMTVCEPKAIEINWETDVPA... 249
63 1.000e-26UniRef50_A0A2H9NUP9 Ferredoxin n=1 Tax=Candidatus Woesearchaeota archaeon CG_4_10_14_0_8_um_filter_47_5 TaxID=1974451 RepID=A0A2H9NUP9_9ARCH  ali  51  15.....KSYTEIPIGGAITEPGNSREYNVSGWRIFRPVVDKKRCINCLFCWITCPDAAIHAKDGNQEGFDYDHCKGCGICSETCPVKCIVMIKEDD...... 104
64 1.000e-26UniRef50_A0A0F9QSS7 Uncharacterized protein n=2 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9QSS7_9ZZZZ  ali  25  155....FTGHILTGFGAALKNLGMGCAGKLEQHSDVHPWVNPKLCDNCGVCFNYCPSQAI-VEKGDSAFIVEEKCIGCGECLVVCNQGAVKFNWDSD...... 247
65 1.000e-26UniRef50_A0A1M5Z7E1 Uncharacterized protein n=5 Tax=Firmicutes TaxID=1239 RepID=A0A1M5Z7E1_9FIRM  ali  25  156....FKGHELTGFGGALKNIGMGCAGKMEMHSSGKPQVSHEQCVGCGMCTKICAHSAISLTERK-ASINHTNCVGCGRCIGVCPTDAVQPAWGE....... 247
66 1.000e-26UniRef50_A0A1S8QK91 Anaerobic sulfite reductase subunit C n=778 Tax=root TaxID=1 RepID=A0A1S8QK91_CLOBE  ali  26  156....FKGHELTGFGGALKNIGMGCAGKMEMHSSGKPSVYEDKCVGCGMCAKNCAHSAISLTDKK-ALINHSKCVGCGRCIGICPMDAV............. 241
67 1.000e-26UniRef50_A0A2N1W756 4Fe-4S ferredoxin n=1 Tax=Candidatus Goldbacteria bacterium HGW-Goldbacteria-1 TaxID=2013807 RepID=A0A2N1W756_9BACT  ali  27  156.....KGHMMTGFGGTLKNLGMGRAGKQEQHSGQVPKFLSDKCTGCAECVEWCNFNAIEINGDKAVNI-PDKCSGCGECIAACRFDAIESNWDVDVS.... 249
68 1.000e-26UniRef50_A0A1V6ABP3 Ferredoxin n=1 Tax=bacterium ADurb.Bin157 TaxID=1866935 RepID=A0A1V6ABP3_9BACT  ali  34  159....FKGHSSAGFGGCIKNASMGPEGKREMHSRDYPITVPEDCIQCGACVNDCPADAITLNP---LTIDREKCIGCGKCIGVCPVKAIT-RPENEV..... 249
69 2.000e-26UniRef50_A0A212KZL2 4Fe-4S ferredoxin iron-sulfur binding domain protein n=2 Tax=Desulfovibrio TaxID=872 RepID=A0A212KZL2_9DELT  ali  26  155....FKGHQMAGFGGAIKNLAMGGAGKREQHATHV-SVNEDACIGCGKCVRACPQDALSIQKKKS-KVDISRCVGCFECMTVCPAAAISVDWETEM..... 247
70 2.000e-26UniRef50_A0A2D6LVM0 4Fe-4S ferredoxin n=1 Tax=archaeon TaxID=1906665 RepID=A0A2D6LVM0_9ARCH  ali  28  130....FKGHMLSGFGGAIKNMGMGRAGKLDMHSGIAPFVHEDQCIACGKCVENCPVDTIKI--NGKAKIYPKKCIGCAKCIAVCPVGAIGIKWR........ 219
71 2.000e-26UniRef50_UPI000478A039 DUF362 domain-containing protein n=3 Tax=Clostridiaceae TaxID=31979 RepID=UPI000478A039  ali  28  150....FKGHALAGFGGAIKQLGMGCAGKLAQHANSKPNINYFKCKACNACVNKCPVSAITI--NKKAKIDKDKCIGCASCISVCPHGAISNSW......... 238
72 2.000e-26UniRef50_A0A1V4WX63 Anaerobic sulfite reductase subunit C n=97 Tax=Bacteria TaxID=2 RepID=A0A1V4WX63_9DELT  ali  26  153....FKAHELSGFGGCLKNLGMGCAGKLVQHSTVSPRVNVETCRGCKLCTGYCPARAISVTSKK-ASIDGRKCIGCGECILICPFNAIQVEWNE....... 244
73 2.000e-26UniRef50_D9S0J6 Pyruvate ferredoxin oxidoreductase, delta subunit n=30 Tax=root TaxID=1 RepID=D9S0J6_THEOJ  ali  49  26.......WHELTRAGNIYEPGNANTYETGDWRSRRPVWNKDRCIHCLMCWRYCPDASVIAKDGKFETFDYKHCKGCGICAKVCPVNAIDMFPEDEI..... 114
74 2.000e-26UniRef50_Q1AXJ2 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate n=1 Tax=Rubrobacter xylanophilus (strain DSM 9941 / NBRC  ali  39  250..VRLPGWRELREGIIVEKPGERNPYKTSSDRTMRPVVNFDTCIKCRQCWIDCPDECFEVTEEGLHPINYEYCTGCGICSQVCPVDCIVMVNDLEFIDE.. 350
75 2.000e-26UniRef50_A0A0F9APJ5 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9APJ5_9ZZZZ  ali  24  154....FTGHMGTGFGGAIKNTGMGLASRRGQHSTLSPQIDTGACNACGMCLEWCPQDTISMVDGKAY-IHNENCIGCGECLAVCKFSAVRFNWGRE...... 246
76 2.000e-26UniRef50_A8MAF7 Pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit n=4 Tax=root TaxID=1 RepID=A8MAF7_CALMQ  ali  46  10................LSRPAMGAGGKTGTWRVRKPIVNLDKCTKCGICWLYCPENVIDWLEDKTVAIDYDYCKGCGICADVCPVKAITMIDE........ 86
77 2.000e-26UniRef50_Q51800 Ketoisovalerate oxidoreductase subunit VorD n=72 Tax=cellular organisms TaxID=131567 RepID=VORD_PYRFU  ali  46  30...................LGTTLVNPTGDWRTFKPVVNEEKCVKCYICWKYCPEPAIYIKPDGYVAIDYDYCKGCGICANECPTKAITMIKEEK...... 105
78 2.000e-26UniRef50_A0A0S8FZZ9 Uncharacterized protein n=1 Tax=Planctomycetes bacterium SM23_32 TaxID=1704029 RepID=A0A0S8FZZ9_9BACT  ali  28  155....LTGHLLGGMGGAIKNVAMGRAGKLRMHSGGSPFIEEAECTACGTCAKWCPEDAISLPE--RAEINYELCVGCGECVAVCPVGAVGFSWDT....... 245
79 2.000e-26UniRef50_UPI000A06BD5E NADH-quinone oxidoreductase subunit NuoI n=1 Tax=Nocardia pseudovaccinii TaxID=189540 RepID=UPI000A06BD5E  ali  31  183..VTFLTMFKKP--NTESYPEPTAPRYHGRHQLNRHPDGLEKCIGCELCAWACPADAIYVEGGQVYQINYLRCIGCGLCIEACPTRALTMTNEYEMADD.. 295
80 2.000e-26UniRef50_V4JWW7 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family n=13 Tax=Archaea TaxID=2157 RepID=V4JWW7_9CREN :_  ali  53  17................ISYPAPASSGKTGLWRTERPVVHLDKCIKCLFCWLYCPEDTILRREDDYVYVDYEYCKGCGICAEVCPTHAIEMVPE........ 93
81 2.000e-26UniRef50_A0A0D2K092 Pyruvate ferredoxin oxidoreductase subunit gamma n=4 Tax=Bacteria TaxID=2 RepID=A0A0D2K092_9DELT  ali  43  205.......FQEMEIGAEVPHPGNSREFLTGNWRTGRPVINKDKCVKCGICWVVCPDMAFNENEEGFFDWDERYCKGCGICAEQCPAGAIVMEAE........ 291
82 2.000e-26UniRef50_A7HLD4 Pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit n=16 Tax=Bacteria TaxID=2 RepID=A7HLD4_FERNB  ali  68  3...ELKGWKELPIGGLIVEPGNAKQYKTGTWRVMRPIYQAENCIHCMQCWLYCPDQAIVVEKPKMRGYNYYYCKGCGLCANVCPKRAIVMKPETDFADE.. 116
83 3.000e-26UniRef50_A0A1Q6R4D3 4Fe-4S ferredoxin (Fragment) n=1 Tax=Firmicutes bacterium CAG:176_63_11 TaxID=1897031 RepID=A0A1Q6R4D3_9FIRM  ali  28  155....FKGHEEAGFGGCLKNIGMGCAGKMEQHNAGKPHVAEKLCIGCGQCRKICAHGAPIITDGK-AVIDHDRCVGCGRCIAVCPKNAVQVNGDE....... 246
84 3.000e-26UniRef50_E8R823 Pyruvate ferredoxin oxidoreductase, delta subunit n=74 Tax=root TaxID=1 RepID=E8R823_DESM0  ali  47  5.....RGWRSLPMGGVAYRL--STDVKTGDWRALKPVVDHGKCTKCMICWLFCPDMAIVW-DGEKIQVNLDYCKGCGICAHECPVKAISMVPEFEEV.... 93
85 3.000e-26UniRef50_Q9UYZ0 Ketoisovalerate oxidoreductase subunit VorD n=75 Tax=root TaxID=1 RepID=VORD_PYRAB  ali  43  30...................LGTTLVNFTGDWRTFMPVIDESKCVKCYICWKFCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMVREEK...... 105
86 3.000e-26UniRef50_A0A1W9PPY1 Uncharacterized protein n=2 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1W9PPY1_9BACT  ali  26  155.....TGHMGTGFGGALKNLGMGLASRMGQHSAMLPQIKESSCTGCGVCMRWCPVQAIEMR-GSVAFIRAEDCIGCGECLVVCRFDAVQHDWKTDTS.... 248
87 4.000e-26UniRef50_A0A1F9LD81 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9LD81_9DELT  ali  24  156.....TGHLATGFGGALKNLGMGCKGKLRQHSGQKPHVEAGACTACGTCAQWCPSDAIEVTD--VAIINSDKCIGCGECIAACRDEAVQFDW......... 243
88 4.000e-26UniRef50_O58412 Ketoisovalerate oxidoreductase subunit VorD n=86 Tax=cellular organisms TaxID=131567 RepID=VORD_PYRHO  ali  43  30...................LGITLVNFTGDWRTFMPVIDESKCVKCYICWKYCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMVREEK...... 105
89 4.000e-26UniRef50_I0A1R3 2-oxoacid:ferredoxin oxidoreductase, fused gamma and delta subunits n=1 Tax=Fervidicoccus fontis (strain DSM 19380 / JCM 18336 / VKM  ali  50  279.................PKPGNKNIGFTTQWRWQRPIIDYKRCTDCKLCHYYCPDGAISFNP---IKIDYDYCKGCGICANVCPAKAISMVSELEH..... 354
90 4.000e-26UniRef50_A0A257LTS4 4Fe-4S ferredoxin n=1 Tax=candidate division bacterium WOR-3 4484_18 TaxID=2020626 RepID=A0A257LTS4_9BACT  ali  21  158....FTGHELTGFGATIKNLGMGCSTRRGMHSTLAPRVVLDRCKACGTCARWCSVGAITVTE--HAIIDEQKCSGCAACIAVCPEGAVRTNWNE....... 248
91 4.000e-26UniRef50_A0A1G3KT55 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWB1_36_13 TaxID=1802174 RepID=A0A1G3KT55_9SPIR  ali  26  153....FKGHMEAGFGGAIKNMAMGCAGKLEQHSSSKPNANPEKCVGCRQCFRVCRAGAISMKDNK-AVIDKTVCIGCGQCVAAC.................. 233
92 4.000e-26UniRef50_C5A3F6 Ketoisovalerate oxidoreductase subunit vorD (VorD) n=18 Tax=cellular organisms TaxID=131567 RepID=C5A3F6_THEGJ  ali  44  30...................LATTLSNFTGDWRTFIPVIIEEKCVKCYICWKFCPEPAIYIREDGYVGIDYDYCKGCGICANECPTNAITMEKEEK...... 105
93 4.000e-26UniRef50_N6U1N8 Uncharacterized protein (Fragment) n=4 Tax=Bilateria TaxID=33213 RepID=N6U1N8_DENPD  ali  30  123LGITLAHIFKEP--ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 231
94 5.000e-26UniRef50_A0A2J0L055 4Fe-4S ferredoxin n=1 Tax=Candidatus Omnitrophica bacterium CG07_land_8_20_14_0_80_42_15 TaxID=1974741 RepID=A0A2J0L055_9BACT  ali  25  160....FKGHMQTGFGAALKNIGMGRSGKQMQHSHVKPEVRENKCVLCKQCFDICPVSAIS-EKNGKAFIDKERCIGCAECVATCKFFAIAITWEE....... 251
95 5.000e-26UniRef50_A0A1F5RCL9 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1F5RCL9_9BACT  ali  28  154....FKGHGLAGFGGAIKNVAMGLAGKRAMHADYVPDYDTSKCIRCGACVKQCPAGAISINP---LKIDTRKCIGCGQCLKDCPVEAFE............ 238
96 6.000e-26UniRef50_A0A1V5L6X7 Ferredoxin-1 n=1 Tax=Actinobacteria bacterium ADurb.Bin444 TaxID=1852789 RepID=A0A1V5L6X7_9ACTN  ali  28  77....FKGHMVSGFGAQIKNLSMGRSGKQMMHSDVRPTVDGERCAGCGRCVYWCPAGAIELHENG-AVISNDRCIGCGECVVSCVHGAIAVSWESE...... 169
97 6.000e-26UniRef50_A0A0B0HCZ1 Pyruvate ferredoxin oxidoreductase, gamma (Delta) subunit n=21 Tax=Proteobacteria TaxID=1224 RepID=A0A0B0HCZ1_SOVGS  ali  40  201.SYALPGWIDLPFAPAIYAPATSVEVKTGLWRTQRPIIDYDLCKKCWICGSYCPDGAIEVEE-SLPIIDYDHCKGCLVCVAQCPSHAIEAIPEAQAQALEA 306
98 7.000e-26UniRef50_D9QZ52 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein n=73 Tax=Bacteria TaxID=2 RepID=D9QZ52_CLOSW  ali  29  156....FKGHESTGFGGALKNIGMGCAGKMEMHNSGKPHVTEETCIGCHACEKNCAHSAISFQNKK-AGIDHNLCVGCGRCIGVCPVDAVE............ 242
99 8.000e-26UniRef50_A0A1V5Z308 Ferredoxin n=1 Tax=Euryarchaeota archaeon ADurb.Bin165 TaxID=1852876 RepID=A0A1V5Z308_9EURY  ali  25  72....VKGHALAGFGGAIKNLAMGCAGKRDQHQGMQAEVNESLCEGCGYCETQCPFSAIHVEDK--AVIDRSICYGCSACLQVCPRHAIYFNWERDVP.... 165
100 8.000e-26UniRef50_A0A2J0LVZ6 4Fe-4S ferredoxin n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2J0LVZ6_9BACT  ali  23  150....FKGHIMAGFGGALKNVGMGCAGKLAQHSDVAPLVRVKNCTGCGECEKVCLADAISIINNKS-QIDSKKCIGCSSCIAACPHNAIDVHWE........ 240
101 8.000e-26UniRef50_D8PJH4 2-ketoisovalerate ferredoxin reductase, fused gamma and delta subunit n=6 Tax=Nitrospirae TaxID=40117 RepID=D8PJH4_9BACT  ali  37  219................ISATGNSVLRETGGWRTFRPVLVADKCNGCWLCFVYCPDGVISMNTDDRPVIDYDHCKGCQICVHECPTHALVAEREQE...... 297
102 8.000e-26UniRef50_I9L580 Uncharacterized protein n=3 Tax=Pelosinus TaxID=365348 RepID=I9L580_9FIRM  ali  23  156....FKGHELTGFGGALKNIGMGCAGKMEMHSDGKPNVRTKSCVGCGACVKICAHSAISLIDKK-AQIDHAKCVGCGRCIGVCHFDAIGAAWDE....... 247
103 8.000e-26UniRef50_A0A1J4VND9 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A1J4VND9_9BACT  ali  26  155.....TGHIFTGFAAAIKNVAMGRPTKQVQHSSMKPSVSEEKCTGCGCCKFICPASAITLGRGSKAHVDLGICIGCGECLCACKFDAINVNWEED...... 247
104 9.000e-26UniRef50_A0A1F9YAB2 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F9YAB2_9BACT  ali  26  156.....TGHIALGYGGAIKNLGMGRKGKLTMHSSIKPSIDSERCTGCKHCMNWCPENAITL-NGYTVVIDESKCIGCGECLTECRFDAVRYNWEMD...... 247
105 9.000e-26UniRef50_A0A1F3Y226 Uncharacterized protein n=1 Tax=Bdellovibrionales bacterium RIFOXYD1_FULL_53_11 TaxID=1797403 RepID=A0A1F3Y226_9PROT  ali  26  157.....TGHLACGYGGAIKNLGMGLSSRRGQHSVVKPFVKQKACKSCETCIKWCPTGAIAMSAGK-AVIDEKKCIGCGECLAACRPGAIRFQWKIE...... 248
106 1.000e-25UniRef50_A0A1F3V8M7 Uncharacterized protein n=1 Tax=Bdellovibrionales bacterium RIFOXYC1_FULL_39_130 TaxID=1797396 RepID=A0A1F3V8M7_9PROT  ali  25  155.....TGHLATGLGATIKNLGMGRKGKLRQHSVSHPLIDAKNCTACEKCLQWCPSDAIKMVKHHYAQINDEDCIGCGECLATCRMGAVKFKWD........ 251
107 1.000e-25UniRef50_A0A117MEU9 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein n=1 Tax=Methanomicrobiales archaeon 53_19 TaxID=1641394 RepID=A0A  ali  29  155....VKGHAVAGFGGAIKNLAMGCAGKREQHRAMPAIVREDDCEGCGGCVSACPEKAITFE--GAAHVDPEGCIGCGICVETCPESAI............. 239
108 1.000e-25UniRef50_A0A2H5YDH6 Pyruvate synthase subunit PorD n=1 Tax=bacterium HR23 TaxID=2035418 RepID=A0A2H5YDH6_9BACT  ali  46  2..LSLRPWYEEPPGGLLPYPGNSVEVDTGAWRSRRPVIALERCVHCMICWAFCPDSAFIVQDGRLIGVDLEHCKGCGICARECPKACIAMEPEPAL..... 95
109 1.000e-25UniRef50_A0A1Q6DW75 Putative Fe-S center protein n=1 Tax=Candidatus Methanohalarchaeum thermophilum TaxID=1903181 RepID=A0A1Q6DW75_9EURY  ali  23  146....FTGHEVTGFGAALKNMGMGLSGKLEMHNAFNLEIERSECKGCGECIEECPADAIDIQEDKAYL-NEEKCIGCGKCIAVCPNEAIKIPWDD....... 237
110 1.000e-25UniRef50_A0A0F9MQ59 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9MQ59_9ZZZZ  ali  25  155....FKGHEGTGMAGSMKNLGMGPAGKQVMHAGVLPSVNRNVCIGCARCKKWCPAEAITIENKKSF-IHSEKCIGCMECVTVCPTGAISIMWNE....... 246
111 1.000e-25UniRef50_B4FUH1 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-B mitochondrial n=56 Tax=Eukaryota TaxID=2759 RepID=B4FUH1_MAIZE  ali  31  81LMLTLKYFFERNV--TINYPGPLSPRFRGEHALRRYESGEERCIACKLCEAICPAQAITIEAEERYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFATE.. 189
112 1.000e-25UniRef50_A0A0P8X7T6 2-ketoisovalerate ferredoxin oxidoreductase n=20 Tax=root TaxID=1 RepID=A0A0P8X7T6_9EURY  ali  45  30...................LGTTLSNFTGDWRTFIPFIDESKCIKCYICWKFCPEPSIYIKEDGYVAVDYDYCKGCGICANECPTKAIEMVRE........ 103
113 1.000e-25UniRef50_A0A0P9DSI3 Pyruvate/ketoisovalerate oxidoreductases common subunit gamma n=1 Tax=Candidatus Bathyarchaeota archaeon BA1 TaxID=1700835 RepID=  ali  47  210.GSEIKSFKELPISPVSKPTKASMGAPTGAWREHRPVLNKEKCEKCMLCWLYCPDGVITISEEKYPIFDYEYCKGCGICAHECRFEAIELVRE........ 301
114 1.000e-25UniRef50_A0A1E3A8F4 4Fe-4S ferredoxin n=7 Tax=Bacteria TaxID=2 RepID=A0A1E3A8F4_9FIRM  ali  28  156....FKGHEATGFGGALKNIGMGCAGKMEMHNAGKPYVEQENCIGCGRCIKICAHDAPSITNGK-ASIDHKKCVGCGRCIGVCPKDAV............. 241
115 1.000e-25UniRef50_A0A1F5RC63 4Fe-4S ferredoxin n=1 Tax=Candidatus Edwardsbacteria bacterium GWF2_54_11 TaxID=1817851 RepID=A0A1F5RC63_9BACT  ali  31  154....FKGHELAGFGGSIKNLGMGGGAKLAMHSDIAPQIKAEKCIACGKCAANCPADAIAI--GKYAVIDPKKCIGCGSCIVVCPTQAVRNGWD........ 243
116 1.000e-25UniRef50_A0A2M6Y5Q0 4Fe-4S ferredoxin n=1 Tax=Elusimicrobia bacterium CG08_land_8_20_14_0_20_59_10 TaxID=2014310 RepID=A0A2M6Y5Q0_9BACT  ali  30  163....FKGHGIAGFGGAIKNLAMGPAGKKAQHSGMFPRVRSSKCVQCGLCRTQCPVGAIS----EDIVVDEKKCTGCGKCAEICPYKAIE............ 246
117 1.000e-25UniRef50_A0A0E3NXX8 Ferredoxin n=7 Tax=root TaxID=1 RepID=A0A0E3NXX8_9EURY  ali  29  48....FKGHIVAGFGGAIKNLAMGCAGKKDQHYPTSPHVVEERCIACGKCVEICPVGAASIEGDSS-KLDPSICISCGQCMEVCPEEAIDLNWETDIP.... 142
118 1.000e-25UniRef50_A0A1W9SZ35 4Fe-4S ferredoxin n=5 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A1W9SZ35_9DELT  ali  25  155....FKGHELSGFGGTLKNLGMGCAGKLDQHSTVSPKIKTKNCEACLDCAKHCPGDAIILKDKKAF-ILSEKCIGCGECIIRCPVNAVNIRWN........ 245
119 2.000e-25UniRef50_A0A084Q9Q6 Uncharacterized protein n=1 Tax=Stachybotrys chlorohalonata (strain IBT 40285) TaxID=1283841 RepID=A0A084Q9Q6_STAC4  ali  29  660MYVLMEQYFRPPY--TIYYPGPISPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERYDIDMTKCIYCGFCQESCPVDAIVESPNAEYATE.. 768
120 2.000e-25UniRef50_A0A133UG24 Uncharacterized protein n=3 Tax=cellular organisms TaxID=131567 RepID=A0A133UG24_9EURY  ali  28  157.....TGHPLACMGGTIKNLGMGRSGKQQQHADVKPEVDLEECRECGTCAMWCPVDAIEVVEGVGAKIDLETCYGCAECITTCPHNAISNEGEE....... 248
121 2.000e-25UniRef50_A0A1F5A742 Uncharacterized protein n=9 Tax=unclassified Aminicenantes TaxID=910038 RepID=A0A1F5A742_9BACT  ali  24  157....VTGHVQTGLGAAIKNVGMGCAGKLDQHSVTHPRVNPKQCRNCGLCMSFCPEAAI-VQAEGYVVIEPARCVGCGECLVVCKHGAVKMKWDED...... 249
122 2.000e-25UniRef50_G0SBG8 Oxidoreductase-like protein n=2 Tax=Sordariomycetes TaxID=147550 RepID=G0SBG8_CHATD  ali  30  741MYVLLEQFFRPPY--TIYYPGPISPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEERYDIDMTKCIYCGFCQESCPVDAIVESPNAEYATE.. 849
123 2.000e-25UniRef50_A0A0S8J0J4 Uncharacterized protein n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A0S8J0J4_9BACT  ali  27  155....VTGHPGAGIGASIKNVGMGRAGKLDQHHGDTPLVDAAKCTACGTCAELCPADAITV--DEIAVIDKKKCIGCGECLAVCPFGAVGFRWRE....... 245
124 2.000e-25UniRef50_K7IX51 Uncharacterized protein n=24 Tax=Eukaryota TaxID=2759 RepID=K7IX51_NASVI  ali  31  59MGVALAHFFKEP--ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 167
125 2.000e-25UniRef50_A0A1W9SI78 Uncharacterized protein n=1 Tax=candidate division KSB1 bacterium 4572_119 TaxID=1971636 RepID=A0A1W9SI78_9BACT  ali  30  155.....TGHIACGVGGAIKNLGMGRKGKLRQHSSVKPWIDVAKCTGCGECIYWCPENAIFMNGDIGA-INEKICVGCGECLTVCHFGAVQYNWKT....... 245
126 2.000e-25UniRef50_X0T772 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0T772_9ZZZZ  ali  36  133..VERPHWIRLPFAPAIHAAATSVEVRTGLWRTVRPVIDEERCRHCTICSTLCPDAAIEVREDGAPRIDLDHCKGCMVCVAVCPSHAIASVPE........ 230
127 2.000e-25UniRef50_A0A1G1GE73 Uncharacterized protein n=1 Tax=Nitrospirae bacterium RBG_16_43_11 TaxID=1801706 RepID=A0A1G1GE73_9BACT  ali  39  225....................GNIIERKTGKWRTFRPVINYDKCNHCWICFVWCPDGVISLDDKEFPHIDYDHCKGCLICYEECPIKAITVERE........ 297
128 2.000e-25UniRef50_A0A291RL24 Multifunctional fusion protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A291RL24_9NOCA  ali  35  451.....................PTAPRYHGRHQLNRHPDGLEKCIGCELCAWACPADAIYVEGGRVYQINYLRCIGCGLCIEACPTRALTMTNDYELADD.. 543
129 3.000e-25UniRef50_A0A1F9ASS4 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_61_14 TaxID=1797834 RepID=A0A1F9ASS4_9DELT  ali  26  156.....TGHMGTGLAAALKNVGMGRAGKMRQHSSIQPEVMAEKCQNCGKCRKWCPVDAIA-ERGDSSWIDPERCIGCGECLAVCRQGAVKFD.......... 243
130 3.000e-25UniRef50_A0A1V4RBJ3 Uncharacterized protein (Fragment) n=1 Tax=Gemmatimonadaceae bacterium 4484_173 TaxID=1956166 RepID=A0A1V4RBJ3_9BACT  ali  26  147....FKGHLLAGFGGAIKHLGMGKAGKLYQHSSVMPFVTVSKCTMCSACISVCGVSAITMSDSSAH-IDETACTGCGECIQRCPAGAIRISWNQE...... 239
131 3.000e-25UniRef50_A0A137QYL5 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial n=1 Tax=Leucoagaricus sp. SymC.cos TaxID=1714833 RepID=A0A137QYL5_9A  ali  30  98MWIVLENFFRPPY--TIMYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIESETKYDIDMTKCIYCGFCQEACPVDAIVETQNQEFSTE.. 206
132 3.000e-25UniRef50_A0A1V5X6T4 Formate dehydrogenase-O iron-sulfur subunit n=1 Tax=Deltaproteobacteria bacterium ADurb.Bin207 TaxID=1852869 RepID=A0A1V5X6T4_9DE  ali  25  157.....TGHLSAGYGGTIKNLGMGCASRKGQHSDTKPRIRRDACTACGACVEACPERAIMQDAQGIAAIDDPLCIGCGECIAQCRSDAVRFRWD........ 247
133 3.000e-25UniRef50_A0A2C5Z815 Uncharacterized protein n=1 Tax=Ophiocordyceps camponoti-rufipedis TaxID=2004952 RepID=A0A2C5Z815_9HYPO  ali  30  648MYLLLEQFFRPPY--TIYYPGPISPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERYDIDMTKCIYCGFCQESCPVDAIVESPNAEYATE.. 756
134 3.000e-25UniRef50_A0A2R6T528 4Fe-4S ferredoxin n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2R6T528_9ARCH  ali  26  146....LTGHEAAGYGGALKNVGMGLSGKLEMHEAFNLEVERDECQACGTCIRECPEKAIRYVEGK-ANIDKEKCIGCGICIAVCPFEAIQIPW......... 235
135 3.000e-25UniRef50_A0A1U7MES1 Electron transport complex subunit RsxB n=2 Tax=Sporomusa TaxID=2375 RepID=A0A1U7MES1_9FIRM  ali  25  156.....TGHPAAGLGACIKNIGMGLAGKMRQHSAMLPEVNNKSCQYCQKCIKWCPQDAI-IEQEGKAFIIAEKCIGCGECLAVCRFDAVKYDWNAE...... 247
136 3.000e-25UniRef50_A0A259UEL7 6-hydroxynicotinate reductase n=1 Tax=Sporomusa acidovorans DSM 3132 TaxID=1123286 RepID=A0A259UEL7_9FIRM  ali  26  156.....TGHPATGLGACIKNIGMGRMGKMRQHSAMMPEINRKSCQYCQKCIKWCPQNAI-IEQDGKAHIVTEKCIGCGECLAVCRFDAVKYDWNAE...... 247
137 4.000e-25UniRef50_A0A2K5KES1 NADH:ubiquinone oxidoreductase core subunit S8 n=23 Tax=Opisthokonta TaxID=33154 RepID=A0A2K5KES1_COLAP  ali  31  68LGMTLSYLFREP--ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 176
138 4.000e-25UniRef50_A0A1J5CX39 Uncharacterized protein n=1 Tax=bacterium CG2_30_54_10 TaxID=1805403 RepID=A0A1J5CX39_9BACT  ali  26  148....FKGHEVTGFGGALKNLGMGCAAKLAMHTSIRPEVLDKKCVRCGRCFDWCSVRAISQKKPGLPVIDPDLCRGCGECLIACRVGAIRINWDND...... 242
139 4.000e-25UniRef50_A0A1B0DAE0 Uncharacterized protein n=21 Tax=Opisthokonta TaxID=33154 RepID=A0A1B0DAE0_PHLPP  ali  31  116MGVTLAHIFKEP--ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 224
140 4.000e-25UniRef50_A0QU28 NADH-quinone oxidoreductase subunit I n=124 Tax=Terrabacteria group TaxID=1783272 RepID=NUOI_MYCS2  ali  38  13..VTLGSMFKKPITGYPEKPGPVAPRYHGRHQLNRYPDGLEKCIGCELCAWACPADAIYVEGGRVYQINYLRCIGCGLCIEACPTRALTMTTEYEMADD.. 125
141 4.000e-25UniRef50_Q2NHX1 PorD n=49 Tax=cellular organisms TaxID=131567 RepID=Q2NHX1_METST  ali  51  5.............GAVVKEPGSTRKNKTGSWRTFKPVADKDKCISCGLCYLFCPDGCISVE----FNHDYDYCKGCGICAEECPVDAIKMVRE........ 80
142 4.000e-25UniRef50_A0A2D6GAJ4 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2D6GAJ4_9CHLR  ali  45  1..MTLHQNGAMPEGAVIFSPGNSVERETGGWRVNRPVVQMDRCTHCMICWIFCPDSAIETGEGKFLGFDLAHCKGCGICATECPVKCIDMIEE........ 91
143 5.000e-25UniRef50_A0A286TZJ9 4Fe-4S ferredoxin iron-sulfur binding domain protein n=2 Tax=Candidatus Scalindua sp. husup-a2 TaxID=1284222 RepID=A0A286TZJ9_9BA  ali  24  155....VTGHLATGMGATFKNIGMGRGGKLAQHSGVIPQIISKNCITCKVCQIWCPTDAITMEED-TAVINPNTCIGCGECLAVCQFGAVKIAWDEDTAN... 250
144 5.000e-25UniRef50_A0A1G0JEL4 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium RIFCSPLOWO2_02_FULL_56_15 TaxID=1798298 RepID=A0A1G0JEL4_9GAMM  ali  39  120...EQWGWEEVTPGAVIREQFTARQNMTGLWAKEVAVIDPDKCNACQQCGIWCPEDAIKLDPGKLDIVDYDFCKGCGICGFVCPQHAIEMVD......... 212
145 5.000e-25UniRef50_A0A2K6EEF9 NADH:ubiquinone oxidoreductase core subunit S8 n=93 Tax=Eukaryota TaxID=2759 RepID=A0A2K6EEF9_PROCO  ali  31  68LGMTLSYLFREP--ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 176
146 6.000e-25UniRef50_Q744Z4 NADH-quinone oxidoreductase subunit I 1 n=50 Tax=Actinobacteria TaxID=201174 RepID=NUOI1_MYCPA  ali  32  12.RVTFSAMFKKPVTGYPEKPGPVAPRYHGRHQLNRWPDGLEKCIGCELCAWACPADAIFVESGRVYQINYLRCIGCGFCIEACPTRALTMINDYEMADD.. 125
147 7.000e-25UniRef50_A0A226MQ76 Uncharacterized protein n=6 Tax=Sauria TaxID=32561 RepID=A0A226MQ76_CALSU  ali  31  459LAMTLSYLFREP--ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 567
148 7.000e-25UniRef50_O24143 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial n=26 Tax=Eukaryota TaxID=2759 RepID=NDUS8_TOBAC  ali  31  88LMLTLKYFFEKKV--TINYPGPLSPRFRGEQPLRRYPTGEERCIACKLCEAICPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFATE.. 196
149 7.000e-25UniRef50_N0BCZ7 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family/2-oxoacid:acceptor oxidoreductase, delta subunit,  ali  41  196................VSTPSVGVAGKTGLWRIVRPVVDRERCNECGTCSLYCPEGVISVVLG-MVDIDYEYCKGCMICMSVCPKRAISGVKESEVKEY.. 277
150 7.000e-25UniRef50_A0A1Q7EBY8 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1Q7EBY8_9CHLR  ali  34  225LQFEKPGWTTMRPGIVVRKPGERPQYKKYTARTLRPVVNFDTCIKCTMCWLDCPDECFEVTPEGHYEVVYEACIGCGICAQVCPVDCIVMVDELRFEDND. 328
151 8.000e-25UniRef50_A0A1G1NV45 Uncharacterized protein n=1 Tax=Omnitrophica WOR_2 bacterium RIFCSPLOWO2_02_FULL_50_19 TaxID=1801865 RepID=A0A1G1NV45_9BACT  ali  21  155....VTGHMVTGFASAVKNIGMGRSGKLLQHSAIKPGVLEKECTGCGICIIHCPSGAISGAKGKKAYIDENKCIGCADCLVACRSDAIKISWSE....... 254
152 8.000e-25UniRef50_A0A2M7JSS8 Pyruvate ferredoxin oxidoreductase n=34 Tax=root TaxID=1 RepID=A0A2M7JSS8_9DELT  ali  45  8.....WTWKELTVGNVILEPGNASQYRTGDWKTLKPILNKELCIHCGLCYIFCPDMAYNLNEEGYFIGDLFYCKGCGICAKECPTGAITMVLEEEE..... 98
153 8.000e-25UniRef50_E6N486 Pyruvate ferredoxin oxidoreductase, gamma subunit n=1 Tax=Candidatus Caldiarchaeum subterraneum TaxID=311458 RepID=E6N486_9ARCH  ali  39  217....................GNAVRRSTGNWRVFRPVVDYGKCTGCKVCFVYCPDSAISLDAENKPVIDYEHCKGCLICVVECPIRAISSVREVEIFA... 294
154 8.000e-25UniRef50_A0A088E5R8 (4Fe-4S)-binding protein n=18 Tax=Sulfolobaceae TaxID=118883 RepID=A0A088E5R8_9CREN  ali  34  218.GVEFKYWQEMMEGTAIPAVGRNEQFKRGTTKTERPTVDFDACIKCDLCWVYCPDGCFDKTPEGYYDIAYDYCVGCGICAEVCPVKCIVMVDEKRLPDY.. 326
155 9.000e-25UniRef50_A0A1Z2TNW8 Pyruvate ferredoxin oxidoreductase n=2 Tax=Euryarchaeota TaxID=28890 RepID=A0A1Z2TNW8_9EURY  ali  44  19........EKMTPGAIATIPGSSVINKTGSWRVFMPEFYKDKCVRCYLCYIYCPEPAIYLDEENYPVFDYDYCKGCGICANECPTDAIIMVRETK...... 105
156 9.000e-25UniRef50_A0A0S8E2T0 Uncharacterized protein n=6 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A0S8E2T0_9BACT  ali  23  155....VTGHMLSGFAAATKNIGMGLAGKLLQHSNIKPSVLTSKCTACKLCIVNCPVDAIEIK-NKAACIKEDICIGCGDCLVVCRDDAIKISWSE....... 246
157 9.000e-25UniRef50_M3VZI9 NADH:ubiquinone oxidoreductase core subunit S8 n=6 Tax=Boreoeutheria TaxID=1437010 RepID=M3VZI9_FELCA  ali  31  68LGMTLSYLFREP--ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 176
158 9.000e-25UniRef50_R5WQE2 4Fe-4S binding domain protein n=1 Tax=Corallococcus sp. CAG:1435 TaxID=1262867 RepID=R5WQE2_9DELT  ali  29  155....FKGHEMAGFGGCLKNLGMGIAGKRDQHSGSRPQVDPENCIGCGLCTTQCAYSAVKVTDGKAH-VNHSVCVGCGRCVGVCPQKTIHFGNEEEILNKK. 254
159 9.000e-25UniRef50_A0A0X3BGZ9 Uncharacterized protein n=1 Tax=Methanoculleus sp. MAB1 TaxID=86622 RepID=A0A0X3BGZ9_9EURY  ali  30  166....VKGHDLAGFGGAIKNLAMGCAGKAEQHAG-RPFVEVERCGGCGKCTMVCPQAAMTVVEG-RARLNPEHCVGCGDCMRSCPTEAIEFDWTTEI..... 258
160 9.000e-25UniRef50_A0A1D8G4Q3 NADH-quinone oxidoreductase subunit I n=152 Tax=Bacteria TaxID=2 RepID=A0A1D8G4Q3_9ACTN  ali  29  23.GVTFKAMFRKRL--TEQYPEQRKPRFHGRHQLNRHPDGLEKCVGCELCAWACPADAIYVEGGRVYQINYARCILCGLCIEACPTRALTMTNEFELAD... 135
161 1.000e-24UniRef50_Q5YWD4 NADH-quinone oxidoreductase subunits H/I n=114 Tax=Actinobacteria TaxID=201174 RepID=NUOHI_NOCFA  ali  35  444.....................PTAPRYHGRHQLNRHPDGLEKCIGCELCAWACPADAIYVEGGRVYQINYLRCIGCGLCIEACPTRALTMTNDYELTDD.. 536
162 1.000e-24UniRef50_A8F2T4 NADH-quinone oxidoreductase subunit I n=1361 Tax=root TaxID=1 RepID=NUOI_RICM5  ali  31  17MALTLKYFFK--PKVTINYPYEKSPRFKGEHALRRYENGEERCIACKLCEAICPAQAIVIEADERYDIDMTKCIYCGLCQAACPVDAIVEGPNFEFAS... 124
163 1.000e-24UniRef50_A0A1V4V3Z2 Ketoisovalerate oxidoreductase subunit VorD n=51 Tax=root TaxID=1 RepID=A0A1V4V3Z2_9EURY  ali  31  155....FKGHSITGFGGAIKNLGMGCAGKTEQHS-IRPILYPERCISCGLCAEVCPRSAISF-DGGPAQIDIESCAGCLDCYRICPERAMDINWTEEI..... 247
164 1.000e-24UniRef50_A0A1G3V9Q1 Uncharacterized protein n=1 Tax=Syntrophus sp. RIFOXYC2_FULL_54_9 TaxID=1802292 RepID=A0A1G3V9Q1_9DELT  ali  27  145....FKGHMEASFGGSIKNISMGRAQKQRMHSDVHPVLIQKRCIRCGICQEVCPVGAAVLPDDQYPLYDLDKCVGCAQCIALCPQAALKIFWETDIS.... 241
165 1.000e-24UniRef50_UPI000C06A1BA DUF362 domain-containing protein n=1 Tax=Tepidibacter mesophilus TaxID=655607 RepID=UPI000C06A1BA  ali  30  149....FKGHIAAGFGGALKQLAMGRGGKLEQHSGISPIVDAEKCISCGICVNKCNFSAIQTPD--TAVIDESKCIGCAGCIAVCPKGAIENTW......... 237
166 1.000e-24UniRef50_UPI000B3E31C0 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial isoform X3 n=3 Tax=Numida meleagris TaxID=8996 RepID=UPI0  ali  31  517LAMTLSYLFREP--ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 625
167 1.000e-24UniRef50_A0A0S7ZEE7 Uncharacterized protein (Fragment) n=1 Tax=Spirochaetes bacterium DG_61 TaxID=1704237 RepID=A0A0S7ZEE7_9SPIR  ali  28  155....LTGHMAAGFGCAIKNVGMGRKGKLKQHSVMSPEISAHRCTACGMCIEWCPKDTISMENGKAF-IHKENCIGCGECLAVCSYGAVLYDWKRE...... 247
168 1.000e-24UniRef50_Q2NHM3 Predicted Fe-S center containing protein n=4 Tax=Methanosphaera TaxID=2316 RepID=Q2NHM3_METST  ali  27  155....VKGHILAGFGGALKNLAMGCASRRGQHKIAAPFISKIACLACNVCIDACPENAITV--DTHAHINYEKCIGCNDCIGACPKNAIKLNK......... 243
169 1.000e-24UniRef50_A0A0R3JRW2 Pyruvate synthase subunit PorD n=20 Tax=Bacteria TaxID=2 RepID=A0A0R3JRW2_9CLOT  ali  47  12.....TTWRETTPGGVVIDAGNAEDFKTGDWRAMRPVWHEEKCKHCLLCWVVCPDNSILVENGKLTGFDYDHCKGCGVCTKQCKFGALDFVPEE....... 100
170 1.000e-24UniRef50_A0A2H0LRH1 4Fe-4S ferredoxin n=1 Tax=Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_43_6 TaxID=1974747 RepID=A0A2H0LRH1_9BA  ali  26  175....FKGHILTGFGGALKNVGMGCAGKLAQHCNTAPVVHADNCIGCGECEIICPVKAIKLVNKKS-VVDSAKCIGCASCLSACPTMA.............. 259
171 2.000e-24UniRef50_Q82DX3 NADH-quinone oxidoreductase subunit I 1 n=538 Tax=Bacteria TaxID=2 RepID=NUOI1_STRAW  ali  30  20.GVTFKAMFKKRL--TEQYPETTAPRFHGRHQLNRHPDGLEKCVGCELCAWACPADAIYVEGGRVYQINYARCILCGLCIEACPTRALTMTNEFELAD... 132
172 2.000e-24UniRef50_A0A090MYV5 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial n=46 Tax=Eukaryota TaxID=2759 RepID=A0A090MYV5_STRRB  ali  30  66......GHFFTEP-ATINYPGPLSSRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDIDMTKCIFCGLCQEACPVDAIVEGPNFEYSTE.. 169
173 2.000e-24UniRef50_O00217 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial n=144 Tax=Opisthokonta TaxID=33154 RepID=NDUS8_HUMAN  ali  31  68LGMTLSYLFREP--ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 176
174 2.000e-24UniRef50_Q2RI40 Oxalate oxidoreductase subunit delta n=20 Tax=Bacteria TaxID=2 RepID=OORD_MOOTA  ali  43  226........RQMPFAGTVPSPVTENEGMTGNWRIQRPIIDREACTECYTCWIYCPDSCITRTEEG-PVFNMKYCKGCGLCTAVCPSGALTNVPELDFKD... 315
175 2.000e-24UniRef50_A0A2K5YHT6 NADH:ubiquinone oxidoreductase core subunit S8 n=19 Tax=Euteleostomi TaxID=117571 RepID=A0A2K5YHT6_MANLE  ali  31  63LGMTLSYLFREP--ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 171
176 2.000e-24UniRef50_A0A101EQQ5 4Fe-4S ferredoxin iron-sulfur binding domain protein (Fragment) n=8 Tax=root TaxID=1 RepID=A0A101EQQ5_9THEM  ali  28  154....FKGHEATGFGGTIKNVGMGRAGKMEQHSDSKPYVVEEKCVACGTCAKFCPVGAITVT--KVAKIDYEKCIG.......................... 225
177 2.000e-24UniRef50_D7E7Z6 4Fe-4S ferredoxin iron-sulfur binding domain protein n=5 Tax=Methanosarcinaceae TaxID=2206 RepID=D7E7Z6_METEZ  ali  30  151....VKGHPATGFGGAVKNLGMGCDGKTDCHEVGIPTIEPEKCVGCETCIDMCAWGALKMEDGK-AVVDTELCKGEGFCVESCPEGAIV............ 237
178 2.000e-24UniRef50_A0A182Q7R0 Uncharacterized protein n=13 Tax=Opisthokonta TaxID=33154 RepID=A0A182Q7R0_9DIPT  ali  30  92..VTLAHIFKEP--ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 198
179 2.000e-24UniRef50_A0A1G1KW78 Uncharacterized protein n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1KW78_9BACT  ali  26  155....FKGHLMTGFGGVLKNIGMGCAGKLAQHSDISPVVDGENCIGCGACEAVCPVSAISLKNNGKANVDGKLCIGCASCIAACDYQAMVVNW......... 246
180 2.000e-24UniRef50_P80903 Pyruvate synthase subunit PorD n=23 Tax=cellular organisms TaxID=131567 RepID=PORD_METTM  ali  49  4............LGATVKEPGSTRKNKTGSWRTFKPFLDKDKCIDCDNCILFCPEGCI----DKEHEIDYDYCKGCGICAEECPVKAIKMERE........ 80
181 2.000e-24UniRef50_E1QUR7 4Fe-4S ferredoxin iron-sulfur binding domain protein n=6 Tax=Vulcanisaeta TaxID=164450 RepID=E1QUR7_VULDI  ali  42  231....LPGWKDMMIGGAIPKPNQRNPYFTGGTAKYRPVVNFDKCIKCSLCWEYCPDSVFDVTPDGYFNPVLAYCKGCGVCAEVCPVDTIIMVDEMEFED... 328
182 2.000e-24UniRef50_A0A2R7Y2P2 Uncharacterized protein n=1 Tax=Aigarchaeota archaeon NZ13_MG1 TaxID=1980982 RepID=A0A2R7Y2P2_9ARCH  ali  39  188....................GNSILRKTGSWRVFTPIVRNELCTACGICYTSCPEGCISLDERGYPAIDYDHCKGCMVCATECPRKAISVERE........ 260
183 2.000e-24UniRef50_W9ASF3 NADH-quinone oxidoreductase subunit I n=25 Tax=Bacteria TaxID=2 RepID=W9ASF3_9MYCO  ali  30  12..ITFGAMFKKPV--TEQYPEERPARYHGRHQLNRYPDGLEKCVGCELCAWACPADAIYVEGGRVYQINYLRCIGCGLCIEACPTRALTMTGEFELADD.. 124
184 2.000e-24UniRef50_A0A1V5K0K7 Ferredoxin n=1 Tax=Firmicutes bacterium ADurb.Bin506 TaxID=1852895 RepID=A0A1V5K0K7_9FIRM  ali  27  48....FKGHGLAGFGGAIKNLGMGCAGKQIQHSDVKPRVRADRCISCRRCYRACPASAISMA-GGKASISPDSCIGCGECVVWCRNGAIRPNWDE....... 139
185 3.000e-24UniRef50_A0A1Q9P6L7 Ketoisovalerate oxidoreductase subunit VorD n=20 Tax=cellular organisms TaxID=131567 RepID=A0A1Q9P6L7_9ARCH  ali  45  9................ILYPMEGAAGKTGDWRTFYPVVNPDLCIKCNICWKYCPDHAISPADREKDEVDYNYCKGCGICAEECPKDAITMVPQGE...... 90
186 3.000e-24UniRef50_A0A0C2FF92 NADH-quinone oxidoreductase, chain I (Fragment) n=1 Tax=Ancylostoma duodenale TaxID=51022 RepID=A0A0C2FF92_9BILA  ali  32  148......HFFMEP--ATINYPGPLSSRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDIDMNKCIFCGLCQEACPVDAIVEGPNFEFSTE.. 250
187 3.000e-24UniRef50_X1MXH3 Uncharacterized protein (Fragment) n=2 Tax=root TaxID=1 RepID=X1MXH3_9ZZZZ  ali  26  94....FKGHELTGFGGAIKNVGMGCASKRGQHSGLTPKIIEDNCTGCGLCVSRCSFNAISLTE-KIATIDEKKCKGCGDCL..................... 171
188 3.000e-24UniRef50_A0A1A9VJR9 Uncharacterized protein n=2 Tax=Holometabola TaxID=33392 RepID=A0A1A9VJR9_GLOAU  ali  29  5.KVTLRYPMEKGPLG---------PRFRGEHALRRYPNGEERCIACKLCEVICPAQAIVIEAEERYDIDMTKCIYCGLCQEACPVDAIVEGPNFEFATE.. 102
189 3.000e-24UniRef50_A0A0V0VUA5 Putative NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial (Fragment) n=8 Tax=Trichinella TaxID=6333 RepID=A0A  ali  34  808..............ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERYDIDMCKCIYCGLCQEACPVDAIVEGPNFEFSTE.. 904
190 3.000e-24UniRef50_A0A1V5UG50 Ferredoxin n=1 Tax=bacterium ADurb.Bin243 TaxID=1866936 RepID=A0A1V5UG50_9BACT  ali  23  162....VTGHMITGVGAAIKNLGMGLAGKLSQHSGALPSINEKKCVKCGRCQMFCPAGAISPGEA-AFKIDSAKCIGCGECIAICKKEAVKFSWK........ 252
191 4.000e-24UniRef50_A0A1V5IN30 Pyruvate synthase subunit PorD n=3 Tax=Bacteria TaxID=2 RepID=A0A1V5IN30_9ACTN  ali  38  36..IDQWGPERHELGATIVEAGNSVYNETGGWRSMVPEIDVAKCDGCMLCYFYCPDASIIVEDNKATGIDLEHCKGCGICARECPTKAIVMK.......... 124
192 4.000e-24UniRef50_A0A024GD89 Uncharacterized protein n=2 Tax=Albugo candida TaxID=65357 RepID=A0A024GD89_9STRA  ali  30  418...............TVNYPFEKSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFATE.. 513
193 4.000e-24UniRef50_A1T698 NADH-quinone oxidoreductase subunit I n=249 Tax=Actinobacteria TaxID=201174 RepID=NUOI_MYCVP  ali  32  12.GVTFGSMFKKPVTEEYPEPGPVAKRYHGRHQLNRYPDGLEKCIGCELCAWACPADAIFVEGGRVYQINYLRCIGCGLCIEACPTRALTMTNDYEMADD.. 125
194 4.000e-24UniRef50_A0A257A5G3 4Fe-4S ferredoxin n=1 Tax=Thermoplasmatales archaeon ex4484_30 TaxID=2012522 RepID=A0A257A5G3_9EURY  ali  31  148....FKGHGMSGFGGAIKNLGMGCTSKAGQHAKSKPSFNEEKCIECLKCIKFCPAHAIEYEDKIK--IDYEKCYGCGACTVLCEQGCFYINNGNEF..... 240
195 4.000e-24UniRef50_A0A1M8ABU8 Uncharacterized protein n=28 Tax=Eukaryota TaxID=2759 RepID=A0A1M8ABU8_MALS4  ali  29  102LWMTLENFFRPPY--TIQYPGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPALAITIESETRYDIDMTKCIYCGMCQEACPVDAIVETQTLEFATE.. 210
196 4.000e-24UniRef50_X0X8U2 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0X8U2_9ZZZZ  ali  22  59....VTGHLATGMGATFKNVGMGRGGKLAQHSGVIPQIISKNCTTCKVCQIWCPADAINMEKD-TAVIDPEKCIGCGECLAVCQFGAVKISWDEDTAN... 154
197 4.000e-24UniRef50_A0A1W9RS54 Uncharacterized protein (Fragment) n=1 Tax=candidate division KSB1 bacterium 4484_87 TaxID=1970772 RepID=A0A1W9RS54_9BACT  ali  31  1...........GMGGAVKNLGMGRKGKLRQHSSVKPWIDAPKCTGCGQCILWCPENAITMNGD-VAVINEEICIGCGECLTVCHFGAVQYNWKT....... 85
198 4.000e-24UniRef50_A1HS53 4Fe-4S ferredoxin, iron-sulfur binding domain protein n=9 Tax=Bacteria TaxID=2 RepID=A1HS53_9FIRM  ali  25  156.....TGHPAAGLGACIKNLGMGLAGKMRQHSAMLPEVLTDNCRFCQKCLKWCPQEAI-IEKDGKAYIMTEKCIGCGECLAVCRFDAVKYDWGAE...... 247
199 4.000e-24UniRef50_UPI00077B18F7 uncharacterized protein LOC107341498 n=1 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077B18F7  ali  31  238LAMTLSKFFQEP--ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFATE.. 346
200 5.000e-24UniRef50_A0A2N2L882 Uncharacterized protein n=1 Tax=Candidatus Cloacimonetes bacterium HGW-Cloacimonetes-1 TaxID=2013733 RepID=A0A2N2L882_9BACT  ali  28  167....FKGHGSAGFGGAVKNISMGLASKEGKHRGNYPKYDESKCIQCNLCVPNCPQNAISINP---VNIDHPNCIACGKCIAVCPQG............... 248
201 5.000e-24UniRef50_A1UD96 NADH-quinone oxidoreductase subunit I n=169 Tax=Terrabacteria group TaxID=1783272 RepID=NUOI_MYCSK  ali  31  13..VTFGTLFKKPITEEYPEPGPVAPRYHGRHQLNRYPDGLEKCIGCELCAWACPADAIYVEGDRVYQINYLRCIGCGLCIEACPTRALTMTNDYEMADD.. 125
202 5.000e-24UniRef50_A3PWR3 NADH-quinone oxidoreductase subunit I n=60 Tax=root TaxID=1 RepID=NUOI_MYCSJ  ali  31  13..VTFGTLFKKPITEEYPEPGPVAPRYHGRHQLNRYPDGLEKCIGCELCAWACPADAIYVEGDRVYQINYLRCIGCGLCIEACPTRALTMTNDYEMADD.. 125
203 5.000e-24UniRef50_A0A2J0LME0 4Fe-4S ferredoxin (Fragment) n=1 Tax=Candidatus Omnitrophica bacterium CG12_big_fil_rev_8_21_14_0_65_42_8 TaxID=1974751 RepID=A0A  ali  25  48....VTGHMQAGFAGTLKNIGMGCASRQGQHSGTLPEITVEKCIGCGACMIVCPANAIGIKKKKAMLV-KERCIGCGECTVACRTGAIEIKYDE....... 139
204 5.000e-24UniRef50_B5YKH9 Pyruvate synthase subunit PorD n=25 Tax=cellular organisms TaxID=131567 RepID=B5YKH9_THEYD  ali  51  3......GWKKIPPGMVILEPGSALKFKTGSWRAFKPRWIEENCIQCLLCWLYCPDNAVKVKDGKREDFDFDYCKGCGICALECPNKAIVMEEE........ 93
205 5.000e-24UniRef50_A0A2R4ZV33 Ferredoxin n=2 Tax=Thermoprotei TaxID=183924 RepID=A0A2R4ZV33_9CREN  ali  50  26................LSKPSPGSAGKTGTWRLYKPRILVDKCIKCGICWLYCPEDTIAWPYRGLPSINYDYCKGCGICANVCPVNAIEMILEGE...... 104
206 6.000e-24UniRef50_A0A0S8G963 Uncharacterized protein n=5 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0S8G963_9BACT  ali  23  142....FKGHLTCGFGGALKNVGMGCAGKLDMHSLSKPTIDRETCTQCLQCYEYCAYDAIKKTKKGV-TIDRNVCTGCCGCMSICPERAIKFSWDAASTD... 237
207 6.000e-24UniRef50_A0A1Q6DTF3 Pyruvate:ferredoxin oxidoreductase delta subunit PorD n=6 Tax=cellular organisms TaxID=131567 RepID=A0A1Q6DTF3_9EURY  ali  48  7................IAEPGSTKNYKTGTWRTYRPVVDFDKCIGCAKCWEYCPEGCIEVDGKEVYETDLDYCKGCGICSEECPVGAIEMELEEE...... 88
208 6.000e-24UniRef50_A4TDB3 NADH-quinone oxidoreductase subunit I n=327 Tax=Bacteria TaxID=2 RepID=NUOI_MYCGI  ali  32  12.GVTFGSMFKKPVTEEYPEPGPVAKRYHGRHQLNRYADGLEKCIGCELCAWACPADAIFVEGGRVYQINYLRCIGCGLCIEACPTRALTMTNDYEMADD.. 125
209 6.000e-24UniRef50_E3PXI2 Putative iron-sulfur-binding protein n=5 Tax=Clostridiales TaxID=186802 RepID=E3PXI2_ACESD  ali  25  149....FKGHGSAGFGGAMIQLAMGRGGKLAQHSGISPKVIEKKCISCGLCVKKCDVEAIEMKEK--AFIHSEKCVGCAGCIAVCPVGAIVNDWSE....... 239
210 7.000e-24UniRef50_A0A240AZI8 Pyruvate ferredoxin oxidoreductase delta subunit n=11 Tax=Bacteria TaxID=2 RepID=A0A240AZI8_CLOCO  ali  50  13.......WDKVPRGGAILAGGNAVEFNTGDWRVMKPIWHEDKCKHCMFCWAVCPDMSIIVENEKVIGFDYDHCKGCGVCVEQCNFDALELVEEE....... 99
211 7.000e-24UniRef50_Q1Q2E9 Conserved hypothetical iron sulfur protein n=4 Tax=Planctomycetes TaxID=203682 RepID=Q1Q2E9_KUEST  ali  26  155....VTGHLATGMGATLKNIGMGRGGKLSQHSGVIPQILKKKCTTCGVCGKWCPVGAIKI-GEEYAIIDPQICIGCGECLAVCQFQAVKIAWDE....... 246
212 7.000e-24UniRef50_Q56224 NADH-quinone oxidoreductase subunit 9 n=77 Tax=Bacteria TaxID=2 RepID=NQO9_THET8  ali  28  10LGITLKYLFSKPV--TVPYPDAPVARFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYE. 125
213 7.000e-24UniRef50_A0A1G0KSC9 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium RIFOXYD12_FULL_61_37 TaxID=1798308 RepID=A0A1G0KSC9_9GAMM  ali  40  194.....PDWIDLPFEGAISAPATSELMQTGLWRTMRPVIDPERCNHCWVCSTFCPDSAISVDGKGNPHIDYDHCKGCLVCLAQCPPHAIRAVPE........ 288
214 7.000e-24UniRef50_Q22619 Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial n=372 Tax=Eukaryota TaxID=2759 RepID=NDUS8_CAEEL  ali  30  71.GVMLGHVFMEP--ATINYPGPLSSRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDIDMTKCIYCGLCQEACPVDAIVEGPNFEYSTE.. 178
215 7.000e-24UniRef50_A0A1F9KDD0 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19 TaxID=1797894 RepID=A0A1F9KDD0_9DELT  ali  39  217.............APTIRSAGNAALRHTGNWRTERPEIELAKCKKCFLCFLFCPDSAIHLDSDLYPHIDYDHCKGCMICREECPTDAIV............ 292
216 8.000e-24UniRef50_A0A166ED44 NAD(P)H-quinone oxidoreductase subunit I, chloroplastic n=11 Tax=cellular organisms TaxID=131567 RepID=A0A166ED44_9EURY  ali  25  155....FKGHGLSGFGGAVKNLAMGCAGKLEQHECAKP-IMTEDCINCGVCFKVCPVDAIEVKQDYEYSIVYDKCIACMNCWDGCPEESIDLDWEKEIP.... 254
217 8.000e-24UniRef50_A0A0G4N8U8 Uncharacterized protein (Fragment) n=2 Tax=Sordariomycetes TaxID=147550 RepID=A0A0G4N8U8_9PEZI  ali  30  283.......MKLLGFGENLDEVGPISPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEERYDIDMTKCIYCGFCQESCPVDAIVESPNAEYATE.. 384
218 9.000e-24UniRef50_Q2NA74 NADH-quinone oxidoreductase subunit I n=654 Tax=root TaxID=1 RepID=NUOI_ERYLH  ali  28  22..LTLKYFFK--PKATINYPFEKSPRFRGEHALRRYPNGEERCIACKLCEAVCPAQAITIESETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTE.. 128
219 9.000e-24UniRef50_UPI0002472665 pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit n=1 Tax=Holophaga foetida TaxID=35839 RepID=UPI0002472665  ali  45  1....MKAWQELNLGGVVSEPGSSRNFQTGSWRSYHPVWIEENCCQCMLCWIYCPDMSVKTADGKRGEFDYDFCKGCGICALECPQKAIVMEE......... 92
220 9.000e-24UniRef50_Q0S442 NADH-quinone oxidoreductase subunit I n=570 Tax=root TaxID=1 RepID=NUOI_RHOJR  ali  30  12.GVTFSTMFKK--SNTEFYPEETAPRYHGRHQLNRYADGLEKCIGCELCAWACPADAIYVEGGQVYQINYLRCIGCGLCIEACPTRALTMTNEYEMADD.. 125
221 1.000e-23UniRef50_G4RLF9 2-oxoacid ferredoxin oxidoreductase, delta subunit n=17 Tax=cellular organisms TaxID=131567 RepID=G4RLF9_THETK  ali  50  8................VSRPDVGSGGLTGTWRTLRPVVHLDKCIDCGICWLYCPESVIDWERGQKIKIDYNYCKGCGICAHECPVKAIEMAPE........ 84
222 1.000e-23UniRef50_E3J4I6 NADH-quinone oxidoreductase subunit I n=58 Tax=Actinobacteria TaxID=201174 RepID=E3J4I6_FRAIE  ali  29  11.GLTFGNMFRKPV--TESYPEPTAPRFHGRHQLNRHPDGLEKCVGCELCAWACPADAIYVEGGKVYQINYLRCILCGLCIEACPTRALTMGNEYELADD.. 124
223 1.000e-23UniRef50_A8LC93 NADH-quinone oxidoreductase subunit I n=178 Tax=root TaxID=1 RepID=NUOI_FRASN  ali  28  11.GVTFSTMFKKP--TTEQYPEETAPRFHGRHQLNRHPDGLEKCVGCELCAWACPADAIYVEGGRVYQINYLRCILCGLCIEACPTRALTMSNDYELADD.. 124
224 1.000e-23UniRef50_A0A1F7WXK7 Uncharacterized protein n=1 Tax=Candidatus Wallbacteria bacterium GWC2_49_35 TaxID=1817813 RepID=A0A1F7WXK7_9BACT  ali  25  146....VTGHIITGIGAAIKNIGMGLAGKLSQHSGVLPSINAKKCTKCGRCRAFCPAGAISP-GDAAFSIDHAKCIGCGECLAVCKFEAVKYSWK........ 236
225 1.000e-23UniRef50_A0A1G5E440 Uncharacterized protein n=1 Tax=Alkaliphilus peptidifermentans DSM 18978 TaxID=1120976 RepID=A0A1G5E440_9CLOT  ali  29  149....FKGHIEAGFGGALKQLSMGRGGKLAQHSGISPNVTAEKCIGCDLCVEKCDFDAIYRTD--TAVIDDSKCIGCAGCIAVCPKGAIRNTW......... 237
226 1.000e-23UniRef50_A0A1F8MGZ8 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_51_36 TaxID=1797625 RepID=A0A1F8MGZ8_9CHLR  ali  28  158....LKGHERAGFGGSIKNVAMGCESKAGQHRANRAVIDISKCNGCGKCVEACPFDALSLVEEKMVR-DDVKCMDCSHCLYLCPE................ 240
227 1.000e-23UniRef50_A0A0C9Q6J8 Uncharacterized protein n=3 Tax=Candidatus Brocadia sinica TaxID=795830 RepID=A0A0C9Q6J8_9BACT  ali  24  155....VTGHLATGMGATLKNIGMGRGGKLAQHSGVIPQILKKRCNTCGACGRWCPVGAITM-GEQYAIIDPKICIGCGECLAVCQFDAVKIAWDE....... 246
228 1.000e-23UniRef50_R7ALG3 Pyruvate ferredoxin/flavodoxin oxidoreductase delta subunit n=6 Tax=Eggerthellaceae TaxID=1643826 RepID=R7ALG3_9ACTN  ali  44  27...........PEGYVCPNPGTSVNCYTGGWRSMRPIWDSEACTNCMLCWVYCPDSSIEVKDGEMTGIDLFHCKGCGVCVNECKFDALTLISEAEAQAQE. 115
229 1.000e-23UniRef50_A0A1Q7HTK5 Uncharacterized protein n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Q7HTK5_9CHLR  ali  33  236LQFEKPGWTKMREGIIVEKPGERNPYKKYTARTLRPVVNFDTCIKCTMCWLDCPDECFEVTSSGHYEVVYEACIGCGICAQVCPVDCIVMVDELKFTDNK. 339
230 1.000e-23UniRef50_A0A235BNV3 2-ketoisovalerate ferredoxin oxidoreductase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A235BNV3_9BACT  ali  43  26.......................RVNKTASWRNLKPVIDYDKCKPCGICWKFCPEPAILLKEDGSPVIDYDYCKGCGICAEECPRNAITMHREE....... 96
231 1.000e-23UniRef50_A0A1V6N4L7 Pyruvate:ferredoxin oxidoreductase, subunit delta n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1V6N4L7_9EURY  ali  50  4............VGGAVKTPGSTRNNKTGSWRTFKPILDKEKCIDCDNCIMFCPEGCI----NKDHDIDYDYCKGCGICEVECPVKAIKMERE........ 80
232 1.000e-23UniRef50_A0A1V6ISM1 Ferredoxin-2 n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V6ISM1_9DELT  ali  25  37....FKGHMVSLFGGAIKNMSMGRAQKQRMHSDYHPVLNKKKCTRCGVCAEICPTGAATIATSDYPTYDLKKCIGCAQCIAMCPEMALQIFWNSDM..... 131
233 1.000e-23UniRef50_A0A2H6IEK0 Pyruvate synthase subunit PorD n=21 Tax=cellular organisms TaxID=131567 RepID=A0A2H6IEK0_9BACT  ali  49  1..MKLKGWKELEIGAIIPEAGNAEQYNTGSWRASRPQWIEENCIQCLFCWIYCPDSSVTVKDSKRGEFDYGHCKGCGVCAHECPKKAIVMVEE........ 95
234 1.000e-23UniRef50_A1AKT7 Pyruvate ferredoxin oxidoreductase, delta subunit n=14 Tax=Bacteria TaxID=2 RepID=A1AKT7_PELPD  ali  46  1....MTNWRELPPGVVITDPGSSRNFKTGSWRSFKPVWIRENCVHCMLCWVYCPDTSVLTADNGRGEFDYDFCKGCGICALECPNKAIVMEEE........ 93
235 2.000e-23UniRef50_A0A0A8WWJ2 Electron transport complex subunit RsxB n=33 Tax=Bacteria TaxID=2 RepID=A0A0A8WWJ2_9DELT  ali  22  154....FKCHELTGFGGALKNLGMGCAGKMVQHSTVAPKVAEKFCTGCGLCLKSCAHDAIAIIEGK-AQIDPDKCVGCSRCITACLQKAVNIQWNE....... 245
236 2.000e-23UniRef50_Q4VBU6 Zgc:109991 n=14 Tax=Opisthokonta TaxID=33154 RepID=Q4VBU6_DANRE  ali  30  68LAMALSYLFREP--ATINYPGPLSPRFRGEHALRRYPNGEERCIACKLCEAVCPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTE.. 176
237 2.000e-23UniRef50_A0A1Q3SUM1 NADH-quinone oxidoreductase subunit I n=6 Tax=Chloroflexi TaxID=200795 RepID=A0A1Q3SUM1_9CHLR  ali  28  15MGITLKNFFSKPV--TVQYPEQVRARVRGRHVLHRYDNGLERCIACMLCSGTCPADAIYIEPAKVFQVDMLRCIFCGYCQAACPTGAITLENNTALATY.. 129
238 2.000e-23UniRef50_A0A1F2WFG4 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_13_55_18 TaxID=1797197 RepID=A0A1F2WFG4_9ACTN  ali  28  137....LTGHEFLGFGGAIKNVSMGRGGKQQMHSDIKPAVNRDRCTACAKCLEWCPTGAISITGKKYAKIDRSKCIGCGECTIMCFKGAIQ............ 227
239 2.000e-23UniRef50_A0A2M6YCJ7 4Fe-4S ferredoxin n=1 Tax=Candidatus Berkelbacteria bacterium CG08_land_8_20_14_0_20_39_8 TaxID=1974511 RepID=A0A2M6YCJ7_9BACT :_  ali  23  132....FKGHGANGFGGALKNVGMGRAGKMAMHKAFELYVNDKKCIGCGICAEKCPAEAIGV--NGVAKIDLEKCIGCAACITNCDQEAVGFAWDSQSSKE.. 227
240 2.000e-23UniRef50_B8LUL8 NADH-quinone oxidoreductase, 23 kDa subunit, putative n=9 Tax=Dikarya TaxID=451864 RepID=B8LUL8_TALSN  ali  30  83MYVVLEQFFRPPY--TIFYPGPISPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERYDIDMTKCIYCGYCQESCPVDAIVESPNAEYATE.. 191
241 2.000e-23UniRef50_A0A1V4X4A4 Ferredoxin 7Fe n=2 Tax=unclassified Syntrophaceae TaxID=1510979 RepID=A0A1V4X4A4_9DELT  ali  23  148....FKGHILFGFGGAIKNLGMGCAGKLEMHSTLKPSVGEG-CTHCGRCVEVCPADAILLGEDRAA-IDPAKCEGCASCIAACEFDAVEIPW......... 236
242 2.000e-23UniRef50_A0A2N1PKB6 4Fe-4S ferredoxin n=1 Tax=Candidatus Wallbacteria bacterium HGW-Wallbacteria-1 TaxID=2013854 RepID=A0A2N1PKB6_9BACT  ali  33  163....FKGHRMAGFGGAIKQLAMGRAGKMDQHANAVPFVIPIKCSRCGACVKYCPEKAISM-GFIRARINAGACVGCAGCIARCPKKAI............. 248
243 2.000e-23UniRef50_A0A1V5MT87 Formate hydrogenlyase complex iron-sulfur subunit n=1 Tax=Planctomycetes bacterium ADurb.Bin412 TaxID=1852905 RepID=A0A1V5MT87_9B  ali  25  162....VTGHVACGFGAAIKNVGMGRAGKLNQHFQSTPLVKASVCTACGHCARWCPRDAITV--KKSAVINEKLCIACGQCHAVCPVGAIGFKWD........ 251
244 3.000e-23UniRef50_A0A1F5SK82 Uncharacterized protein n=1 Tax=Candidatus Falkowbacteria bacterium RIFOXYA2_FULL_47_19 TaxID=1797994 RepID=A0A1F5SK82_9BACT  ali  48  225.........................NKTGDWRMFKPAFDQELCNHCGLCREFCPDSAIGDEAGGKLLINYDYCKGCGICARMCPKKAISMQAESEITNQEA 302
245 3.000e-23UniRef50_A0A142VA24 Pyruvate ferredoxin oxidoreductase n=92 Tax=root TaxID=1 RepID=A0A142VA24_9CHLR  ali  41  9......TWQEVTPGCIVSEPGNASQYKTGDWRSQLPIHNFKKCIKCGVCYIFCPEGCINETKEGFFEADLFYCKGCGICAHECPTGAIVMKDEEE...... 97
246 3.000e-23UniRef50_A0A0C7NQI8 Uncharacterized protein n=1 Tax=Moorella glycerini TaxID=55779 RepID=A0A0C7NQI8_9THEO  ali  28  153....FKGHDDVGFGGIIKNLGMGRPGKQAIHSHMKPVVETSLCNGCGKCVEVCKVKAIAIEEGKAF-IEQGNCNNCGDCLVICPRKAIPVNW......... 242
247 3.000e-23UniRef50_I3IRJ1 4Fe-4S ferredoxin iron-sulfur binding domain protein n=17 Tax=Planctomycetes TaxID=203682 RepID=I3IRJ1_9BACT  ali  25  155....VTGHMMAGMGATLKNIGMGRGGKLAQHSGVIPQILKKRCSTCGVCGRWCPVGAIKM-GERYAIIDPRICVGCGECLAVCQFDAVEISWDE....... 246
248 3.000e-23UniRef50_A0A0U0Z6Y1 NADH-quinone oxidoreductase subunit I n=111 Tax=Actinobacteria TaxID=201174 RepID=A0A0U0Z6Y1_9MYCO  ali  31  34.GVTFSSMFRPTV--TEQYPVPPKPRYHGRHQLNRYPDGLEKCIGCELCAWACPADAIYVEGGRVYQINYLRCIFCGLCIEACPTRALTMTNEYELA.... 148
249 3.000e-23UniRef50_A0A2S5B1U8 Putative NADH:ubiquinone reductase (H(+)-translocating) n=1 Tax=Rhodotorula taiwanensis TaxID=741276 RepID=A0A2S5B1U8_9BASI  ali  30  87MGVVLEQFFRPPY--TIMYPGPVSSRFRGEHALRRYASGEERCIACKLCEAICPAQAITIESETRYDIDMTKCIYCGYCQEACPVDAIVESHNTEYSTE.. 195
250 3.000e-23UniRef50_A0A1G1ITP0 Uncharacterized protein n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1ITP0_9BACT  ali  23  155.....TGHILSGYAGAIKNIAMGRPTKQVQHSSLKPHVIDKKCTACGYCVKICPANAISPGKGEGYVIDQTKCLGCGECLCACKFYAISINWSEDHA.... 259
251 3.000e-23UniRef50_A0A2H0WWP8 Uncharacterized protein n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0WWP8_9BACT  ali  44  230.........................NKTGLWRTVKPVIDYAKCKKCGICRKFCPEPAILVDENGKVTIDYDHCKGCGVCSEECPLKAIEMRPDVE...... 303
252 3.000e-23UniRef50_D5UVI1 NADH-quinone oxidoreductase subunit I n=19 Tax=root TaxID=1 RepID=D5UVI1_TSUPD  ali  32  11.GTTLRTMFSKPV--TESYPEPTAARYHGRHQLNRYADGLEKCIGCELCAWSCPADAIYVEGGRVYQINYLRCIGCGLCVKACPTRALTMTNDYEMADGE. 125
253 4.000e-23UniRef50_A0A091F9U8 Uncharacterized protein n=14 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A091F9U8_9DELT  ali  25  150....FKGHMVSLFGGAIKNISMGRAQKQRMHSDYHPVLNKKKCTRCCVCVNICPTKAASISEPHYPEYDLQKCIGCAQCIAMCPEMALKIFWNSDM..... 244
254 4.000e-23UniRef50_A0A085NNY9 Uncharacterized protein n=2 Tax=Trichuris suis TaxID=68888 RepID=A0A085NNY9_9BILA  ali  32  696LAMVFGSFFKQP--ATINYPGPLSPRFRGEHVLRRYPSGEERCIACKLCEAICPAQAITIEAEERYDIDMCKCIYCGLCQEACPVDAIVEGPNFEFSTE.. 820
255 4.000e-23UniRef50_G9PSJ4 Uncharacterized protein n=3 Tax=Synergistaceae TaxID=649777 RepID=G9PSJ4_9BACT  ali  24  150....FKGHRIAGFGGAIKQLSMGKGGKLAMHMGIKPFIFRPLCRRCGLCAANCPVHAI--AKDGAYRIDAAKCIGCGACFALCPHKAVSI........... 236
256 4.000e-23UniRef50_A0A0W0GAP7 Uncharacterized protein n=1 Tax=Moniliophthora roreri TaxID=221103 RepID=A0A0W0GAP7_9AGAR  ali  28  103LWIVVEQFFRQPY--TIMYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIESETKYDIDMTKCIYCGFCQEACPVDAIVETQNQEFATE.. 211
257 4.000e-23UniRef50_A0A2H5XGA2 NADH-quinone oxidoreductase subunit I n=8 Tax=Bacteria TaxID=2 RepID=A0A2H5XGA2_9BACT  ali  23  9MKVTFSHLFK--PKVTVQYPDEPAPRFRGRHILRRWDDGLERCIGCHLCSAACPADAITVIAEKVYQIDLLRCIFCGYCEDACPVNAIVLGPVFELSAY.. 123
258 5.000e-23UniRef50_A0A1V5QJS2 Pyruvate synthase subunit PorD n=1 Tax=archaeon ADurb.Bin336 TaxID=1866922 RepID=A0A1V5QJS2_9ARCH  ali  45  9............LGGALQ-GGTSIENKTGSWRTERPVWDKKKCIQCMKCYIFCPENCIAIKKNKSIETDLDFCKGCGICAEVCPTKAITMQKENDF..... 95
259 5.000e-23UniRef50_A0LM19 Pyruvate ferredoxin oxidoreductase, delta subunit n=13 Tax=root TaxID=1 RepID=A0LM19_SYNFM  ali  44  10.......WKSLNLGMAITKPGCAADLKTGDWRSMRPETDRKKCTKCGQCYIFCPDMVYSKDAEGYYVQNYYYCKGCGICAKECPVDAITMHQEVD...... 97
260 5.000e-23UniRef50_A0A2A2HE97 Pyruvate synthase n=3 Tax=Archaea TaxID=2157 RepID=A0A2A2HE97_9EURY  ali  48  1.........MVSIGAAVKEPGSTRRNKTGSWRTFRPEPDSEKCISCGICYLFCPDGCI----GEDFIADYDFCKGCGICAEECPVKAIKMVRE........ 80
261 5.000e-23UniRef50_C6BUM9 4Fe-4S ferredoxin iron-sulfur binding domain protein n=6 Tax=Desulfovibrionales TaxID=213115 RepID=C6BUM9_DESAD  ali  28  146MMVTLKGHGLAGYGGAIKNIGMGCASKKGKHVSTAPHLHPEKCTGCGVCITECAAKALDLDDDGK-IIMGGKCTGCGRCFLSCRYGAISIDWKSDV..... 246
262 5.000e-23UniRef50_A0A1F5F6J3 Uncharacterized protein n=1 Tax=Candidatus Coatesbacteria bacterium RBG_13_66_14 TaxID=1817816 RepID=A0A1F5F6J3_9BACT  ali  44  220......GYIVASELHAYLRAGNAEDYNTGAWRADRPVWDSEKCTHCFRCFIFCPDSAITFETEKMTGHDLVHCKGCGLCAEVCPVKAITMVAET....... 311
263 5.000e-23UniRef50_A0A1G1GMV0 NADH-quinone oxidoreductase subunit I n=5 Tax=Nitrospirae TaxID=40117 RepID=A0A1G1GMV0_9BACT  ali  24  1MALTLKRMFSH--AVTIQYPKERRPGFRGQHALAKNQAGQAKCVGCGLCATICPSQCIHISRAKKYEIDILRCIYCGFCVEACPYGAIALTENYEYSDY.. 104
264 6.000e-23UniRef50_A0A2T0B1S7 Pyruvate synthase subunit PorD n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2T0B1S7_9CLOT  ali  46  11.....TTWQDLPRGGAILDAGNAADFKTGDWRAMRPIWYKDKCKHCLFCWAVCPDMSIMAKDGKVIEFDYDHCKGCGVCVDQCKFEALELIAEE....... 99
265 7.000e-23UniRef50_Q890V8 Pyruvate synthase subunit porD n=37 Tax=cellular organisms TaxID=131567 RepID=Q890V8_CLOTE  ali  50  15.......WTEVPRGGIIYAGGNAVEFNTGDWRVMKPIWYEDKCKHCMFCWAVCPDMSIIVENEKVIGFDYDHCKGCGVCVDQCNFNALELVEEE....... 101
266 7.000e-23UniRef50_C6Q2J4 4Fe-4S ferredoxin iron-sulfur binding domain protein n=35 Tax=cellular organisms TaxID=131567 RepID=C6Q2J4_9CLOT  ali  27  150....FKGHALAGFGGAIKQLGMGCAGKLAQHANSIPKISYFKCKGCGSCAKNCPEKAIVM--GSKAKINKDKCVGCAACMTTCNFGAVSNSW......... 238
267 7.000e-23UniRef50_A0A2E7Z3G9 Ferredoxin n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E7Z3G9_9CHLR  ali  39  7.......WKQIQPGGIGVNPGSTDRVQTGDWRTEVPVIDFERCTHCMICWVDCPDTSFEVADSKLVAVDLKHCKGCGICAQVCPVKCIDMVPD........ 92
268 7.000e-23UniRef50_A0A1W1YPS2 Uncharacterized protein n=2 Tax=Sporomusa malonica TaxID=112901 RepID=A0A1W1YPS2_9FIRM  ali  25  156.....TGCTSTGLGACIKNLGMGRKGKRRQHSAVLPTVESSQCTNCTKCMRWCPADAI-VEQNGKAYIVPEKCIGCGECIAACRFDAVK----YDFTADEG 249
269 7.000e-23UniRef50_A0A1G3LTI1 Uncharacterized protein n=1 Tax=Spirochaetes bacterium GWB1_66_5 TaxID=1802178 RepID=A0A1G3LTI1_9SPIR  ali  24  42.....TGHLGNGLGAAIKNLGMGLASRMGQHASLKPTVDPQARTFCAKCLKRCPAEAI-VERGGKAFIVSELCIGCGECLAVCRFDAVRHDWGTDL..... 134
270 8.000e-23UniRef50_A0A2K3J080 Ferredoxin n=10 Tax=Archaea TaxID=2157 RepID=A0A2K3J080_9EURY  ali  44  1.......MKKYNIVTTISYPKKGAMGKTGNWRVFRPILDKNKCVKCLRCWIFCPEATIIRNKDDSVDIDYEYCKGCGVCANVCKVKAITLKREAEI..... 89
271 8.000e-23UniRef50_A0A2H5ZSS9 Pyruvate synthase subunit PorD n=6 Tax=Bacteria TaxID=2 RepID=A0A2H5ZSS9_9BACT  ali  50  3.....TDWQALDRGPVIP-GGSSVAYRTGDWRQERPVLDLQRCVHCMLCWLYCPDSAIRVAGGRVVEVDYDHCKGCGVCAAVCPASAIRMVPE........ 91
272 9.000e-23UniRef50_UPI000853613C (4Fe-4S)-binding protein n=1 Tax=Vulcanisaeta thermophila TaxID=867917 RepID=UPI000853613C  ali  36  230....LPGYKDMMIGGAIPGLKPNQRNPLGTAKHYRPVINFDKCTKCTLCWEYCPDSVFDPTPDGYFNPALAYCKGCGICAEVCPVDTIIMVDELEFED... 327
273 9.000e-23UniRef50_A0A0S8CH97 Pyruvate ferredoxin oxidoreductase n=15 Tax=root TaxID=1 RepID=A0A0S8CH97_9CHLR  ali  41  17......GWKEIELGCFITEPGNSDEVRTGDWKSRRPELDFNKCTKCTLCYFFCPEGCIAKNKDGYFEPDLFYCKGCGICATECPKDAITMVEEAK...... 105
274 9.000e-23UniRef50_A0A252F7M3 Ferredoxin n=5 Tax=Bacteria TaxID=2 RepID=A0A252F7M3_9CLOT  ali  44  13.......WQDLTPGCEIYEPGTAVLTKTGEWRTMTPHWDPAKCKQCLLCAPYCPDSSIPVKDGKRSDFDFDHCKGCGICYKVCPFHAISFGKEDE...... 100
275 9.000e-23UniRef50_A0A1B7NGP3 Ndufs8, NADH:ubiquinone oxidoreductase 23 kd subunit n=10 Tax=Basidiomycota TaxID=5204 RepID=A0A1B7NGP3_9HOMO  ali  29  104MWIVMENFFRQPY--TIMYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIESETKYDIDMTKCIYCGFCQEACPVDAIVETQNQEFSTE.. 212
276 1.000e-22UniRef50_A0A284VN73 Pyruvate/ketoisovalerate oxidoreductases common subunit gamma n=9 Tax=Euryarchaeota TaxID=28890 RepID=A0A284VN73_9EURY  ali  44  199....LPAYQELPTGGALVEPGSFIENKVMGWATFRPVRDREKCTMCLLCWFYCPEGTIVISDRGDLMTNYDYCKGCGICANECPVDAIKMVR......... 296
277 1.000e-22UniRef50_UPI000A062B61 DUF362 domain-containing protein n=1 Tax=Desulfovermiculus halophilus TaxID=339722 RepID=UPI000A062B61  ali  18  133....FTGHELTGFGGTIKNLAMGCAGKMHQHCGLGPKVHASKCVGCGRCVEVCAPGALALDESGTITLDQAACTGCANCITACNYECLHLNWDMDL..... 227
278 1.000e-22UniRef50_A0A1V4QPN2 NADH-quinone oxidoreductase subunit I n=1 Tax=Planctomycetales bacterium 4484_113 TaxID=1956161 RepID=A0A1V4QPN2_9BACT  ali  28  201LRISLTHMFRRNF--TFYYPEQTLEYFRGKHRLVFDEHGKHLCIACQLCMKVCPDGVILVSAVRNPEVDNSRCCFCGLCEDVCPTGAIRLSNEFAYSSYD. 311
279 1.000e-22UniRef50_A0A2H0MQC2 Uncharacterized protein n=3 Tax=unclassified Nitrospinae TaxID=1449243 RepID=A0A2H0MQC2_9BACT  ali  34  208..MEQKGIRDASP--LIFATGNMALRKTGDWRIQRPEIDYSHCNKCLICYARCPDGAIRVNADDHPEIDYDHCKGCMICAQECPGHFINTVRE........ 296
280 1.000e-22UniRef50_D0YTM0 NADH-quinone oxidoreductase subunit I n=11 Tax=Actinobacteria TaxID=201174 RepID=D0YTM0_9ACTO  ali  32  83.....................PTQPRYHGRHQLNRYPDGLEKCIGCELCAWACPADAIYVEAGRVYQINYLRCIFCGMCTEACPTRALTMSNDYEIWDD.. 175
281 1.000e-22UniRef50_A0A2N2H3M2 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2N2H3M2_9DELT  ali  25  209....FKGHGSAGFGGAIKNVAMGIAGKMAQHANDIPSVDGTKCVKCMRCVGECPAKAITVDDAGV-RIDKKKCIGCAKCIGECPT................ 291
282 1.000e-22UniRef50_A0A1G1DEY9 4Fe-4S ferredoxin n=2 Tax=Bacteria TaxID=2 RepID=A0A1G1DEY9_9BACT  ali  28  154....FKCHELSGIGGVIKNIGMGCAGKLNQHSSVKPFVIMDKCTGCMRCIQWCPEGAIVFTKRDKVKIVSGVCIGCGECILPCRDGAIKIKWDADTSS... 271
283 1.000e-22UniRef50_X1UCH5 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1UCH5_9ZZZZ  ali  25  18....FTGHIITGLGGALKNLGMGRAGKLAMHCNTKITIDPKKCIACNLCIENCPVNAISYVNKKAF-IDEKKCIGCARCIAVCEQKA.............. 102
284 1.000e-22UniRef50_H3EEX7 Uncharacterized protein n=11 Tax=Opisthokonta TaxID=33154 RepID=H3EEX7_PRIPA  ali  30  64.GVMLGHVFMEP--ATINYPGPLSSRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETTYDIDMTKCIYCGLCQEACPVDAIVEGPNFEYSTE.. 171
285 1.000e-22UniRef50_A0A1Q9N7Z6 Ketoisovalerate oxidoreductase subunit VorD n=31 Tax=root TaxID=1 RepID=A0A1Q9N7Z6_9ARCH  ali  48  5.....KSWREIPMGGL--TWLNSIEYKTGEWRSFRPVVDHNKCTRCMQCVIFCPDIAIKYKPDNMIEINLDHCKGCGVCAEECPVHAITMVKEKD...... 93
286 2.000e-22UniRef50_A0A1Q9P327 Pyruvate synthase subunit PorD n=1 Tax=Candidatus Heimdallarchaeota archaeon AB_125 TaxID=1841596 RepID=A0A1Q9P327_9ARCH  ali  43  15...EKWGSSQLPIGGTVPYH-TAYGYKTGDWSAFKAIIDKDKCISCMNCYYYCPDSAIIMDDDMKAACDMEFCKGCGICSKHCPSDAIEMKRVT....... 104
287 2.000e-22UniRef50_A0A2H5ZSK8 Oxalate oxidoreductase subunit delta n=15 Tax=Bacteria TaxID=2 RepID=A0A2H5ZSK8_9BACT  ali  36  227....LPKWHEFSEGVVVKAVGQSRNFKRGTTKSQRPVVRFDLCTKCTLCWLECPDQCFDPTPDGYYDVDYEYCVGCGKCAEVCPVECIVMVDELAFEDN.. 333
288 2.000e-22UniRef50_A6UU77 Pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit n=9 Tax=cellular organisms TaxID=131567 RepID=A6UU77_META3  ali  53  10............IGGVLP-PGTSVENKTGGWRTYKPIIDYENCNSCLFCWLYCPDGVVIVEDDKI-TIDYDFCKGCGICEVECPKNAIKMIEED....... 89
289 2.000e-22UniRef50_C8X5Q2 4Fe-4S ferredoxin iron-sulfur binding domain protein n=29 Tax=Deltaproteobacteria TaxID=28221 RepID=C8X5Q2_DESRD  ali  19  154....FKGHDLAGFGGALKNIAMGCASRRGQHSGLAPRVNHHLCTGCGQCLPVCPAGALTIDSQKTLLLDTAQCIGCAACILACRHNALQVDW......... 245
290 2.000e-22UniRef50_A0A183LPV2 Uncharacterized protein n=18 Tax=Eumetazoa TaxID=6072 RepID=A0A183LPV2_9TREM  ali  29  64LRLTLGMVFKEP--ATLNYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTE.. 172
291 2.000e-22UniRef50_A5N1L0 PorD n=173 Tax=root TaxID=1 RepID=A5N1L0_CLOK5  ali  41  10.....TKWREMTAGGSIYLSGNSKEFITGSWRVDKPVFIQEKCKQCLLCAPVCPDSSIPVKEGKRLDFDYDHCKGCGICAEACAFEAIKMVKDEK...... 99
292 2.000e-22UniRef50_W2THJ5 NADH-quinone oxidoreductase, chain I n=2 Tax=Strongylida TaxID=6308 RepID=W2THJ5_NECAM  ali  30  316......GHFFMEP-ATINYPGPLSSRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDLDTNKCIFCGLCQEACPVDAIVEGPNFEYSTE.. 419
293 3.000e-22UniRef50_A0A1Q9NSY8 Pyruvate synthase subunit PorD n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_2 TaxID=1841597 RepID=A0A1Q9NSY8_9ARCH  ali  38  14...EKWGTEKLPRGGVVIESATSLLFKTGDWRIYKPVLKEEVCIGCTKCYFVCPDDCIELNENYAPIFDLDFCKGCSLCMDICPPHAIDMILE........ 103
294 3.000e-22UniRef50_A0A1F2RSP6 Uncharacterized protein n=1 Tax=Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 TaxID=1797186 RepID=A0A1F2RSP6_9BACT  ali  37  217................VFNTGNADLRHTGSWRVERPVIDRNACTRCGMCFVVCPDGSIALDEHGYPVIDYDHCKGCMICRSVCPRHIITKERET....... 294
295 3.000e-22UniRef50_B5YL33 NADH-quinone oxidoreductase subunit I n=13 Tax=Bacteria TaxID=2 RepID=B5YL33_THEYD  ali  29  19..ITFKTIFTTPV--TIRYPKQKRPGFRGRHAFVRPETGKERCVACTKCAQVCPSQCIYIDYSIKYEIDALRCIFCGYCEEVCPVNAIVLTEYFEYASY.. 127
296 3.000e-22UniRef50_A0A151AMZ1 Electron transport complex subunit RsxB n=14 Tax=cellular organisms TaxID=131567 RepID=A0A151AMZ1_9CLOT  ali  27  150....FKGHALAGFGGAIKQLAMGCAGKLDQHANSIPKINPLKCKSCSVCAKTCPENAIIL--NFKAKIEKNKCIGCASCMAVCPHKAISTNW......... 238
297 3.000e-22UniRef50_A0A1G3Q945 Pyruvate ferredoxin oxidoreductase n=4 Tax=Bacteria TaxID=2 RepID=A0A1G3Q945_9SPIR  ali  44  10.......WNELSCGAIVTEKGNARSYKTGSWRSSRPVVDKGLCIKCAVCWIFCPEGCIYQTEEGYYTANLDYCKGCGICPRECPVGCIAMIDEEE...... 97
298 3.000e-22UniRef50_A0A257LXB3 2-ketoisovalerate ferredoxin oxidoreductase n=2 Tax=Bacteria TaxID=2 RepID=A0A257LXB3_9BACT  ali  50  27.......................RVNKTGTWRQMRPVIDYGKCKNCGICWKYCPEPAIVIE-NERFVIDYEYCKGCGICAVECPFGAISMVSE........ 95
299 3.000e-22UniRef50_A0A2J6N7L8 Ferredoxin n=2 Tax=Fervidicoccus TaxID=685950 RepID=A0A2J6N7L8_9CREN  ali  50  16.................PKPGNKNIGFTTQWRWQRPIIDYKRCTDCKLCHYYCPDGAISFNP---IKIDYDYCKGCGICANVCPTKAISMVSELEH..... 91
300 4.000e-22UniRef50_A0A150IRQ9 Hydrogenase subunit EhaR n=2 Tax=cellular organisms TaxID=131567 RepID=A0A150IRQ9_9EURY  ali  50  22.....................PTLEQKTGSWRVYRPKINKEKCIKCFICWRCCPDISIEIDEEGFPKINYDYCKGCGICSHECPNEAINMEREEK...... 95
301 4.000e-22UniRef50_A0A1I4M8U2 Ion-translocating oxidoreductase complex subunit B n=42 Tax=Proteobacteria TaxID=1224 RepID=A0A1I4M8U2_9GAMM  ali  29  105..................NPVNGRERPRA-----VAYIDEALCIGCTLCIQACPVDAIVGAAKQMHTVLPELCTGCDLCVAPCPVDCIVMYPVTQTAGWDA 182
302 4.000e-22UniRef50_A0A2G9PTH7 Pyruvate synthase n=8 Tax=Archaea TaxID=2157 RepID=A0A2G9PTH7_9ARCH  ali  44  5...................IKPGTDNKTGSWRARKPIVDEEKCVGCGACERNCPDGTIRVGINKKAKVDYDYCKGCGICANECPVKAIRMEDE........ 78
303 4.000e-22UniRef50_A0A2T2WSS6 Pyruvate oxidoreductase subunit gamma n=1 Tax=Sulfobacillus benefaciens TaxID=453960 RepID=A0A2T2WSS6_9FIRM  ali  37  213.........KLGRAGALIRPGDYPVPLTGGWRMKKPAVFLNRCVNCLLCWQFCPDGAVVVDGTTFLGFDYAYCKGCEICDAVCPTKAVVMIDEE....... 298
304 4.000e-22UniRef50_Q9RU95 NADH-quinone oxidoreductase subunit I n=53 Tax=Terrabacteria group TaxID=1783272 RepID=NUOI_DEIRA  ali  29  10MGVTLGKLFQKPL--TVSYPEQRAPRFRGRHVLTRPDTGLEKCIGCSLCAAACPAYAIYVEAAKVYEINMLRCIFCGLCEEACPTGAVVLGNEFEMADY.. 125
305 4.000e-22UniRef50_A0A1F3J2Y5 Uncharacterized protein n=3 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3J2Y5_9BACT  ali  26  160....FKGHGSAGFGGCIKNVSMGIEGKKLMHFNNFPKTDNSKCTRCGVCVADCPSGAITLNP---LTIDKEKCIGCGKCISSCHFDAIS---NPEAADK.. 251
306 4.000e-22UniRef50_A0A1U5MTS0 NADH-quinone oxidoreductase subunit I n=39 Tax=Actinobacteria TaxID=201174 RepID=A0A1U5MTS0_9MYCO  ali  35  44.....................PTAPRYHGRHQLNRHPDGLEKCIGCELCAWACPADAIYVEGGRVYQINYLRCIGCGLCIEACPTRALTMTNDYELTDD.. 136
307 4.000e-22UniRef50_A0A0D0TIS0 Ion-translocating oxidoreductase complex subunit B n=101 Tax=Pseudomonadales TaxID=72274 RepID=A0A0D0TIS0_PSEFL  ali  27  44......GHETAGLAHLLRVPVLELDTSRGEAPAQIAYIREAECIGCTKCIQACPIDAIVGAAKLMHTVIIDECTGCDLCVAPCPVDCIEMRP......... 130
308 4.000e-22UniRef50_A0A256YUF6 Uncharacterized protein n=1 Tax=Candidatus Aenigmarchaeota archaeon ex4484_56 TaxID=2012505 RepID=A0A256YUF6_9ARCH  ali  42  14......GWKDLPEGAVISNIC-SKENKTGNWASMKPVWDSKKCTHCLLCVVYCPEGCIPVKNNKREDTNPKYCKGCGICARECPMKAIEMK.......... 97
309 4.000e-22UniRef50_A0A1G1DMN4 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1G1DMN4_9BACT  ali  38  217................VNTAGNIPLRKTGNWRTFKPIFNYELCNKCMICVARCPDGCIAVNERGFPSIDYDNCKGCLICIDECPVHAIEKVRE........ 294
310 5.000e-22UniRef50_A0A1M7T8X2 Uncharacterized protein n=1 Tax=Desulfovibrio litoralis DSM 11393 TaxID=1121455 RepID=A0A1M7T8X2_9DELT  ali  29  155....FKGHQLAGFGGAIKNLAMGCAGKKEQHAS-RFHTKIENCTACGMCIAHCPEDAISFVHKEKASINKDKCIGCGECLTVCKYDAIAIDFGTEMI.... 265
311 5.000e-22UniRef50_A0A151ZEG0 NADH-ubiquinone oxidoreductase 23 kDa subunit n=1 Tax=Tieghemostelium lacteum TaxID=361077 RepID=A0A151ZEG0_9MYCE  ali  33  460...............TINYPGPLSPRFRGEHALRRYPTGEERCIACKLCEAICPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFTTE.. 555
312 5.000e-22UniRef50_A0A1Q3SXS9 NADH-quinone oxidoreductase subunit I n=1 Tax=Chloroflexi bacterium 54-19 TaxID=1895928 RepID=A0A1Q3SXS9_9CHLR  ali  28  12MGVTLKNFFKKPI--TVQYPKHMRPRFRGAVGFVRDETGKERCVGCGLCSAVCPANCLTVVPGKIYLYDMSRCVFCGMCVEVCPELALVMTHEFELAVND. 122
313 5.000e-22UniRef50_S5DRZ2 NADH-quinone oxidoreductase subunit I n=17 Tax=Bacteria TaxID=2 RepID=S5DRZ2_9ACTN  ali  28  11LKVTFKELFKKSV--TDKYPKEFRQRFHGRHVLNKYEDGMEKCIGCELCAGVCPAQCIYVRGGFIYEINMLRCIYCGLCVEACPTEAITMTSLFEIS.... 123
314 5.000e-22UniRef50_A0A2D6CWN7 Ferredoxin n=1 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2D6CWN7_9BACT  ali  44  32.......WRDLPAGGTVPQGGTSENYVTGGWRSDKPIFDAVTCTHCLLCWVFCPDSAIDLDDGKVTGVAYDHCKGCGICAYECPQDAMVMAPDT....... 119
315 5.000e-22UniRef50_A0A1Q9NBC5 Pyruvate/ketoisovalerate oxidoreductases common subunit gamma n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_3 TaxID=1841598 Re  ali  38  222...EKWGYEKLPMGTVVPYPGSSKAFKTGDWAAVQPTLVKEKCISCLTCFFVCPDTAIKMDPKGYPIILTDFCKGCGMCAYECDERAL............. 310
316 5.000e-22UniRef50_A0A2H6GYH3 Pyruvate synthase subunit PorD n=14 Tax=cellular organisms TaxID=131567 RepID=A0A2H6GYH3_9ARCH  ali  45  1........MKISPGGVIRDMGSTVNTKTGGWRSERPVIDNDKCIECGSCWIFCPDSSIIVTNRRTYSVNLDFCKGCGICANECPSAAIKMILEEK...... 90
317 5.000e-22UniRef50_A0A1Y3GBA1 Putative Fe-S center protein n=1 Tax=Methanonatronarchaeum thermophilum TaxID=1927129 RepID=A0A1Y3GBA1_9EURY  ali  26  147.....TGHDATGVGGNLKNIGMGLPGKLEMHNAFELEVDKETCTGCKKCNDICPENAIQVNNK--AEINQQTCIGCGSCVGWCPKGAVKIPW......... 234
318 5.000e-22UniRef50_A0A1F5EWC0 Uncharacterized protein n=1 Tax=Candidatus Coatesbacteria bacterium RBG_13_66_14 TaxID=1817816 RepID=A0A1F5EWC0_9BACT  ali  48  20.................KTLGTMLVNETGSWRNVRPIISNENCIQCGICWKYCPDMAITEDAEGFPVVNLTYCKGCGVCAAECPKDCIEMVEE........ 95
319 5.000e-22UniRef50_F9VNM1 2-oxoacid--ferredoxin oxidoreductase delta subunit n=28 Tax=Archaea TaxID=2157 RepID=F9VNM1_SULTO  ali  44  10................VSRPSEGGGGKTGNWRIVKPVVDLNKCIGCKACFLWCPENTIIPTDGKV-SINYEYCKGCGVCSNVCPVKAISMVSEND...... 87
320 6.000e-22UniRef50_Q0FZ93 NADH-quinone oxidoreductase subunit I n=146 Tax=cellular organisms TaxID=131567 RepID=Q0FZ93_9RHIZ  ali  32  32..............ATVNYPGPVSPRFRGEHALRRYPNGQERCIACKLCEAICPAQAITIEAGPRYDIDMVKCIYCGFCQEACPVDAIVEGPNFEFATE.. 129
321 6.000e-22UniRef50_A0A2W6A4L7 NADH-quinone oxidoreductase subunit NuoI n=1 Tax=candidate division AD3 bacterium TaxID=2052315 RepID=A0A2W6A4L7_9BACT  ali  27  9LAFTLKTMLRKPI--TVRWPEETTPRHRGRHILHRYDNGLEKCIGCELCAAACPVGCIYVGPAERYEINLMRCIYCGYCAEACPTEAITLGPRYDLADY.. 123
322 7.000e-22UniRef50_I0GJ74 Pyruvate synthase subunit PorD n=8 Tax=root TaxID=1 RepID=I0GJ74_CALEA  ali  47  3...EKKGWKELMRGGDLP-PATALENKTGSWRSLRPVWDPSNCIHCMICVSYCPDMAIPITKSEEGVINFDYCKGCGICAVECPTKCITMVREE....... 107
323 7.000e-22UniRef50_A0A1I5U107 Pyruvate ferredoxin oxidoreductase delta subunit n=2 Tax=Oscillibacter TaxID=459786 RepID=A0A1I5U107_9FIRM  ali  43  14.......WQDITPGCNIFEGGTSQTVETGDWRTMKPVLDADKCRQCLLCVPVCPDMSIPMEDGKRGEFNYFFCKGCGICASACPFGAITMVRDEK...... 102
324 7.000e-22UniRef50_B1L694 Pyruvate:ferredoxin oxidoreductase, delta subunit n=1 Tax=Korarchaeum cryptofilum (strain OPF8) TaxID=374847 RepID=B1L694_KORCO  ali  43  1MSSSLVGWKDLPLGAV--AFISAKEYPTGEWAVFQPKIDESKCIKCGLCWMYCPDSVYRWDGESVPVPDLDHCKGCGICEVECPTKAIQMVR......... 90
325 8.000e-22UniRef50_N6WSE9 Putative Fe-S center protein n=1 Tax=Thermoplasmatales archaeon SCGC AB-539-C06 TaxID=1242690 RepID=N6WSE9_9EURY  ali  25  127....VKGHGCTGLGGAIKNIGMGRKGKLALHANVSPTINESSCNACGKCVDDCPTKAIKI--NGKAKIDPKLCIGCAKCIAVCPERAVNIPWN........ 216
326 8.000e-22UniRef50_A0A0G0F0C0 Iron-sulfur cluster-binding protein n=1 Tax=candidate division WS6 bacterium GW2011_GWC2_36_7 TaxID=1619091 RepID=A0A0G0F0C0_9BAC  ali  29  129.....KGHECAGFGGAIKNLGMGAKTKKIIHNASKPEIDPEKCIGCGVCAKLCPAKAIDIIDDKAPEWN--KCWGCSICEISCPQEALT............ 214
327 9.000e-22UniRef50_A0A1F5DUB1 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon RBG_13_52_12 TaxID=1797379 RepID=A0A1F5DUB1_9ARCH  ali  43  203.............................SWRVFYPVVDEEKCIGCKTCWIFCPEAALEWKENNKPAMIDRACKGCGVCANECPVKAIEMKRVE....... 267
328 9.000e-22UniRef50_A0A2J6N9T9 Pyruvate synthase n=1 Tax=Candidatus Korarchaeota archaeon TaxID=2056630 RepID=A0A2J6N9T9_9ARCH  ali  40  1MSNQLPTWQEVTDAGTVFNPPNSVLNKTGGWRTYRPIIDQAKCIDCRICLLVCPDSVITRKEAQVYDIDYDFCKGCLVCENECPAKAITHIEEEK...... 102
329 1.000e-21UniRef50_A0A1Q7CC67 Uncharacterized protein n=1 Tax=Actinobacteria bacterium 13_2_20CM_2_66_6 TaxID=1803492 RepID=A0A1Q7CC67_9ACTN  ali  34  13LQFTKPGWTTMRPGIIVRKPGERPQYKKYTARTLRPVVNFDTCIKCTMCWLDCPDECFEVTPEGHYEVVYQACIGCGICAQVCPVDCIVMVDELRFEDNE. 116
330 1.000e-21UniRef50_A0A1V6BV70 Electron transport complex protein RnfB n=10 Tax=Bacteria TaxID=2 RepID=A0A1V6BV70_9SPIR  ali  26  154....FKAHEISRIGGAIKNLSMGCAGKLDMHSNARPFVKEKNCTSCKKCVSSCQVAAI--EAREKAFIRSDICVGCARCVSICPVGAIRIDWN........ 243
331 1.000e-21UniRef50_A0A256ZKH1 [Fe-S]-binding protein (Fragment) n=3 Tax=Archaea TaxID=2157 RepID=A0A256ZKH1_9ARCH  ali  29  157.....KGHPRTGFGGALKNIGVGCLTKKGRHLAKKPQIKPEFCDGCGKCAEFCPAGAI-VKEGDVYRIDQEKCWACG-CWELCPKKAITGWAEMHHPSNE. 253
332 1.000e-21UniRef50_A0A1G0ZZA4 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium RIFOXYC12_FULL_60_16 TaxID=1798582 RepID=A0A1G0ZZA4_9BACT  ali  26  151....VTGHLVACMGASIKNVAMGRAGKLQQHHSAEPIFSKSKCTACGRCARHCPTAAITVE--KYATLDVKRCIGCGECYAFCPHGAVSFEWSE....... 241
333 1.000e-21UniRef50_Q74GA0 NADH-quinone oxidoreductase subunit I 1 n=9 Tax=root TaxID=1 RepID=NUOI1_GEOSL  ali  24  9LKITLKHMFMKPV--TLQYPDERPPNFRGLHAL-KVSHDKAKCVACYLCPTVCPAKCITVEAGERYEIDMLRCIFCGYCVEACPVDALKMTGQFELANYK. 117
334 1.000e-21UniRef50_A0A0J8G4Q0 Ion-translocating oxidoreductase complex subunit B n=32 Tax=Pseudomonas TaxID=286 RepID=A0A0J8G4Q0_9PSED  ali  30  49..........AGLANLLNVPVLALDTTRGEAPAQIAYIREAECIGCTKCIQACPVDAIVGSAKLMHTVIIDECTGCDLCVAPCPVDCIEMRP......... 130
335 1.000e-21UniRef50_A0A2N0LCN6 Uncharacterized protein n=34 Tax=Bacteria TaxID=2 RepID=A0A2N0LCN6_9CHLR  ali  34  220.KFELPGWKTMEEGVVIYQPVRSEVFKKYSTRSMRPVINFETCIKCTLCWLQCPDTCFDVTPDGLYDANMESCCGCGVCEAVCPVDCVTMVSEADFEDN.. 333
336 1.000e-21UniRef50_A0A075R6X8 Pyruvate synthase subunit PorC n=205 Tax=Bacteria TaxID=2 RepID=A0A075R6X8_BRELA  ali  35  221...TVLGYLTQPIGGVITNPGNSVLKDLSTSRGYLPHFNEETCIHCAACEMHCPDFCFVWEEGELRGIDYQYCKGCMKCVEVCPTGSLTREREEEQYARE. 327
337 1.000e-21UniRef50_A1B486 NADH-quinone oxidoreductase subunit I n=1080 Tax=root TaxID=1 RepID=NUOI_PARDP  ali  29  34...............TLNYPGPLSPRFRGEHALRRYPNGEERCIACKLCEAVCPAQAITIDAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYATE.. 129
338 1.000e-21UniRef50_M1Z373 NADH-quinone oxidoreductase subunit I n=12 Tax=Bacteria TaxID=2 RepID=M1Z373_NITG3  ali  25  16MGVTFRNMVSKP--TTFSYPEVKRERYRGRHFLNKDEEGYEKCIGCSLCSVNCPVGCIHVVAAEVYEINLLRCIYCGFCEEACPVDAVVLREHYELADYD. 131
339 1.000e-21UniRef50_A0A0S8HMY1 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium SM23_33 TaxID=1703412 RepID=A0A0S8HMY1_9BACT  ali  29  146.....KGHGQSGFGGAIKNIAMGCGTTRGRHRLMSAQWDRSKCTGCLLCRDNCPNQAITYRDGQISIFDHA-CKYCMHCVLACPQHAITIDQR........ 237
340 1.000e-21UniRef50_A0A0F7IHD3 Pyruvate ferredoxin oxidoreductase, gamma subunit/pyruvate ferredoxin oxidoreductase, delta subunit n=2 Tax=Geoglobus TaxID=19081  ali  40  218................VSRPKRGVAGKTWVWRDFVPEIDYSKCTACLSCWLYCPESAIIRNGDGVA-IDYEYCKGCLVCHSVCPRAAVRVSRE........ 293
341 1.000e-21UniRef50_A0A2T3YYL9 Uncharacterized protein n=1 Tax=Trichoderma asperellum CBS 433.97 TaxID=1042311 RepID=A0A2T3YYL9_9HYPO  ali  30  735MYVLLEQFFRPPY--TIYYPGPISPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAEERYDIDMTKCIYCGFCQESCPVDAIVESPNAEYATE.. 860
342 2.000e-21UniRef50_Q2GJS3 NADH-quinone oxidoreductase subunit I n=104 Tax=cellular organisms TaxID=131567 RepID=NUOI_ANAPZ  ali  30  35...............TLRYPGPLSTRFRGEHALRRYESGEERCIACKLCEAICPAQAITIEAEERYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTE.. 130
343 2.000e-21UniRef50_A0A1V5VD35 NADH dehydrogenase subunit I n=3 Tax=Bacteria TaxID=2 RepID=A0A1V5VD35_9BACT  ali  23  166................IKNIGMGCSGKQNQHSDVKPKISLKKCVGCGSCMKKCPTDAISFNEDHKAVIDRALCIGCAECTVTCRFEAIAVSWKSDL..... 248
344 2.000e-21UniRef50_E8WJA4 NADH-quinone oxidoreductase subunit I n=13 Tax=Bacteria TaxID=2 RepID=E8WJA4_GEOS8  ali  25  9LQITISHMFKKPV--TLQYPTERPEGFRGLHALNV-SHDKAKCVACYLCPTVCPAKCITVEAGEKYEIDMLRCIFCGYCVEACPVDAIRMTEEFELANY.. 116
345 2.000e-21UniRef50_B5YKI7 NADH-quinone oxidoreductase subunit I n=10 Tax=Bacteria TaxID=2 RepID=B5YKI7_THEYD  ali  27  21..LTLKMLFSKPV--TIQYPFERRDGFRGRHALVRPFTDKDKCIGCMRCTTVCPSRCIYIKREKTYIIDASRCIFCAYCVEACPVCALVLTEDFEYSSY.. 127
346 2.000e-21UniRef50_A0A1F9WRH3 Uncharacterized protein n=6 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9WRH3_9BACT  ali  24  150....FKGHEISGFGGALKNIGMGCAGKYAMHDKLTPRVDVKQCIGCGQCVKWCGGHALRLENGTI-VFDEKKCTGCGECILSCPSSVFEIPWDENTSA... 245
347 2.000e-21UniRef50_D1JE83 Putative pyruvate oxidoreductase, delta and gamma chain n=17 Tax=cellular organisms TaxID=131567 RepID=D1JE83_9ARCH  ali  36  220...............AINATGNTPLRMTGNWRVFRPVWNYDSCTRCMICVSRCPDGCILVNEDGFPYTDYDNCKGCLICVEECPTN............... 290
348 2.000e-21UniRef50_A0A1F5BBW6 Uncharacterized protein n=13 Tax=root TaxID=1 RepID=A0A1F5BBW6_9BACT  ali  49  1..MKKETWKELPIGTVNIHAGNSVINLTGTWRSRRPEFIEKNCIQCFFCWLYCPHFAILVNDGKVTGINYDYCTGCGLCAEECPTKAIIMVKEEIKLAE.. 100
349 2.000e-21UniRef50_E9JB10 Uncharacterized protein (Fragment) n=2 Tax=Aculeata TaxID=7434 RepID=E9JB10_SOLIN  ali  32  78..............ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERYDIDMSKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 174
350 2.000e-21UniRef50_C1D0H9 NADH-quinone oxidoreductase subunit I n=16 Tax=Bacteria TaxID=2 RepID=NUOI_DEIDV  ali  29  10MGLTLGKLFQKPV--TVSYPEERKPRFRGRHVLTRPGTGLEKCIGCSLCAAACPAYAIYVEAGKVYEINMLRCIFCGMCEEACPTGAVVLGNEFEMADY.. 125
351 2.000e-21UniRef50_A0A1W6JWS0 Ferredoxin n=2 Tax=Acidianus TaxID=12914 RepID=A0A1W6JWS0_9CREN  ali  48  10................VSRPSKGAGGKTGNWRVVRPVVNLDKCIGCKACYLWCPEATII--PGDKVSIDYEYCKGCGICSNVCPVKAIQMVSE........ 84
352 2.000e-21UniRef50_A0A1Q4CY15 NADH-quinone oxidoreductase subunit I n=140 Tax=root TaxID=1 RepID=A0A1Q4CY15_9RHOB  ali  30  38...............TLNYPGPLSPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIDAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTE.. 133
353 2.000e-21UniRef50_M4YM48 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family n=3 Tax=Euryarchaeota TaxID=28890 RepID=M4YM48_TH  ali  39  7.......YKEMIIGSRVIEPGNSEKFRTGDWRSQVPVIDKSICISCLSCWIDCPDNCIVVDEDGLVDVKTTHCKGCGICSQVCPKDAITMKED........ 92
354 2.000e-21UniRef50_A0A212PL13 NADH-quinone oxidoreductase subunit I n=1 Tax=Geobacter sp. DSM 9736 TaxID=1277350 RepID=A0A212PL13_9DELT  ali  22  9LKITFKHLFMKPV--TLQYPTERPPNFRGLHALNV-SHDRAKCVACYLCPTVCPAKCIRVEAMEVYEIDLLRCIFCGYCVEACPVDALRMTQEFELANY.. 116
355 2.000e-21UniRef50_A0A124FD11 Pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit n=1 Tax=Clostridia bacterium 41_269 TaxID=1635275 RepID=A0A124FD11_9  ali  47  8....LKLYEELPFAGTYPSPKTENDKQTGNWKVQRPVLDTEKCTQCWQCWIFC-ADAIITRGENGPEFFYKYCKGCGVCANECPTGAITMVPELEFED... 101
356 2.000e-21UniRef50_A0A1W9VT47 Pyruvate ferredoxin oxidoreductase n=8 Tax=Bacteria TaxID=2 RepID=A0A1W9VT47_9BACT  ali  46  47..............................WRVFRPVVDNDKCVGCMRCYMLCPDGVIFKVENNKVDVDFDYCKGCGVCAFECPVDAIKMTKE........ 109
357 2.000e-21UniRef50_A0A0A8WW37 NADH-quinone oxidoreductase subunit I n=30 Tax=root TaxID=1 RepID=A0A0A8WW37_9DELT  ali  22  9LKITLKHMFMKPV--TLQYPTERPPNFRGLHALKVAH-NNAKCVACYLCPTVCPAKCITVQAGEVYEIDMLRCIFCGYCVEACPVDALKMTQTFELANYK. 117
358 3.000e-21UniRef50_A0A0Q0W8P5 Uncharacterized protein n=1 Tax=Desulfuromonas sp. SDB TaxID=1735325 RepID=A0A0Q0W8P5_9DELT  ali  28  148....FKGHLLAGIGGAIKNISMGRAGKQIMHADVEPQRNEEQCLLCGYCVESCPVNAVCLGEFG-PEFDLELCIGCGECIAVCPNHVIKILWNEEIFAEK. 248
359 3.000e-21UniRef50_A0A151BC85 4Fe-4S ferredoxin n=1 Tax=Candidatus Bathyarchaeota archaeon B24 TaxID=1779368 RepID=A0A151BC85_9ARCH  ali  28  150....FKGHEITGFGGAIKNYGAGCETKYYIHFENKPTVDEALCDGCGECVDACPTGAITLR-GGKAKVDWNLCYGCKACQSVCPRKALK............ 236
360 3.000e-21UniRef50_A0A2G9Z3T7 Ferredoxin n=3 Tax=Candidatus Moranbacteria TaxID=1752737 RepID=A0A2G9Z3T7_9BACT  ali  49  1..........MEFGAVIK-HDQSKSPKTGAWRYMHPEVDKEKCIGCATCVPFCPDAAIIIKDGK-AEIDYEYCKGCGVCAEVCPMKAIIMKKK........ 81
361 3.000e-21UniRef50_A0A0M3QEX3 NADH-quinone oxidoreductase subunit I n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A0M3QEX3_9DELT  ali  26  9LSITFK-HLLPGHSTTVQYPKQRLERFRGLHRLV-PAHDREKCVACYLCPTVCPAKCITVESAEVYKIDLLRCIFCGYCVEACPVEAIEMTGTYELAN... 116
362 3.000e-21UniRef50_Q1H2M5 Ion-translocating oxidoreductase complex subunit B n=15 Tax=Proteobacteria TaxID=1224 RepID=Q1H2M5_METFK  ali  35  60...................PYVPLNPFHGATRKMRAVIDEARCIGCTLCIKACPVDAILGAHKQMHTVIADECTGCELCLVPCPMECIDMVP......... 133
363 3.000e-21UniRef50_A0A1V5E7H8 Pyruvate synthase subunit PorD n=15 Tax=cellular organisms TaxID=131567 RepID=A0A1V5E7H8_9DELT  ali  50  9...............AISRPKEGAAGKTGSWRLFRPVVDREKCNRCGLCVLYCPDCAM----GTDIEIDLEFCKGCGICANECPKKAIVMAPE........ 82
364 3.000e-21UniRef50_A0A1V4Z3H2 Pyruvate/ketoisovalerate oxidoreductases common subunit gamma n=5 Tax=Methanomassiliicoccales TaxID=1235850 RepID=A0A1V4Z3H2_9EUR  ali  44  202.....PAWNEIPIGGVDIGPASSSQNLTGRWKWSTPRYDREKCIRCLRCWWSCPDAAVIRLEDDYMRWDMDHCKGCGICADICPVSAIEMVQ......... 297
365 3.000e-21UniRef50_A0A2N9N8I4 Pyruvate synthase, subunit PorCD n=21 Tax=Bacteria TaxID=2 RepID=A0A2N9N8I4_9BACT  ali  34  221.KFDLPKWHEMGEGIAIRQPDRNPTFKKFSTRTMRPVVNFDTCIKCTLCWLQCPDSCFDVTPEGLYDANMEACCGCGVCEAVCPVKCVTMVNETEFSDN.. 338
366 3.000e-21UniRef50_A0A2G5NF13 (4Fe-4S)-binding protein n=2 Tax=Pseudomonas TaxID=286 RepID=A0A2G5NF13_9PSED  ali  29  49..........AGLALLLRVPVLDLDTSRGEAPAQVAYIREAECIGCTKCIQACPVDAIVGAAKFMHTVIIDECTGCDLCVAPCPVDCIEMRP......... 130
367 3.000e-21UniRef50_A0A161I6Y3 NADH-quinone oxidoreductase subunit I n=91 Tax=root TaxID=1 RepID=A0A161I6Y3_9MICO  ali  30  26.GVTFASMFR--PAVTEEYPTPPQTRFHGRHQLNRYADGLEKCIGCELCAWACPADAIYVEGGRVYQINYLRCIFCGLCIEACPTRALTMTNDFELA.... 143
368 3.000e-21UniRef50_UPI0009FC1C78 hypothetical protein n=1 Tax=Meiothermus chliarophilus TaxID=52023 RepID=UPI0009FC1C78  ali  50  215.........................PRTGGWRTLKPAVRLEACVNCLLCWVYCPDAAILTENQAFVGFDYQHCKGCELCVKACPTAAIEMVPE........ 283
369 3.000e-21UniRef50_A0A0F9AZC6 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9AZC6_9ZZZZ  ali  29  88.....KGHGHSGFGGAIKNIAMGCVDGTTRHRLMSAEWDESKCSGCLLCRDNCPNDAISFEDGKLSIFDHA-CKYCMHCQLACPTDAITIDQR........ 179
370 4.000e-21UniRef50_C3KBZ6 Ion-translocating oxidoreductase complex subunit B n=139 Tax=Pseudomonadales TaxID=72274 RepID=C3KBZ6_PSEFS  ali  28  49..........AGLALLLRVPVLDLDTHRGEAPAQVAYIREAECIGCTKCIQACPVDAIVGAAKLMHTVIIDECTGCDLCVAPCPVDCIEMHP......... 130
371 4.000e-21UniRef50_X5F5G7 Ion-translocating oxidoreductase complex subunit B n=200 Tax=Proteobacteria TaxID=1224 RepID=X5F5G7_NEIME  ali  36  72...................................ARIDETACIGCTACIRACPADAIMGAGKLMHTVIADECTGCGLCVAPCPVDCIHMQPVAD...... 131
372 4.000e-21UniRef50_A0A0F3NIY2 NADH-quinone oxidoreductase subunit I n=14 Tax=cellular organisms TaxID=131567 RepID=A0A0F3NIY2_ANAPH  ali  30  17...............TLRYPGPLSTRFRGEHALRRYESGEERCIACKLCEAICPAQAITIEAEERYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYSTE.. 112
373 4.000e-21UniRef50_A0A244EXP9 Ion-translocating oxidoreductase complex subunit B n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A244EXP9_PSESX  ali  31  61............LAGLLSVPVLPLDTERGAAPAQVAFIREAECIGCTKCIQACPVDAIVGAAKLMHTVIIDECTGCDLCVAPCPVDCIEMHP......... 140
374 4.000e-21UniRef50_A0A1V5VFZ4 Pyruvate synthase subunit PorC n=1 Tax=bacterium ADurb.Bin236 TaxID=1866925 RepID=A0A1V5VFZ4_9BACT  ali  42  242......GWKNAPIGGVIVNPGNTVLNDTASRTGFKPVWDESKCINCAECDTACPDQCIIFDDKGKEHIDYMHCKGCLRCVEVCPKQALT............ 334
375 4.000e-21UniRef50_A0A1X7DDE9 NADH-quinone oxidoreductase subunit I n=2 Tax=Desulfovibrio sp. K3S TaxID=1519643 RepID=A0A1X7DDE9_9DELT  ali  29  355...TFKAMFTRPI--TVQYPEERRTPPPRSRALTRSPDGDERCVACYLCSAACPVSCISMQADTRADINFARCIYCGLCEEACPTLAIQLTPEYEFASD.. 460
376 4.000e-21UniRef50_A0A2T0BCP6 4Fe-4S binding domain protein n=2 Tax=Clostridiales TaxID=186802 RepID=A0A2T0BCP6_9CLOT  ali  22  157....FKGHEMTGFGGTIKNIGMGCAGKTDQHSSGKPHIDPTLCRGCRRCQRECANGGLEFDTSKKMMVNHENCVGCGRCLGACNFDAIVFDNDAANA.... 253
377 4.000e-21UniRef50_A0A2R4XIZ9 Ion-translocating oxidoreductase complex subunit B n=2 Tax=Alcaligenaceae TaxID=506 RepID=A0A2R4XIZ9_9BORD  ali  32  79................................LTVAVIDEEHCVGCTLCIKACPVDAIIGANKRMHTVLPDWCTGCDLCVAPCPVDCITMTPVSDPA.... 143
378 4.000e-21UniRef50_Q1IQK4 NADH-quinone oxidoreductase subunit I 2 n=35 Tax=Acidobacteria TaxID=57723 RepID=NUOI2_KORVE  ali  25  14MGITFSEMFKYPDGPGVLRGAVFQERFRGMHVLQRDENGLEKCVACFLCAAACPSNCIYIEAAKVYNIDYNRCIFCGYCVEACPTDAITHGHGFELAT... 132
379 4.000e-21UniRef50_A2STC6 Pyruvate ferredoxin oxidoreductase, delta subunit n=9 Tax=Archaea TaxID=2157 RepID=A2STC6_METLZ  ali  43  6..............GCTARPGNSRNNKTGSWRVFYPVMDTEKCTKCGTCQLICPEGCINQNPDKTYSIDLDFCKGCGMCAEECPAKAIHMVKEEK...... 88
380 4.000e-21UniRef50_A0A1G1IS21 Uncharacterized protein n=6 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1IS21_9BACT  ali  25  167....VTGHMQSGFAGSLKNLGISRQGKLLQHSGTLPEITIEKCIGCSACMSICPANAIGIKKKKAILV-KERCVGCGECTVACRAGAIDIKYDE....... 258
381 4.000e-21UniRef50_A1RXL7 Pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit n=3 Tax=root TaxID=1 RepID=A1RXL7_THEPD  ali  49  20............................GSWRTERPVVDMSKCRLCGVCWLYCPDGVIEIDEDRLVKIDYDYCKGCGVCAAECPFKAISMVREHE...... 87
382 5.000e-21UniRef50_A0A2N2PGT0 NADH-quinone oxidoreductase subunit I n=1 Tax=candidate division BRC1 bacterium HGW-BRC1-1 TaxID=2013722 RepID=A0A2N2PGT0_9BACT :  ali  22  35LGVTGRYLFKKPV--TLQYPTEKPDGYRGIH-----VYEKDKCIACDMCAVACPVDCIYIEEMTRYEIDYNRCIFCALCVEPCPTSCIHMGQSYDLASYDS 139
383 5.000e-21UniRef50_M7TCS7 Putative Fe-S center protein n=13 Tax=root TaxID=1 RepID=M7TCS7_9EURY  ali  32  100....VKGHVATGMGGAIKNFGMGKETKRKMHRGSRPIYKEDACTYCGVCAEVCPFDAIKIKGNKWKQ-NARNCFGCGVCIENCETGALK............ 186
384 5.000e-21UniRef50_A0A1Q6XIB2 NADH-quinone oxidoreductase subunit I (Fragment) n=1 Tax=Actinobacteria bacterium 13_2_20CM_68_14 TaxID=1803496 RepID=A0A1Q6XIB2_  ali  26  16.GVTFKQIFKKPL--TLQYPEYKRPRFRGRHRLWRHENGLEKCVGCSLCAAACPADCIRVVAAEIYEINMSRCIFCGYCELACPFDAITLGNDYE...... 125
385 5.000e-21UniRef50_C4GGY5 Ion-translocating oxidoreductase complex subunit B n=49 Tax=Bacteria TaxID=2 RepID=C4GGY5_9NEIS  ali  38  72...................................AWIDEAVCIGCTACIRACPVDAIMGASKQMHTVLADECTGCGLCVAPCPVDCIYMRP......... 128
386 5.000e-21UniRef50_A0A2H5WRW7 NADH-quinone oxidoreductase subunit I n=28 Tax=root TaxID=1 RepID=A0A2H5WRW7_9BACT  ali  26  15MRITLRHF--LGEKQTVFYPEERKEQFRRRHVLLRYENGLERCIGCSLCAGACPVRCIYVEAAKRYEINLLRCIYCGYCQEACPTGAIVLREDYELADY.. 129
387 5.000e-21UniRef50_A0A2H5W056 NADH-quinone oxidoreductase subunit I n=72 Tax=Bacteria TaxID=2 RepID=A0A2H5W056_9BACT  ali  29  16.....TTFRHLPDRVTIQYPDEPVRRFRGQHILHVDENGREKCVACFLCAIACPADAIYIEAAKVYDIDYGKCIFCGFCEEACPKDAITMGPNFELA.... 127
388 5.000e-21UniRef50_Q9A6Y4 NADH-quinone oxidoreductase subunit I n=259 Tax=root TaxID=1 RepID=NUOI_CAUVC  ali  33  34...............TVIYPNERSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDIDMVKCIYCGLCQEACPVDAIVEGPNTEFATE.. 129
389 5.000e-21UniRef50_A0A1G3C4Z3 Uncharacterized protein n=2 Tax=Planctomycetes bacterium RIFCSPLOWO2_12_FULL_40_19 TaxID=1801983 RepID=A0A1G3C4Z3_9BACT  ali  39  225....................ETTKLKKTGNWRLFRPVIDHEKCSRCRTCFVYCPHSCISIDEGDYPQIDYNNCKGCLTCFYECPKKVISKDRE........ 297
390 6.000e-21UniRef50_A0A1V6DNK7 Pyruvate synthase subunit PorD n=4 Tax=Bacteria TaxID=2 RepID=A0A1V6DNK7_9BACT  ali  49  3...DLKNWQDLPLGGVIVEAGSAAKYETGSWRTWRPVTHREHCIHCLKCWEYCPEDAIKLEDGTDAEIEYFHCKGCGLCVRECPVN............... 94
391 6.000e-21UniRef50_A0A1V5T5B4 Anaerobic sulfite reductase subunit C n=3 Tax=Bacteria TaxID=2 RepID=A0A1V5T5B4_9BACT  ali  24  155....FKGHVLTGFGGAIKNIGMGCKGKFEMHSSAAPKVTSQKCVGCGMCIPTCAQSALKLSDGKI-ELDKKLCAGCGECIIACHTAALSITWNEE...... 247
392 6.000e-21UniRef50_A0A1V5A581 Pyruvate synthase subunit PorD n=9 Tax=Euryarchaeota TaxID=28890 RepID=A0A1V5A581_9EURY  ali  47  8...............AISRPTRGACGKTGSWRVFRPIVDLEKCNSCGICAMFCPDAAIS----EDLEIDLDFCKGCGICAHECPKKAIRMEREEK...... 83
393 6.000e-21UniRef50_A0A1Q9P781 Pyruvate/ketoisovalerate oxidoreductases common subunit gamma n=1 Tax=Candidatus Heimdallarchaeota archaeon AB_125 TaxID=1841596  ali  36  224...................PGAAKQRKTGTWSKEKAVVNQEKCIECLKCLFHCPEGIIYKNNGKV-KINNVYCKTCGICVAVCPVDAVSIEEIEDY..... 299
394 6.000e-21UniRef50_A0A0S8G0J4 Uncharacterized protein n=1 Tax=Planctomycetes bacterium SM23_32 TaxID=1704029 RepID=A0A0S8G0J4_9BACT  ali  46  4..............GAVAEGGTMAGLYTGSWRTYCPVTDFEKCTHCMLCWIVCPDSAVRVEGGKKLGTDYQYCKGCGICAVECPADAIEMKLESDLS.... 86
395 6.000e-21UniRef50_A0A160VAY7 Pyruvate:ferredoxin oxidoreductase, gamma subunit / Pyruvate:ferredoxin oxidoreductase, delta subunit n=5 Tax=root TaxID=1 RepID=  ali  34  220.SFDMPGWKTMEEGLVIYQPGRSEVFKKWSVRSMRPVINFDTCIKCTLCWLQCPDTCFDVTPDGLYDANMESCCGCGVCEAVCPVDCVTMVSEAEFNDN.. 333
396 6.000e-21UniRef50_A3LRW9 Mitochondrial complex I NUIM TYKY subunit (Proton translocation) n=321 Tax=Eukaryota TaxID=2759 RepID=A3LRW9_PICST  ali  31  97...............TIYYPGPISPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEEKYDIDMTKCIYCGYCQESCPVDAIVESPNVEYST... 191
397 6.000e-21UniRef50_A0A212LWC6 Ketoisovalerate oxidoreductase subunit VorD n=13 Tax=Bacteria TaxID=2 RepID=A0A212LWC6_9FIRM  ali  45  15.......WRDITPGCNIYEGGTTALVNTGDWRTMMPVLDKEKCKQCLLCVPVCPDMSIPMAEQERGDFNYFFCKGCGICAEVCPFDAIAMVREEK...... 103
398 7.000e-21UniRef50_A0A1V5R9N4 Ferredoxin-1 n=1 Tax=Parcubacteria group bacterium ADurb.Bin316 TaxID=1852942 RepID=A0A1V5R9N4_9BACT  ali  28  145...............AIKNLGMGRKGKLAMHASIKHNIQKEKCISCGSCISHCPVSAIEFDDNKKAFIKQHKCISCSKCISVCPVGAVKIPW......... 224
399 7.000e-21UniRef50_A0A0S8I9Q5 NADH-quinone oxidoreductase subunit I n=1 Tax=bacterium SM23_31 TaxID=1703762 RepID=A0A0S8I9Q5_9BACT  ali  26  23MLVTLKHLIRPHKRVTIQYPEERRAGYRGFHRLNKDEQDRIKCVACEMCATACPANCITIEPVERFDINMLVCIYCGMCEEACPVDAIELTKIHDWAAY.. 137
400 7.000e-21UniRef50_A0A0B5GFY5 NADH dehydrogenase subunit 8 n=8 Tax=Eukaryota TaxID=2759 RepID=A0A0B5GFY5_STALP  ali  31  31...............TLNYPGPLSSRFRGEHALRRYSDGEERCISCKLCEVVCPALAITIDGAIRYDIDMTKCIYCGLCQEACPVDAIVEGPNFEYST... 125
401 7.000e-21UniRef50_A0A0K9JS88 Ion-translocating oxidoreductase complex subunit B n=59 Tax=Burkholderiaceae TaxID=119060 RepID=A0A0K9JS88_9BURK  ali  31  84..................................VAVIDENVCIGCTLCIQACPVDAIVGTAKQMHTIIPELCTGCDLCVPPCPVDCIAMIPVTGAAT... 147
402 8.000e-21UniRef50_UPI00030148E5 electron transport complex subunit RsxB n=1 Tax=Pseudomonas fluorescens TaxID=294 RepID=UPI00030148E5  ali  31  244................LKVPVLELDISRGAAPPQVAFIREAECIGCTKCIQACPIDAIVGAAKLMHTVIIDECTGCDLCVAPCPVDCIEMHP......... 319
403 8.000e-21UniRef50_A0A2H6EZA2 NADH-quinone oxidoreductase subunit I n=19 Tax=root TaxID=1 RepID=A0A2H6EZA2_9BACT  ali  30  28LSITFKHLFKKHI--TLEYPDEPPPGYRGAIRLNRDELGREKCVACEMCATACPANAISMQGGIWYKIDMLRCILCGMCEEACPEEAIELTVIYDFADY.. 138
404 8.000e-21UniRef50_M1E6E7 Pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit n=3 Tax=cellular organisms TaxID=131567 RepID=M1E6E7_9FIRM  ali  46  18.......WEEMPLGNTLVGGANSECLKTGTWRVQHPTVNKEKCTNCMTCWLFCPDMSIVVEKKEMLGFDPVHCKGCGVCSKVCPVNAIEMVLGSDFENTE. 114
405 8.000e-21UniRef50_A0A0D0KLT6 Ion-translocating oxidoreductase complex subunit B n=47 Tax=Pseudomonadaceae TaxID=135621 RepID=A0A0D0KLT6_9PSED  ali  31  73.................................QIAVIREAECIGCTKCIQACPVDAIVGAAKLMHTVISDECTGCELCIAPCPVDCIDLI.......... 130
406 8.000e-21UniRef50_A0A1V4UET5 Pyruvate synthase subunit PorD n=2 Tax=unclassified Methanoregulaceae TaxID=1811719 RepID=A0A1V4UET5_9EURY  ali  43  8...............AISRPVKGACGKTGSWRVFQPRVNRDLCNACGICAMFCPDNAIS----ENLEIDLDFCKGCGICAHECPKKAIEMVREEK...... 83
407 9.000e-21UniRef50_A0A229H3U8 Ion-translocating oxidoreductase complex subunit B n=1 Tax=Moraxella sp. VT-16-12 TaxID=2014877 RepID=A0A229H3U8_9GAMM  ali  35  111.................................VRAVIDESECIGCTKCLPACPVDAIIGTAKHMHTIITDLCTGCELCLPPCPVDCISLVP......... 169
408 9.000e-21UniRef50_Q2LV75 Pyruvate synthase delta subunit n=6 Tax=Bacteria TaxID=2 RepID=Q2LV75_SYNAS  ali  43  9...............AMSRPKQGAAGRTGFWRISKPVVDKDKCDSCGICRMYCPDNAI----DGNIEIDLEFCKGCGICANECPKKAIEMVRD........ 82
409 1.000e-20UniRef50_F8EBQ8 NADH-quinone oxidoreductase subunit I n=157 Tax=cellular organisms TaxID=131567 RepID=F8EBQ8_RUNSL  ali  27  30LGITIKHFFQKKV--TIQYPEVKQPVFRGRHVLKRDEQGRERCTACGLCAVACPAEAISMVAAERYEINMLRCIFCGLCEEACPKQAIYLRHDE....... 140
410 1.000e-20UniRef50_A0A1J5E5H6 Uncharacterized protein n=5 Tax=Candidatus Desantisbacteria TaxID=1819803 RepID=A0A1J5E5H6_9BACT  ali  23  154....FKGHMLSGFGGALKNVGMGCADKAGMHLGAIPLIKPELCKGCLLCLNSCPGRAISLI-KKIPVIDHASCIGCGQCFSFCQNGVFKIDWD........ 244
411 1.000e-20UniRef50_A0A2U9Y0T3 DUF362 domain-containing protein n=2 Tax=Clostridium TaxID=1485 RepID=A0A2U9Y0T3_CLOAT  ali  23  42....FKGHVLAGFGGAIKQLSMGCAGKLAQHANSIPKINRLKCRACKACANKCPQSAITV--DKKAKIDKNKCVGCASCMATCQFSAITNSW......... 130
412 1.000e-20UniRef50_G0F0W8 Ion-translocating oxidoreductase complex subunit B n=111 Tax=Bacteria TaxID=2 RepID=G0F0W8_CUPNN  ali  35  80..................................VARIDESLCIGCTLCIQACPVDAIAGAAKQMHTVIPDWCTGCDLCVAPCPVDCIDMVPVT....... 139
413 1.000e-20UniRef50_A0A0U5AYX5 Pyruvate synthase subunit PorC n=15 Tax=Bacillales TaxID=1385 RepID=A0A0U5AYX5_9BACL  ali  34  219......GYATQPIGGVVVNPGNSILKDLGSRQGFLPEYHESKCIHCAACDTVCPDYCFVWEEGTDKKIDYQYCKGCLKCVQACPVEALTNMREEIGYAEDN 323
414 1.000e-20UniRef50_UPI00082D89C2 RnfABCDGE type electron transport complex subunit B n=1 Tax=Moraxella oblonga TaxID=200413 RepID=UPI00082D89C2  ali  31  105.................................VRAIINEDECIGCTKCIPACPVDAIIGTAKHMHTIITDLCTGCELCLPPCPVDCITLIKYPHAPDD.. 170
415 1.000e-20UniRef50_A0A2V9ZV29 (4Fe-4S)-binding protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9ZV29_9BACT  ali  32  150.KFEFPKWHEMGEGIAIPRPDRNPTFKKFTTRTMRPVVNFDTCIKCTLCWLHCPDSCFDVTPDNLYDANMQACCGCGVCEAVCPVKCVTMVNEAEFSDN.. 267
416 1.000e-20UniRef50_A0A1V4UJH8 Pyruvate synthase subunit PorD n=13 Tax=cellular organisms TaxID=131567 RepID=A0A1V4UJH8_9EURY  ali  47  12...................PTEGACGKTGTWRVFRPVVDREKCNACGICAMYCPDAAIS----EDLEVDLEFCKGCGICAHECPKKAITMEREEK...... 83
417 1.000e-20UniRef50_P42031 NADH-quinone oxidoreductase subunit I n=752 Tax=root TaxID=1 RepID=NUOI_RHOCA  ali  29  34...............TLNYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIDAETRYDIDMTKCIYCGYCQEACPVDAIVEGPNFEYATE.. 129
418 1.000e-20UniRef50_UPI000B83032F electron transport complex subunit RsxB n=1 Tax=Acidovorax wautersii TaxID=1177982 RepID=UPI000B83032F  ali  30  553..................NPAHGAEGPRAL-----AVIDEAWCIGCTLCLDACPTDAIIGANKRMHTVMAPHCTGCELCIPVCPVDCIQLVND........ 622
419 1.000e-20UniRef50_A0A286TY75 Pyruvate synthase gamma/delta subunits n=2 Tax=Candidatus Scalindua sp. husup-a2 TaxID=1284222 RepID=A0A286TY75_9BACT  ali  34  211....................GNTIMKKTGNWRFFKPVIDHDRCSRCRACFVHCPHSCISLDESGYPHIDYDNCKGCFTCMDECPKKVITKERE........ 283
420 1.000e-20UniRef50_R9T4W7 Pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta n=2 Tax=Methanomassiliicoccales TaxID=1235850 RepID=R9T4W7_METII  ali  53  11...............AIISAGTAKSYETGSWRSHRPVLDKEQCVNCMTCWVFCPDNSIVVENGEVLGFKLTHCKGCGICAQDCPKKAITMVPE........ 88
421 1.000e-20UniRef50_A0A0G0U3F7 Ketoisovalerate oxidoreductase subunit VorD n=3 Tax=Candidatus Moranbacteria TaxID=1752737 RepID=A0A0G0U3F7_9BACT  ali  41  9..............GAIIEHDLKKSPRTGDWRYMKPQVDKKTCLGCGNCFDVCPEAAIDYDSERKADIDYDVCKGCGVCATVCPKKAITMMKNT....... 88
422 1.000e-20UniRef50_A0A0F7GFI7 Pyruvate:ferredoxin oxidoreductase delta subunit n=8 Tax=cellular organisms TaxID=131567 RepID=A0A0F7GFI7_9CHLR  ali  39  9......TWQEIEIGAAVTEPGNAAIYRTGDWRSQKPTYDFSRCLKCGICFVFCPEGCIRQNQRGFYEADFYYCKGCGICSYECPTRVIAMREEEE...... 97
423 1.000e-20UniRef50_A0A0Q9ZQM0 Iron-sulfur protein n=8 Tax=Psychrobacter TaxID=497 RepID=A0A0Q9ZQM0_9GAMM  ali  35  118.................................VRAVIREDDCIGCTKCIPACPVDAIVGTGKHMHTIFTDLCTGCELCIAPCPVDCIDLVTERELSSSE. 185
424 1.000e-20UniRef50_A0A1F5DLP2 Pyruvate ferredoxin oxidoreductase n=1 Tax=Candidatus Bathyarchaeota archaeon RBG_13_52_12 TaxID=1797379 RepID=A0A1F5DLP2_9ARCH :  ali  40  1MSERKRGWKTLPKGAVPY--KSSKDYQTGDWGVAKPIIDRTRCSKCTLCHFFCPEGAITVRVDGYTEVNYDYCKGCGVCANECPVKCIKME.......... 89
425 2.000e-20UniRef50_A0A1F5TGT8 Pyruvate synthase n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1F5TGT8_9BACT  ali  41  8..................NPGTTKENKTGNWRTDVPVIDRDRCIACGACARACPEGCVFVVGDKAFEKDLDYCKGCGICAEECPVKCIKMILE........ 88
426 2.000e-20UniRef50_X1FXY2 Uncharacterized protein n=4 Tax=marine sediment metagenome TaxID=412755 RepID=X1FXY2_9ZZZZ  ali  25  154.......HPDAGFAGSLKNVAMGCETKLAMHSSAKPSYNEEKCTQCLRCVKICPGGAFYEKDSQIHY-QAEKCIGCGECIAVCPSGAITVPW......... 241
427 2.000e-20UniRef50_A0A1W0D450 Electron transport complex subunit RsxB n=7 Tax=Neisseriales TaxID=206351 RepID=A0A1W0D450_9NEIS  ali  30  79...................................AVIREDSCIGCTLCIQACPVDAIVGAAKQMHTVIADECTGCELCLAPCPVDCIDLVPVADPADGE. 143
428 2.000e-20UniRef50_A0A2V4VWR8 Electron transport complex protein RnfB n=2 Tax=Psychrobacter fozii TaxID=198480 RepID=A0A2V4VWR8_9GAMM  ali  33  144.................................VRAVIREDDCIGCTKCIPACPVDAIVGTGKHMHTIFTDLCTGCELCIAPCPVDCIDLVTVERDISE.. 209
429 2.000e-20UniRef50_A0A1W1V7F9 Pyruvate ferredoxin oxidoreductase, delta subunit n=3 Tax=Bacteria TaxID=2 RepID=A0A1W1V7F9_9THEO  ali  46  17....FPAWYEIPLGGTLVSEGST-DYHTGSWRTKRPIWNAEECSHCMICWIYCPETAIKVEGGKVTGIDTTLCKGCGICANECPENAMTMAEGGEY..... 108
430 2.000e-20UniRef50_A0A1F4FC12 Uncharacterized protein n=12 Tax=Bacteria TaxID=2 RepID=A0A1F4FC12_9PROT  ali  35  218.....WGYETQPIGAIIPEPGNTVWNDLSTARTGLPVFNRERCIHCGLCDLVCPDLCLVWEDGEKTGVDYRYCKGCLRCVESCPASALTKKAET....... 315
431 2.000e-20UniRef50_E1YZ48 4Fe-4S binding domain protein n=5 Tax=root TaxID=1 RepID=E1YZ48_9BACT  ali  22  155....FKGHEQAGFGGALKNLGMGCAGKLELHCASQPRIDTEACKGCNICVKHCAHDAIHLNNNRKAEIDYERCVG.......................... 228
432 2.000e-20UniRef50_A0A2K8KWR2 Pyruvate ferredoxin oxidoreductase gamma subunit n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2K8KWR2_9PROT  ali  39  205.....PSWVDMPFEATIHAGATSVLVKTGLWRTMRPIIDPEQCKRCWICSSFCPDGIINVSEEGEPQIDYDHCKGCLVCLSQCPSHAIT............ 295
433 2.000e-20UniRef50_A0A1W1W0Y8 Pyruvate ferredoxin oxidoreductase gamma subunit n=1 Tax=Thermanaeromonas toyohensis ToBE TaxID=698762 RepID=A0A1W1W0Y8_9THEO  ali  43  236..........................RTGSWRVQRPVLDPGKCNNCLICWLFCPEGSIQRGEGCV-SIDLAFCKGCGICVRECPHQALRMVDEALLAKGEG 309
434 2.000e-20UniRef50_A0A235BVA3 Uncharacterized protein n=1 Tax=candidate division WOR-3 bacterium JGI_Cruoil_03_51_56 TaxID=1973747 RepID=A0A235BVA3_9BACT  ali  29  154....FKGHFVAGFGGVIKNLAMGLAGKLEMHSYSKPFVDPEKCVSCGTCVEYCPYNAINFV-QYVAKIGRGC-TGCGGCLAVCPQGAIQIDWN........ 243
435 2.000e-20UniRef50_H2C461 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family n=3 Tax=Sulfolobaceae TaxID=118883 RepID=H2C461_9  ali  41  1.......MINLPPGVPLARPSLGSSGQTGTWRVLRPVIHYNKCTKCRLCFFYCVENTIDLELNMFPKIDYQYCKGCGVCAQVCPTAAIEMMRE........ 86
436 2.000e-20UniRef50_A0A2H6K657 Pyruvate synthase subunit PorC n=1 Tax=bacterium BMS3Abin01 TaxID=2005709 RepID=A0A2H6K657_9BACT  ali  35  221......GYENAPMGGTIINPGNTVLKDLSPTRMGRPIYDRSLCINCGKCEYTCPDFCYTFAGGIDHKIDYRYCKGCLRCVEACPTEALTTDDEEEYVAEHG 326
437 2.000e-20UniRef50_H5SNL8 Pyruvate ferredoxin oxidoreductase, delta subunit n=2 Tax=Candidatus Bipolaricaulota TaxID=67810 RepID=H5SNL8_9BACT  ali  43  1....MKRYQELPIGGVIPGGATPQLVQTGGWRGKKPLFNEKLCVNCLLCWVHCPEATIVVERAQMRGISYDHCKGCGICSQACPTGAIVMVAET....... 91
438 2.000e-20UniRef50_B1H074 Uncharacterized protein n=7 Tax=Elusimicrobia TaxID=641853 RepID=B1H074_UNCTG  ali  19  148....FKGHEITGFGGALKNIGMGCAGKYAMHHLSKPTVSQKLCSGCRTCVKYCCQKALSLVSNKIVM-DKEKCAGCGQCIVNCVFKVFKLKWNEDPPA... 243
439 2.000e-20UniRef50_A0A0S8DY34 Uncharacterized protein (Fragment) n=1 Tax=Phycisphaerae bacterium SG8_4 TaxID=1703409 RepID=A0A0S8DY34_9BACT  ali  23  155....FTGHVASGLGATLKTIGMGCASKHGQHAALTLEIGDD-CTSCGLCREYCPADAITLDEVRAH-IDQDKCIGCGECMAMCRSGAVRCNWGQE...... 246
440 2.000e-20UniRef50_A0A0B5CKU3 Ion-translocating oxidoreductase complex subunit B n=33 Tax=Neisseriaceae TaxID=481 RepID=A0A0B5CKU3_NEIEG  ali  34  74...................................AWIDESACIGCTACIRACPVDAIMGASKLMHTVIAEECTGCGLCVAPCPVDCIHMLPN........ 131
441 2.000e-20UniRef50_UPI0009A8F70B hypothetical protein n=1 Tax=Phoenicibacter massiliensis TaxID=1944646 RepID=UPI0009A8F70B  ali  41  268.........................TKNAGWRTFRPKIDQEKCTGCLKCYMDCPDGCIKMQESRTVGIDLDFCKGCAMCAEACKFDAIEMIAE........ 336
442 2.000e-20UniRef50_A0A1V5NS61 Pyuvate ferredoxin oxidoreductase subunit delta n=1 Tax=bacterium ADurb.Bin374 TaxID=1866937 RepID=A0A1V5NS61_9BACT  ali  25  160....FKGHEVTGFGGAIKNMGMGCAAKLVMHTAIRPSVLTDVCVKCRRCFSWCSAGAIQPTPGGPVVIDQQKCRGCGECLMACLVGAIRINWSSD...... 254
443 3.000e-20UniRef50_A0A1G1DG04 Uncharacterized protein (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A1G1DG04_9BACT  ali  38  164................VNTAGNTPLRKTGNWRTFKPIFNYELCNKCMICVARCPDGCIAVNERGFPSIDYDNCKGCLICIDECPVHA.............. 235
444 3.000e-20UniRef50_A0A2C8F826 4Fe-4S ferredoxin iron-sulfur binding domain protein n=5 Tax=Desulfovibrionales TaxID=213115 RepID=A0A2C8F826_9DELT  ali  24  154....FKGHELAGYGGALKNLGMGCASKKGQHFSTGPVVKPENCQGCEACISVCKTKALYIDEEGTIALNPERCVGCGGCFVACRFKALEVNWK........ 246
445 3.000e-20UniRef50_A0A1V5R8C4 NADH-quinone oxidoreductase subunit I n=3 Tax=Acidobacteria TaxID=57723 RepID=A0A1V5R8C4_9BACT  ali  26  25MAITF-GHFLRQITTTIQYPKEMPEGYRGLHELKRFEDGAIKCVACFMCAEACPARCITIEAEKVFKIDMLRCIYCGYCEEACPKDAIWLRKDYELAAYD. 148
446 3.000e-20UniRef50_A0A1J5DT07 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1J5DT07_9DELT  ali  32  200.....WGYLNAPLGGAIINPANTVEKNLGSRTGIIPVFEGSKCVHCALCDLVCSDNCIKVDDGGLAGIDYQYCKGCMACVDSCPTGAMREERETPGFADE. 304
447 3.000e-20UniRef50_B3R461 Ion-translocating oxidoreductase complex subunit B n=406 Tax=Bacteria TaxID=2 RepID=B3R461_CUPTR  ali  35  80..................................VARIDESLCIGCTLCIQACPVDAIAGAAKQMHTVIPDLCTGCDLCVPPCPVDCIDMVPVT....... 139
448 3.000e-20UniRef50_A0A0G0CT93 Pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit n=4 Tax=cellular organisms TaxID=131567 RepID=A0A0G0CT93_9BACT  ali  47  5..............GAIIKHDQKKSPKTGAWRYMHPEVDKKKCIGCGTCVGFCPDATITIENKK-AQIDYEYCKGCGVCAEVCPMKAIIMKKK........ 82
449 3.000e-20UniRef50_A0A240ULL5 Electron transporter RnfB n=1 Tax=Kushneria marisflavi TaxID=157779 RepID=A0A240ULL5_9GAMM  ali  32  77...................................AVIREEECIGCTKCIKACPVDAILGAAKQMHTVIEAECTGCELCVAPCPVDCIDII.......... 132
450 4.000e-20UniRef50_A0A2M6ZXJ9 Uncharacterized protein n=1 Tax=Chloroflexi bacterium CG07_land_8_20_14_0_80_45_17 TaxID=1973941 RepID=A0A2M6ZXJ9_9CHLR  ali  28  65....VKGHIQAGFGGAIKNLGMGKGTKRIIHRMSIPRFLAERCDLCGSCAEVCPCHAITVDLDWRYHSNA--CSGCGICVSACPSGALSHE.......... 152
451 4.000e-20UniRef50_A0A2R8CM97 Ion-translocating oxidoreductase complex subunit B n=12 Tax=Halomonadaceae TaxID=28256 RepID=A0A2R8CM97_9GAMM  ali  31  77...................................AVIREAECIGCTKCIKACPVDAILGAAKQMHTVIEAECTGCELCVAPCPVDCIDIVP......... 133
452 4.000e-20UniRef50_A0A254WRM8 NAD(P)H-quinone oxidoreductase subunit I n=2 Tax=Bacteria TaxID=2 RepID=A0A254WRM8_9CYAN  ali  28  50MRITLKYCFARTI--TLQYPDMAPARYRGFH-----WFEAEKCIACDQCAKACPVDCIYIEKGERYAIDYSKCMFCALCCDPCPTDCIHMGDNHDLSAY.. 161
453 4.000e-20UniRef50_A4G3A6 Ion-translocating oxidoreductase complex subunit B n=51 Tax=Betaproteobacteria TaxID=28216 RepID=A4G3A6_HERAR  ali  30  79..................NPVNGVERPRP-----VAVIDESLCIGCTLCIQACPVDAIVGAAKQMHTIVTDLCTGCDLCVAPCPVDCIAMVE......... 147
454 4.000e-20UniRef50_A0A136JW40 NADH-quinone oxidoreductase subunit I n=35 Tax=Bacteria TaxID=2 RepID=A0A136JW40_9BACT  ali  28  31MKATLKHLLNKPI--TLQYPHEKRDNYRGMLSLLRYDDGTEKCVGCDLCEAACPSRVIRVVSAEVYYMDMTRCLFCGLCVDACPVDALAMTREFEWSVYD. 143
455 4.000e-20UniRef50_UPI0003C1B314 NADH-ubiquinone oxidoreductase chain 6-like n=1 Tax=Pantholops hodgsonii TaxID=59538 RepID=UPI0003C1B314  ali  25  20.GMALTGRYFFARKITIQYPEERTPRFRGLHALRRYPNGEERCIACKLCEAVCPAMAITIESEQRYDIDLTKCIFCGLCEESCPVDSIVETRVFDY..... 126
456 4.000e-20UniRef50_Q1QVN6 Electron transport complex, RnfABCDGE type, B subunit n=22 Tax=Gammaproteobacteria TaxID=1236 RepID=Q1QVN6_CHRSD  ali  28  73...............................SPKVAFIREAECIGCTKCIQACPVDAILGAAKQMHTVIAGECTGCELCVAPCPVDCIDILPHPEWVAAE. 141
457 4.000e-20UniRef50_A0A1I5L7W5 Pyruvate ferredoxin oxidoreductase delta subunit n=1 Tax=Hydrogenimonas thermophila TaxID=223786 RepID=A0A1I5L7W5_9PROT  ali  44  47............................GDWRVLKPVYNRDLCIDCQFCWIYCPDISIISRDKKMIGVDYDHCKGCGICVEVCPTNPKSLLMFEERIDND. 118
458 4.000e-20UniRef50_A0A1F8SL67 NADH-quinone oxidoreductase subunit I n=15 Tax=root TaxID=1 RepID=A0A1F8SL67_9CHLR  ali  22  14MALTFKHLFRAPI--TVQYPEEKLVVSR-RIRGNELVWFLDRCTGCATCAKACPQGNIEIVTHDKFEIDTGRCMFCGLCVEACPYDALAMGRSYERA.... 116
459 4.000e-20UniRef50_A0A0L1KRU9 Endonuclease III n=1 Tax=Candidatus Burkholderia brachyanthoides TaxID=1090379 RepID=A0A0L1KRU9_9BURK  ali  30  83.......YNQCPPGGALDKPVIPLDTTHGEERARVAVIDENVCIGCTLCIQACPVHAIVGAVKQMHTIIPELCTGCDLCVPPCPVDCIAMIPVTGTAT... 183
460 5.000e-20UniRef50_A0A2H9QTV1 Uncharacterized protein n=2 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A2H9QTV1_9EURY  ali  34  138....VKGHACCGFGGAIKNLGMGKKTKEKIHTYSRPKLNPEKCIGCGQCESICPNGAVKLENG-LPILDYSKCWGCGQCIVKCESQALK............ 224
461 5.000e-20UniRef50_N8QHN4 Uncharacterized protein n=33 Tax=root TaxID=1 RepID=N8QHN4_9GAMM  ali  33  78............................GRPQRMKAIIREDECIGCTKCISACPVDAIIGSGKLMHSILTDLCTGCELCIPPCPVDCIDLIEDNHVIPNE. 149
462 5.000e-20UniRef50_B8EIM5 NADH-quinone oxidoreductase subunit I n=299 Tax=root TaxID=1 RepID=NUOI_METSB  ali  32  39.................KNPQS--PRYRGEHALRRYPNGEERCIACKLCEAICPAQAITIEAGTRYDIDMVKCIYCGFCQEACPVDAIVEGPNAEFSVE.. 128
463 5.000e-20UniRef50_E1VPT2 Ion-translocating oxidoreductase complex subunit B n=2 Tax=gamma proteobacterium HdN1 TaxID=83406 RepID=E1VPT2_9GAMM  ali  26  64...............ALQRPYLPVAPDHDTSTEPRAVIREDECIGCTKCIQACPVDAILGAAQLMHTVIGDQCTGCNLCVEPCPVDCIDMVAMPELPMPEA 151
464 5.000e-20UniRef50_A0A1V4WSX7 Pyruvate synthase subunit PorD n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1V4WSX7_9DELT  ali  48  2........................EYKTGDWRSSKPVWNWEKCTKCGLCWLFCPDASIRQRDDGFYEADLDYCKGCGICARECKPGAISMVEEE....... 71
465 5.000e-20UniRef50_C1LL32 NADH dehydrogenase (Ubiquinone) Fe-S protein 8 n=13 Tax=Bilateria TaxID=33213 RepID=C1LL32_SCHJA  ali  28  7..............ATLNYPFEKSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEYST... 102
466 5.000e-20UniRef50_A0A258UN20 Ion-translocating oxidoreductase complex subunit B n=1 Tax=Methylophilales bacterium 16-45-7 TaxID=1970536 RepID=A0A258UN20_9PROT  ali  29  252..................................VAFIDENICIGCTLCIQACPVDAILGAAKHMHTIISSECTGCELCVAPCPVDCISMQVIAETPDN.. 316
467 5.000e-20UniRef50_A0A2H6FZZ2 Electron transport complex protein rnfB n=1 Tax=bacterium BMS3Abin11 TaxID=2005719 RepID=A0A2H6FZZ2_9BACT  ali  33  1.............................MHVAALAVIIEEYCIGCTKCIQACPVDAIVGAAKQMHTVIEEECTGCELCLPPCPVDCIDMRP......... 63
468 5.000e-20UniRef50_A0A1F5V2K0 NADH-quinone oxidoreductase subunit I n=5 Tax=Bacteria TaxID=2 RepID=A0A1F5V2K0_FRAXR  ali  27  15MSVTFRYLFEKPV--TIEYPEIKRKPFRGRHYLRLWEDGMERCIGCHLCEIVCPAQAIYVKDDKKFQINMLRCIFVGDCEEVCPVDCIVLSDEYELSGY.. 129
469 6.000e-20UniRef50_C8PF39 NADH-quinone oxidoreductase subunit I n=1 Tax=Campylobacter gracilis RM3268 TaxID=553220 RepID=C8PF39_9PROT  ali  31  36LWVVLKNMFKRGGSHTLRYPMEKPPRYRGVHKLMRLESGSERCIGCGLCEKICVANCIAMEDGRKYSINLGRCVYCGLCADVCPEIAIVHGCEYELASEQ. 148
470 6.000e-20UniRef50_A0A2N2QP25 Ion-translocating oxidoreductase complex subunit B n=122 Tax=Bacteria TaxID=2 RepID=A0A2N2QP25_9PROT  ali  29  65..................NPSNGIEGP-----LTLAVIDEDWCIGCTLCIKVCPTDAIVGSNKRMHTVIEPFCTGCELCLPVCPVDCISLE.......... 132
471 6.000e-20UniRef50_Q4K756 Ion-translocating oxidoreductase complex subunit B n=371 Tax=Proteobacteria TaxID=1224 RepID=Q4K756_PSEF5  ali  26  49..........AGLAQLLQLPVVELDHSRGEAPAQIAHIREAECIGCTKCIQACPVDAIVGAAKLMHSVLIDECTGCDLCVAPCPVDCIDMLP......... 130
472 6.000e-20UniRef50_A0A1G1H8B3 Uncharacterized protein n=1 Tax=Nitrospirae bacterium RBG_19FT_COMBO_58_9 TaxID=1801711 RepID=A0A1G1H8B3_9BACT  ali  34  12................ISAAGNSILRETSGWRTFRPVLVPGKCNGCWLCFAYCPDGVISMTKDDRPVIDYAHCKGCQICVHECPTEALVAEREKEGA.... 92
473 6.000e-20UniRef50_A0A210PVB7 NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210PVB7_  ali  32  79..............ATINYPGPLSPRFRGEHALRRYPSGEERCIACKLCEAVCPAQAITIEAETRYDIDMTKCIYCGFCQEACPVDAIV............ 165
474 6.000e-20UniRef50_UPI0003802CBE RnfABCDGE type electron transport complex subunit B n=2 Tax=Vitreoscilla TaxID=59 RepID=UPI0003802CBE  ali  32  76...................................AVIDENICIGCTACIKACPVDAIVGATKWMHDVIANECTGCGLCVPPCPVDCIDLV.......... 131
475 6.000e-20UniRef50_B3E9W1 NADH-quinone oxidoreductase subunit I n=11 Tax=Desulfuromonadales TaxID=69541 RepID=B3E9W1_GEOLS  ali  26  12MKITLGHVFKKPV--TLMYPDERPERFRGLHAL-KVSHNKAKCVACYLCPTVCPAKCITVEAGEKYEIDMLRCIFCGYCVEACPVDALKMTGEFELANY.. 119
476 7.000e-20UniRef50_A0A2V8SAD1 NADH-quinone oxidoreductase subunit I n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8SAD1_9BACT  ali  30  59LWVTLKNQFRPHI--TVEYPKETVERFRGVPRLYHPDNGEELCIACHLCETVCPDDCIHIVSEKKFEINYERCCFCGLCVDPCPTKAIYMSHDYEMADYK. 173
477 7.000e-20UniRef50_A0A1W9MP17 Pyruvate synthase n=2 Tax=Archaea TaxID=2157 RepID=A0A1W9MP17_9EURY  ali  39  1........MKYNLGATIEDAGNSVLNKTSSWRVSKPVV--EKCTKCGLCATFCPEGIIQIKD--TAIIDYDYCKGCGICAEECPVKGIRMILE........ 81
478 7.000e-20UniRef50_F8E5F6 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein n=5 Tax=Bacteria TaxID=2 RepID=F8E5F6_FLESM  ali  32  150....VKGHIQAVLGGAIKNISMGNESHHGDWHEGRMEWDQEKCILCYDCMKVCPAECITF-PNNIYTVDKDKCWRCGRCARVCPEDAIHV........... 247
479 7.000e-20UniRef50_Q6FD68 Ion-translocating oxidoreductase complex subunit B n=439 Tax=cellular organisms TaxID=131567 RepID=Q6FD68_ACIAD  ali  35  64............................GRPQRMKAIIREDECIGCTKCISACPVDAIIGSGKLMHTVLTDLCTGCELCIPPCPVDCIDLVEDRE...... 130
480 7.000e-20UniRef50_A0A1Y4G684 Pyruvate oxidoreductase subunit gamma n=2 Tax=Gordonibacter urolithinfaciens TaxID=1335613 RepID=A0A1Y4G684_9ACTN  ali  43  238..........................KNAGWRNIRPVIDPAACTGCLQCYLYCPDGTVFKVPDPAPGIDYDFCKGCGVCAKACRFGAITMIPESE...... 311
481 7.000e-20UniRef50_A0A259U8F8 NADH-dependent phenylglyoxylate dehydrogenase subunit delta n=20 Tax=root TaxID=1 RepID=A0A259U8F8_9FIRM  ali  46  20...........................TGSWRNFRPVIDQEKCSKCGLCFTFCPVNSISRVDNE-YQISMSYCKGCGICANECPRKAIDMVPE........ 84
482 7.000e-20UniRef50_R6V837 Pyruvate ferredoxin/flavodoxin oxidoreductase delta subunit n=3 Tax=environmental samples TaxID=2231195 RepID=R6V837_9CLOT  ali  44  3........KKYSLGGIILKDGNSVEFKTGNWKNKYPYHDKEKCKNCMMCVPYCPEGCIRHKDGKLLGMDLDFCKGCGICAKVCPFHAIDMKSDID...... 89
483 7.000e-20UniRef50_A0A1F8M764 NADH-quinone oxidoreductase subunit I n=9 Tax=root TaxID=1 RepID=A0A1F8M764_9CHLR  ali  22  14MALTFKHLFRAPI--TVQYPEEKLAVSR-RIRGNELVWFPARCTACATCAKACPQGNIEIISHEKFEIDTGRCMFCGLCVEACPFDALAMGLSYERAQY.. 118
484 8.000e-20UniRef50_A0A1G1MWS7 Uncharacterized protein n=1 Tax=Omnitrophica WOR_2 bacterium GWF2_43_52 TaxID=1801847 RepID=A0A1G1MWS7_9BACT  ali  24  155.....TGHILSIYAGALKNVAMGRSTKQMQHSSLKPKVTAKKCNSCDCCLIACPAQAITHKDGKAF-INEEMCIGCSECLCACKFDAIGVNWHEDV..... 247
485 8.000e-20UniRef50_A0A225LW99 Ion-translocating oxidoreductase complex subunit B n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A225LW99_9BURK  ali  32  61..................RPARPLDPECGEHRPLRAVIDEAHCIGCTLCIQACPVDAIVGAAKLMHTVLADACTGCDLCVPPCPVDCIAMVP......... 135
486 8.000e-20UniRef50_A0A1T0CRZ4 Ion-translocating oxidoreductase complex subunit B n=75 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1T0CRZ4_9GAMM  ali  30  102.............................SHREVRAIIREDDCIGCTKCIPACPVDAIIGTAKHMHSIITELCTGCELCLAPCPVDCIDLVEHPRHIDD.. 173
487 8.000e-20UniRef50_I3TEX9 Membrane-bound hydrogenase, subunit NuoI n=1 Tax=Thermogladius calderae (strain DSM 22663 / VKM B-2946 / 1633) TaxID=1184251 RepID=I3  ali  38  28......................SRAVEREVLRGY-PKVNPEKCIGCSLCARSCPSDAITMVDKKIPFFNYYKCIYCGLCSNVCPVKAIDMVKGTPLDALE. 116
488 8.000e-20UniRef50_A0A2V7V2G7 NADH-quinone oxidoreductase subunit I n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7V2G7_9BACT  ali  27  23MGITLKNMVKTMFGATIQFPEQKRNRYRGIHILTQREDGTPKCVACYMCATACPAECIYIEAGERFEIDLLRCVYCGFCVDACPEEAIFMSRENDLV.... 136
489 1.000e-19UniRef50_A0A1R0MSU3 Ferredoxin n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A1R0MSU3_9NEIS  ali  31  79...................................AVIREDSCIGCTLCIQACPVDAIVGAAKQMHTVIADECTGCELCLAPCPVDCIDLVPVAD...... 138
490 1.000e-19UniRef50_W1NAQ5 Uncharacterized protein n=16 Tax=Halomonadaceae TaxID=28256 RepID=W1NAQ5_9GAMM  ali  29  98...................................ASIREDECIGCTKCIQACPVDAILGAAKQMHTVITEECTGCELCVAPCPVDCIDLDWQTANSDDE. 166
491 1.000e-19UniRef50_Q0W6S7 Pyruvate:ferredoxin oxidoreductase, delta subunit n=6 Tax=cellular organisms TaxID=131567 RepID=Q0W6S7_METAR  ali  45  11..............GLVAMPGTSMQYHTGGWRTYKAVISQEKCIGCKRCADSCPDGAPHDGKKKKFCINYDYCKGCGVCAYECPVDAIEMVVEEK...... 95
492 1.000e-19UniRef50_A0A217EES6 Electron transport complex protein RnfB n=1 Tax=Acinetobacter apis TaxID=1229165 RepID=A0A217EES6_9GAMM  ali  36  83.................................MKAVIREDECIGCTKCISACPVDAIIGSGKLMHSILTDLCTGCELCIPPCPVDCIDLI.......... 140
493 1.000e-19UniRef50_A0A2E0YU02 Ion-translocating oxidoreductase complex subunit B n=20 Tax=Proteobacteria TaxID=1224 RepID=A0A2E0YU02_9GAMM  ali  32  111...............................RPAMAFIREDECIGCTKCIQACPVDAILGAAKQMHTVIASECTGCDLCVEPCPVDCIDMIREEE...... 174
494 1.000e-19UniRef50_A0A1F9KMJ2 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=A0A1F9KMJ2_9DELT  ali  31  232....LPKWFEMQEGAVVPAVKRGPGFKRGTTKTQRPAVRFDLCTKCTLCWAECPDECFDPTTDGFYDIEYQYCVGCGKCAEVCPVKCIVMVDELQFEDDHS 340
495 1.000e-19UniRef50_A1AVS0 NADH-quinone oxidoreductase subunit I n=19 Tax=root TaxID=1 RepID=NUOI_RUTMC  ali  25  21MKITAKELVNKKI--TVQFPEERSPRFRGLHALRRYPNGEERCIACKLCEAVCPANAITIESEIVYDIDLFKCIFCGFCEEACPVDAIVETQIFDYAFK.. 129
496 1.000e-19UniRef50_A0A0S3QRQ3 NADH-quinone oxidoreductase subunit I n=2 Tax=Bacteria TaxID=2 RepID=A0A0S3QRQ3_THET7  ali  26  9LKITFTHLFRPAF--TVKYPYEKIERWRGRHILRVDEEGREKCCYCGLCEAVCPANAIRIYGEEIYEIDYRRCIFCGYCEEACPRGAIELTPDYELAEPE. 122
497 1.000e-19UniRef50_W4M305 Uncharacterized protein n=3 Tax=Candidatus Entotheonella TaxID=93171 RepID=W4M305_9BACT  ali  41  2....................GNSPERRTGSWRQFRPVLQPEKCTRCWLCFVWCPEAAITLDHDEYPVVDYDVSKGCLLCAHECPTHAFSVEQE........ 74
498 1.000e-19UniRef50_K0N2N1 PadF1: phenylglyoxylate:acceptor oxidoreductase, subunit F n=24 Tax=root TaxID=1 RepID=K0N2N1_DESTT  ali  47  25...........................TGDWRSKRPVVDKDKCIFCGFCAIYCPIQVMEMVENSYFSPDLAFCKGCGICAKECPKDAISMEPEGDF..... 93
499 1.000e-19UniRef50_A0A1G1E5L2 NADH-quinone oxidoreductase subunit I n=1 Tax=Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22 TaxID=1801687 RepID=A0A1G1E5L2_9BAC  ali  26  19LKTTLKHLFRKPI--TIQYPKERWQRFRGLHALKTEKNEKDLCIACGLCARSCPSDVIEIVTSGKYKIDLSRCIYCGFCVEVCPQNALEMTDFYELAGY.. 129
500 1.000e-19UniRef50_A0A1F7PDU4 Uncharacterized protein n=25 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1F7PDU4_9BACT  ali  29  221.SFQMPKWWEMREGVTIPAIPVGKPKEAGKTRTMRPVIDFDTCVKCTLCWIQCPDSCFDVMPDGTYDANMEACCGCGVCEAVCPVNCITMVNEALFDDN.. 333
501 1.000e-19UniRef50_T0YNU8 Pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T0YNU8_9Z  ali  35  26.......................LDFKRGTSKTQRPVVRFDICTKCTLCWYDCPDEVFDPTTDGLYDVNYDYCTGCGRCAEVCPVDCIVMVDELKFENQDS 104
502 1.000e-19UniRef50_A0A1B6BCX3 Pyruvate:ferredoxin oxidoreductase delta subunit n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1B6BCX3_9FIRM  ali  46  36..............................WRVFMPVIHLDQCVSCYRCYLVCPEGAIHQNEDQKFEIDYDYCKGCGICANECKIKAISMVKEEK...... 100
503 1.000e-19UniRef50_A0A2V8HU50 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8HU50_9BACT  ali  36  95........................AFKRGTTKTHRPVVRFDLCIKCTLCWLDCPDECFDPTDDGLYDVNYEVCVGCHKCAAVCPVECIVMVDELKFADN.. 170
504 1.000e-19UniRef50_A0A1G2YUD8 Uncharacterized protein n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G2YUD8_9BACT  ali  21  160....FTGHLGACFGATLKTLGMGCASKRGQHSGITLSIG-DGCVLCGECFKHCPADAITLGSIKAH-IDREKCIGCAECLAVCKFGAVECNWGAE...... 251
505 1.000e-19UniRef50_G0R605 NADH-ubiquinone oxidoreductase, putative n=1 Tax=Ichthyophthirius multifiliis (strain G5) TaxID=857967 RepID=G0R605_ICHMG  ali  31  108...............TINYPGPLSPLFRGEHALRRYPTGEERCIACKLCQSACPARAITIETEPRYDIDMTKCIYCGFCQEACPVDAIV............ 193
506 1.000e-19UniRef50_A0A172YF72 Ion-translocating oxidoreductase complex subunit B n=13 Tax=Halomonadaceae TaxID=28256 RepID=A0A172YF72_9GAMM  ali  30  43.......HTKCPPGGTLIALAQLLDRPKGALAPQLAVIREDECIGCTKCIQACPVDAIVGAAKLMHGVLESECTGCELCVAPCPVDCIDMRP......... 134
507 1.000e-19UniRef50_F0YTF4 Pyruvate synthase, subunit PorD n=2 Tax=Clostridiales TaxID=186802 RepID=F0YTF4_9CLOT  ali  41  10....FTPWQDTTRGGNIYGSGTSKYYRTGGWRVDTPQFEAARCVNCMRCFLLCPDGSIALEDGQVTGIHYNYCKGCGICSEVCSAGAIHMMSRQEESA... 103
508 1.000e-19UniRef50_A0A1J5NFN7 NADH-dependent phenylglyoxylate dehydrogenase subunit gamma n=3 Tax=Bacteria TaxID=2 RepID=A0A1J5NFN7_9DELT  ali  46  227...........................TGEWRFKRPILDKDGCKQCGICAMYCPIGCISERPSGYFVPDFTYCKGCGVCANECPAHAIVMHFEEEL..... 295
509 1.000e-19UniRef50_A0A1V6KC97 Pyruvate synthase subunit PorD n=23 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V6KC97_9DELT  ali  44  13.................SEHGAGDGGRTGSWRVERPVLDRNLCIACFICWLFCPDVVISRT--IPPTINLEYCKGCGICAEECPTKAITMVDEAKFAEED. 100
510 1.000e-19UniRef50_A0A149VVW2 NADPH-Fe(3+) oxidoreductase subunit beta n=4 Tax=root TaxID=1 RepID=A0A149VVW2_9PROT  ali  45  275................................EARRCLSCGNCFECDNCYGVCPDNAIKLGHGKRFQINYDYCKGCGICVAECPCGAIKMVPE........ 336
511 1.000e-19UniRef50_A0A1J5Q9M4 NADPH-Fe(3+) oxidoreductase subunit beta n=6 Tax=root TaxID=1 RepID=A0A1J5Q9M4_9ZZZZ  ali  45  316................................EARRCLSCGNCFECDNCYGVCPDNAIKLGPGNRFRIDYDYCKGCGICATECPCGAIQMVPE........ 377
512 2.000e-19UniRef50_Q67P14 NADH-quinone oxidoreductase subunit I 1 n=6 Tax=Firmicutes TaxID=1239 RepID=NUOI1_SYMTH  ali  25  11MATTLKVLFRKPV--TVDYPYVKRPRFRGRHELRTYENGLEMCVGCELCQVACPAAAITVQAGYKYQVDLLRCIFCGMCEEACPTDCLHLTQEFELAD... 124
513 2.000e-19UniRef50_A0A151F4W2 Uncharacterized protein n=2 Tax=unclassified Theionarchaea TaxID=1980646 RepID=A0A151F4W2_9EURY  ali  57  24.........................TKTGNWRNAKPVFHKEKCIQCGICWKVCPNACIIL--GEYPEWNMDYCKGCGVCAEECPKDAIEMEDE........ 89
514 2.000e-19UniRef50_A0A239R2Q7 Pyruvate ferredoxin oxidoreductase delta subunit n=1 Tax=Lachnospiraceae bacterium TaxID=1898203 RepID=A0A239R2Q7_9FIRM  ali  36  18.......YQDITPGNAVYGGGGATAFNTGEWRTQTPVVDWDKCVQCLLCAPMCPDSSIPVKDGKRLDFDLDHCKGCGICAGCCSFGAITMKE......... 102
515 2.000e-19UniRef50_A0A1H9IV51 Pyruvate ferredoxin oxidoreductase delta subunit n=2 Tax=unclassified Lachnospiraceae TaxID=186928 RepID=A0A1H9IV51_9FIRM  ali  41  18.......YQDITPGNVVYGGGGAASFLTGEWRTMTPVIDWDKCKQCLLCAPMCPDSSIPVEDGKRLDFDYDHCKGCGICAGCCSFGAITMKE......... 102
516 2.000e-19UniRef50_A0A1E3X4K4 Pyruvate synthase gamma/delta subunit n=1 Tax=Candidatus Scalindua rubra TaxID=1872076 RepID=A0A1E3X4K4_9BACT  ali  36  147....................GNTRLKKTGNWRLFKPIIDYEECSRCLACFVHCPHSCISVDESGYPMIDYENCKGCFTCLDECPKKIISRKRE........ 219
517 2.000e-19UniRef50_A0A0B7J0I9 Ion-translocating oxidoreductase complex subunit B n=19 Tax=root TaxID=1 RepID=A0A0B7J0I9_9PROT  ali  30  86.....................MGVEYKPAEHGLPKPKIDEATCIGCTLCIQACPVDAILGAAKHMHTIIASECTGCELCLAPCPVDCITMEPIAESPDN.. 169
518 2.000e-19UniRef50_E3PWR5 Pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit (Modular protein) n=3 Tax=Clostridiales TaxID=186802 RepID=E3PWR5_ACESD  ali  41  19...........................TGSWRTFRPIMNKDNCVECGICMSFCPVGSITGNKQKIYAIDYKFCKGCGICAYECPSKAIDMVKEGD...... 86
519 2.000e-19UniRef50_A0A151BG09 Pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta n=1 Tax=Candidatus Bathyarchaeota archaeon B25 TaxID=1779369 RepID=A0  ali  38  8LKLKYESYRELPITPLIK-AGISKLVETPWHLHGKPQVDQAKCIGCRLCWLYCPEGVITVRNGEV-EVDYARCKGCGICANECPVEAITMV.......... 96
520 2.000e-19UniRef50_A0A1F6D3Q6 NADH-quinone oxidoreductase subunit I n=3 Tax=Bacteria TaxID=2 RepID=A0A1F6D3Q6_HANXR  ali  21  24MALTFRHMLGKKF--TMQYPEKKPPGYRGLHKLTKDEQGRVKCVACYMCATACPAECITIEAAARFDIDMLRCIFCGYCVEACPEEAIVMTEVHELAA... 133
521 2.000e-19UniRef50_X1RS02 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1RS02_9ZZZZ  ali  28  11....VKGHMQTGFGGAIKNLGMGKSTKRMLHRMSMPRHLAEKCDLCGSCAEICPCNAITVDSDWKY--DRGACLGCGECVFTCPNEALSYE.......... 98
522 2.000e-19UniRef50_UPI0009EA5B00 4Fe-4S dicluster domain-containing protein n=1 Tax=Clostridiales bacterium mt11 TaxID=1686289 RepID=UPI0009EA5B00  ali  51  28........................DTKTGTWRLTRPIIS-EKCIACGICSKYCPGQYIEIKD--IATIDYDYCKGCGICEVLCPVHAISMIEEAE...... 95
523 2.000e-19UniRef50_A0A2R5L1H7 NADH dehydrogenase (Ubiquinone) iron-sulfur protein 8-A, mitochondrial (Fragment) n=2 Tax=Hirondellea gigas TaxID=1518452 RepID=A  ali  30  150........KAMEIKHTINYPYEKAPKFRGEHALRRYPSGEERCIACKLCESVCPAQAITIEAETRYDIDMTKCIYCGYCEQACPVASIVEGPNFEFSTE.. 252
524 2.000e-19UniRef50_A0A099V3F9 NADH-quinone oxidoreductase subunit I n=17 Tax=Epsilonproteobacteria TaxID=29547 RepID=A0A099V3F9_9HELI  ali  28  50LGLTIKEFFSKPV--TINYPFETQPRYRAVHNLQRMESGSERCIGCGLCEKICTSNCIRIDDGRKYTINLGRCIYCGLCAEVCPELAIVMGNRFENASEQ. 160
525 2.000e-19UniRef50_A0A255ZL84 NADH-quinone oxidoreductase subunit I n=2 Tax=FCB group TaxID=1783270 RepID=A0A255ZL84_9FLAO  ali  30  37..ITIRHLFKRKV--TIKYPEQVRERYRGQHQLKRDELGRENCTACGLCALSCPAEAITMTAAERYEINMLRCIFCGLCEEACPKDAIYLTE......... 143
526 2.000e-19UniRef50_A0A0K2SQ31 NADH-quinone oxidoreductase subunit I n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0K2SQ31_9FIRM  ali  25  12...TLKNFFA--PKVTIPYPEPRAQGFRGLHELRRYANGLEMCVGCELCQVACPANAITVQAAENYRIDLLRCIFCGLCEEACPTGALHLTQEFELS.... 121
527 2.000e-19UniRef50_E8UC86 Ion-translocating oxidoreductase complex subunit B n=3 Tax=Taylorella equigenitalis TaxID=29575 RepID=E8UC86_TAYEM  ali  32  79................................LHKAYILEEHCIGCTKCIQVCPVDSIIGANKWMHTVIPDFCTGCELCVLACPVDCIQMNPSLALWTED. 146
528 2.000e-19UniRef50_C7MNQ0 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family/2-oxoacid:acceptor oxidoreductase, delta subunit,  ali  41  253..............................WRERRPVVDAQRCTGCLQCYLYCPDGAIKRTPSAAVVVDTEFCKGCAVCEQVCPFDAISMVSE........ 317
529 2.000e-19UniRef50_E8RDZ3 NADH-quinone oxidoreductase subunit I n=10 Tax=Deltaproteobacteria TaxID=28221 RepID=E8RDZ3_DESPD  ali  33  24MTLTLKRLFSKPI--TRQYPEEKRPGFRGQHALVRPETKDCKCIGCMRCAMVCPSRCIRIEPGSRRIIDCYRCVYCGYCEEVCPVNAIVLTEVFEYGSYE. 136
530 2.000e-19UniRef50_A0A0S7XD38 NADH-quinone oxidoreductase subunit I n=1 Tax=Latescibacteria bacterium DG_63 TaxID=1703781 RepID=A0A0S7XD38_9BACT  ali  24  11LWLTISHVFKRPV--TVFYPERKRPRFRGLLALSLDEEGFEKCVGCGLCARICPSCAIVVDAAKNYVIDIGRCIFCGYCVDACPTEALSMTPRYEMADYE. 126
531 2.000e-19UniRef50_A0A0F7IFT3 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family n=12 Tax=Archaea TaxID=2157 RepID=A0A0F7IFT3_  ali  41  8.................SNPTKGSAGKTGEWRVFRPVVDQSLCVLCMSCYDYCPENVVEVGDE--VVIDYDYCKGCGICSRVCVTGAIRMERE........ 81
532 2.000e-19UniRef50_K2EN56 Pyruvate synthase delta chain n=29 Tax=root TaxID=1 RepID=K2EN56_9ZZZZ  ali  38  4.............GATIK-HELSKAAKTGDWRYVKPEVDKEKCIGCSTCVPFCPEASIVMKSHKKADIDYEFCKGCGVCEQVCPVKAILMKKN........ 87
533 2.000e-19UniRef50_A0A2D5W542 NADH-quinone oxidoreductase subunit I n=8 Tax=cellular organisms TaxID=131567 RepID=A0A2D5W542_9BACT  ali  28  34MRITGKYFLKKPI--TVQYPDERLPRYRGIH-----YLEQEKCINCLACARACPVDCIEMDAVRKFTIDYQKCMFCELCVYPCPKDCIHMGNEFAFVTTD. 137
534 2.000e-19UniRef50_A6SVW0 Ion-translocating oxidoreductase complex subunit B n=102 Tax=Proteobacteria TaxID=1224 RepID=A6SVW0_JANMA  ali  30  73..................NPVNGHERPRP-----VAVIDESLCIGCTLCIQACPVDAIVGAAKQMHTIVNDLCTGCDLCVAPCPVDCIAMVEVT....... 143
535 2.000e-19UniRef50_A0A151BG12 Formate hydrogenlyase subunit 6 n=3 Tax=unclassified Candidatus Bathyarchaeota TaxID=1700837 RepID=A0A151BG12_9ARCH  ali  29  24...............TVKYPDERLERFRGRHRL-----DLDKCIHCGLCARICPCASIVLVEGKYPQIDYGTCSLCGLCVDACPRGALTMTDFVEFSAYK. 111
536 2.000e-19UniRef50_X1E8Y6 Uncharacterized protein (Fragment) n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X1E8Y6_9ZZZZ  ali  29  100.....KGHIQAGFGGAIKNLGMGKGTKRIIHRMSIPRFFAEKCDLCGSCAEVCPCHAITVDLDWRY--DSLACEGCGKCVSTCPSGALSYD.......... 186
537 2.000e-19UniRef50_G2LF60 NADH-quinone oxidoreductase subunit I n=17 Tax=Bacteria TaxID=2 RepID=G2LF60_CHLTF  ali  30  42...................PVELYPRFRGEHYLARDENGKERCVACFLCAAACPADAIYIEADEVYNIDYGRCILCGYCVEACPKDAIKHGHNFEMA.... 136
538 2.000e-19UniRef50_A0A1F7LMS1 Uncharacterized protein n=3 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1F7LMS1_9BACT  ali  41  265...............................RTMRPVIDFDKCVKCTLCWLQCPDSCFDVTPDDLYDANMDACCGCGVCEAVCPKECITMVSEAAFDDN.. 333
539 2.000e-19UniRef50_A0A1F9ZS98 Uncharacterized protein n=7 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9ZS98_9BACT  ali  31  141................LKNLAMGPSGKKAQHSGMFPKVRSSKCVHCGLCITECPVGAIR----EDLTIDETKCTGCGKCAEVCPYDAIE............ 212
540 2.000e-19UniRef50_E6NAM7 Pyruvate ferredoxin oxidoreductase, gamma subunit n=3 Tax=Archaea TaxID=2157 RepID=E6NAM7_9ARCH  ali  37  217...............ILTSVGNTVKKLTGTWRIDRPIIDYAKCTRCMICYIYCPDSVISLRDDLSPVIDYSNCKGCLICYVMCPPRAIKTEAE........ 294
541 2.000e-19UniRef50_C8PYA4 Electron transport complex, RnfABCDGE type, B subunit n=14 Tax=Proteobacteria TaxID=1224 RepID=C8PYA4_9PROT  ali  39  107.................................MRAIIREEDCIGCTKCIPACPVDAIIGSGKRMHTIFTDLCTGCELCLPPCPVDCIELVPFPRLMDD.. 172
542 2.000e-19UniRef50_A0A1F9LYV7 NADH-quinone oxidoreductase subunit I n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9LYV7_9DEL  ali  28  32.GVTLRHFLRNLFGGTISYPEERREGYRGKHVLYRRADAPDKCVACFMCATACPARCITIEAGERFEIDGLRCIYCGMCEEACPKDAIALTSFYETAAY.. 151
543 2.000e-19UniRef50_W0PG41 Putative electron transport complex protein RnfB n=9 Tax=Proteobacteria TaxID=1224 RepID=W0PG41_9BURK  ali  31  76................................LLVAVIDESHCIGCTLCIQACPVDAIMGANKFMHTIIPDLCSGCELCIAPCPVDCISMED......... 135
544 2.000e-19UniRef50_A0A125P1Y7 NADH-quinone oxidoreductase subunit I n=5 Tax=Nitrospirae TaxID=40117 RepID=A0A125P1Y7_9BACT  ali  26  79MSLTMSYMFKKPV--TRQYPKEKREGFRGMHALVRPLTRRARCVGCGLCAAICPSKCITISEGKRYEIEILRCLFCGLCVEACPFQAIVLTGHYEYAD... 187
545 2.000e-19UniRef50_A0A0F6ZZY1 Ion-translocating oxidoreductase complex subunit B n=147 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0F6ZZY1_PSESY  ali  30  65................LSVPVLTLDMQRGTAPAQVAFIREAECIGCTKCIQACPVDAILGASRLMHTVIIDECTGCDLCVAPCPVDCIEMHP......... 140
546 2.000e-19UniRef50_UPI0005AB7EDB RnfABCDGE type electron transport complex subunit B n=2 Tax=Escherichia coli TaxID=562 RepID=UPI0005AB7EDB  ali  32  24.................................MVAFIDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISLQPVAETPD... 88
547 3.000e-19UniRef50_A0A1F8KKC3 NADH-quinone oxidoreductase subunit I n=4 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1F8KKC3_9CHLR  ali  30  8...TLKEMVVDPVT-TVQYPEVKRPRYKGRHTLKRYENGLEKCIGCSLCAAACPADAIFVEAAITYEINFLRCIFCGFCEDACPTEAIVLGDQYEMSFTE. 121
548 3.000e-19UniRef50_A0A098EED4 Pyruvate synthase subunit PorD n=11 Tax=root TaxID=1 RepID=A0A098EED4_9ZZZZ  ali  39  6........MKYSVGATIEEAGNSVLNKTSSWRVLKPVV--ENCKKCGLCATFCPEGIIRIKD--MAIIDYDYCKGCGICAEECPIKGIKMVLE........ 86
549 3.000e-19UniRef50_X1LJA9 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1LJA9_9ZZZZ  ali  25  51.......HPDAGFAGSLKNVAMGCETKLAMHSSAKPSYNEEKCTQCLRCVKICPGEAFYEKDSQIHY-QAEKCIGCGECIAVCPSGAITVPW......... 138
550 3.000e-19UniRef50_A0A2N1ZFP8 Ion-translocating oxidoreductase complex subunit B n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2N1ZFP8_9GAMM  ali  32  283.................................MVAYIREAECIGCTKCIQACPVDAIVGAARQMHTVIVSECTGCDLCVEPCPVDCIDMIQ......... 341
551 3.000e-19UniRef50_A0A256YXI6 Uncharacterized protein n=1 Tax=Desulfurococcales archaeon ex4484_42 TaxID=2012520 RepID=A0A256YXI6_9CREN  ali  35  9........KALGIGVTRKYPYVRVEPPEGFR--GKPIIDPDKCLGCGACAEACPPKAISTEDARYVKIFYGRCIFCGMCADVCPANAIELSKEFELASKE. 104
552 3.000e-19UniRef50_X1BMJ9 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1BMJ9_9ZZZZ  ali  23  167....FTGHPLGGFGGSIKNLAMGCASIKGQHSEYLPKVKEGLCNLCGVCIENCGYNAIKKGKNSIYFI-AENCVGCGECVSVCKYGAIS............ 253
553 3.000e-19UniRef50_A0A1F5TFR8 Uncharacterized protein n=1 Tax=Candidatus Falkowbacteria bacterium RIFOXYC2_FULL_48_21 TaxID=1798005 RepID=A0A1F5TFR8_9BACT  ali  26  133....VKGHYCSGFGGAIKNLAMGKKTKSVEHTLGKPKW-VDDCEGCGLCAKQCPSKAIKMMDGK-AVINLEKCWGCSICEVNCP................. 213
554 3.000e-19UniRef50_A0A0Q9YTD1 Ion-translocating oxidoreductase complex subunit B n=1 Tax=Candidatus Berkiella cookevillensis TaxID=437022 RepID=A0A0Q9YTD1_9COX  ali  37  79...................................AVVQEEACIGCTKCIKACPVDAIIGTSKKLHVVISDFCTGCELCLPVCPVDCIDMV.......... 134
555 3.000e-19UniRef50_I7KBT2 Pyruvate ferredoxin oxidoreductase, delta subunit n=20 Tax=root TaxID=1 RepID=I7KBT2_METBM  ali  44  11...................PGRALENKTGAWRVFKPVFDPETCSRCGMCALVCPEGCVHETEEGTFEPDLDYCKGCGICEEVCPKKSIRMEKEEK...... 86
556 3.000e-19UniRef50_F6ABS0 Ion-translocating oxidoreductase complex subunit B n=10 Tax=Pseudomonas TaxID=286 RepID=F6ABS0_PSEF1  ali  31  73.................................QVAVIREAECIGCTKCIQACPVDAIVGAAKLMHTVIGDECTGCELCIAPCPVDCIDLI.......... 130
557 3.000e-19UniRef50_A0A133UD99 Uncharacterized protein n=9 Tax=Euryarchaeota TaxID=28890 RepID=A0A133UD99_9EURY  ali  26  9....LKNLFSKPF--TLKYPFEKREPPEN--ARGKPSIDRDECVSCGLCARICPPRAITYDEEEKPIIDLGICIYCSECADACPTEAIQRSKEYELGLYD. 100
558 3.000e-19UniRef50_C1A8Y6 NADH-quinone oxidoreductase subunit I n=13 Tax=Bacteria TaxID=2 RepID=C1A8Y6_GEMAT  ali  26  11MATTFK-HLVDPHKVTMEYPETKWPRWRGTHRMLTTEDGKAKCVACGLCPTVCPANCIKLTPGEVFEIDEFRCIFCGYCQEVCPEEAIHLGRHYENAEYD. 121
559 3.000e-19UniRef50_A0A2D5QHG8 Ion-translocating oxidoreductase complex subunit B n=1 Tax=Porticoccus sp. TaxID=2024853 RepID=A0A2D5QHG8_9GAMM  ali  30  111...............................RKTVAFIREDECIGCTKCIQACPVDAILGAAKQMHTVIEKECTGCDLCIDPCPVDCIDI........... 169
560 3.000e-19UniRef50_A0A2W5Y1P3 NADH-quinone oxidoreductase subunit NuoI n=1 Tax=Solirubrobacterales bacterium TaxID=1909295 RepID=A0A2W5Y1P3_9ACTN  ali  26  66...............TFQYPEEKVPRFRGRHKLHRFEDGLEKCVGCSLCAAACPADCIRVVAAEVYEINMTRCIFCGYCEVACPFDAITMGHDYELSDY.. 168
561 3.000e-19UniRef50_I0GIF5 Putative glutamate synthase n=2 Tax=Caldisericum exile TaxID=693075 RepID=I0GIF5_CALEA  ali  29  20.....KYIFKKPV--TVQYPKEKLERYRGFH-----VNDLDKCIGCGNCMSICPCQAITMDDPKRPRIDYGRCSYCGLCVEVCPTGSLKMERNLIFTSQDG 125
562 3.000e-19UniRef50_A0A2S0QX00 Ion-translocating oxidoreductase complex subunit B n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A2S0QX00_9RHOO  ali  32  106...................................AFIDEQTCIGCTLCIQACPVDAIIGAAKQMHTVVEQLCTGCELCVAPCPVDCITMKPLPETVEN.. 169
563 4.000e-19UniRef50_A0A060NX34 Ion-translocating oxidoreductase complex subunit B n=53 Tax=Burkholderiaceae TaxID=119060 RepID=A0A060NX34_9BURK  ali  29  56..........ARLAALLDKPVIPLDTTHGEERARLAVIDENVCIGCTLCMQACPVDAIAGAAKQMHTVIAELCTGCDLCVPPCPVDCIAMLPVT....... 140
564 4.000e-19UniRef50_A0A2D5UFV3 Uncharacterized protein n=1 Tax=Nitrospinae bacterium TaxID=2026769 RepID=A0A2D5UFV3_9BACT  ali  35  253...................PGRNPYFKKWSTRSMRPVLQFDKCTKCTLCWVACPDSAFDVTPDGYFDPNMEACIGCGVCEAICPVECLQMAYETAFEDRDS 335
565 4.000e-19UniRef50_Q6MDQ8 NADH-quinone oxidoreductase subunit I n=7 Tax=Chlamydiia TaxID=204429 RepID=NUOI_PARUW  ali  27  17..IVLKHAFQTPV--TLRYPEEKRARSRGRHYLTKWNDGLERCVGCELCAIVCPAQAIYVEPGHIHQINMLRCIFCGYCEEACPTGAIVLSNQYELSAY.. 129
566 4.000e-19UniRef50_A0A1B2I723 Pyruvate ferredoxin oxidoreductase n=5 Tax=Synergistetes TaxID=508458 RepID=A0A1B2I723_9BACT  ali  42  7.......WQEVPLG-TVAFGASALKVQTGLWRSMRPIIDADKCVSCLKCWIQCPDDSVELNDNRVCGINLFFCKGCGLCEKLCPTKAITMRSEASFAGE.. 98
567 4.000e-19UniRef50_A0A0W0P4X6 (4Fe-4S)-binding protein (Fragment) n=1 Tax=Pseudomonas sp. ABAC21 TaxID=1230462 RepID=A0A0W0P4X6_9PSED  ali  29  29...........GLAHLLNVPVLDLDTTRGEAPAQVAYIREAECIGCTKCIQACPVDAIVGAAKLMHSVIIDECTGCDLCVAPCPVDCIEMRP......... 109
568 4.000e-19UniRef50_A0A1Q4FHE9 Ion-translocating oxidoreductase complex subunit B n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Q4FHE9_9GAMM  ali  33  77..................................VALIDEDVCIGCTKCIQACPVDAIVGANKRMHTIISAECTGCGLCVPPCPVDCIAMV.......... 133
569 4.000e-19UniRef50_A0A139SUR1 Uncharacterized protein n=1 Tax=Ventosimonas gracilis TaxID=1680762 RepID=A0A139SUR1_9GAMM  ali  33  73................................VQLAFIREDECIGCTKCIQVCPVDAIVGAAKWMHTVIADECSGCELCLAPCPVDCIDLLP......... 132
570 4.000e-19UniRef50_A0A1J5NX47 NADH-dependent phenylglyoxylate dehydrogenase subunit delta n=12 Tax=cellular organisms TaxID=131567 RepID=A0A1J5NX47_MOOTH  ali  45  30.......................ASTKTGSWRIMRPEVDYDQCTRCGTCAKYCPLDIIDVDKEQSVTMNLDYCKGCGICANVCPRKCIKMVSE........ 102
571 4.000e-19UniRef50_A0A256Y478 Pyruvate ferredoxin oxidoreductase n=1 Tax=Archaeoglobales archaeon ex4484_92 TaxID=2012529 RepID=A0A256Y478_9EURY  ali  42  3........IKLNIGG-VSPPLQSEEIKTGDWGTQYPVVDKEKCTACRICQQYCPDLCIEVKEEKYAVVDYNYCKGCGICSSVCPSEAITME.......... 87
572 4.000e-19UniRef50_X1M5T3 Uncharacterized protein (Fragment) n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X1M5T3_9ZZZZ  ali  25  57.......HPDAGFAGSLKNVAMGCETKLAMHSSAKPSYNEEKCTQCLRCVKICPGEAFYEKDSQIHY-QAEKCIGCGECIAVCPSGAITVPW......... 144
573 4.000e-19UniRef50_UPI0009AF7BEA electron transport complex subunit RsxB n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0009AF7BEA  ali  35  85.................................MLAVIDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCIELRPVNETPD... 149
574 5.000e-19UniRef50_A0A2V8H424 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8H424_9BACT  ali  36  36........................AFKRGTTKTHRPVVRFDLCIKCTLCWLDCPDECFDPTDDGLYDVNYEVCVGCHKCAAVCPVECIVMVDELKFADN.. 111
575 5.000e-19UniRef50_A0A2H0LHS1 NADH-quinone oxidoreductase subunit I n=29 Tax=Bacteria TaxID=2 RepID=A0A2H0LHS1_9BACT  ali  23  58.......FRDQPASVTIQYPDQRRPRLRTRHRLTKREDGTPRCVACMMCETVCPARCIYIVAGKSFDIDLGKCVYCGYCVEACPEDAIRMDQRHDIAAY.. 164
576 5.000e-19UniRef50_Q603B3 Ion-translocating oxidoreductase complex subunit B n=15 Tax=Proteobacteria TaxID=1224 RepID=Q603B3_METCA  ali  34  104..................................VAVIDETKCIGCTLCIQACPVDAILGAAKLMHTVIASECTGCELCIAPCPVDCIAMEPVRE...... 164
577 5.000e-19UniRef50_C6WYD9 Ion-translocating oxidoreductase complex subunit B n=63 Tax=root TaxID=1 RepID=C6WYD9_METML  ali  30  106..................................VAFIDEATCIGCTLCIQACPVDAILGAAKHMHTIIASECTGCELCLAPCPVDCISMQPLAETPDN.. 170
578 5.000e-19UniRef50_A0A0A6PRC1 Uncharacterized protein n=1 Tax=Candidatus Thiomargarita nelsonii TaxID=1003181 RepID=A0A0A6PRC1_9GAMM  ali  33  214.....WGYETAPIGGILAAPGNTVSNDTASRMGWLPIFDLEKCIHCGICDMVCPDYCLVFKNQEIHGIDYRYCKGCLRCVESCSTGAL............. 302
579 5.000e-19UniRef50_D4H177 NADH-quinone oxidoreductase subunit I n=7 Tax=Deferribacteraceae TaxID=191394 RepID=D4H177_DENA2  ali  25  18LSITLSHMFKKPV--TYKYPYEAMDRFRGIQYIKTHEDGRTKCVGCYLCQKVCPSECIHIETDRKYELDLSRCIYCGYCEEVCPVDAIHMGWE........ 120
580 5.000e-19UniRef50_UPI00097808FD 4Fe-4S dicluster domain-containing protein n=1 Tax=Desulfatitalea tepidiphila TaxID=1185843 RepID=UPI00097808FD  ali  23  252...............TLKAFKMHPKPASLASSAFVASVNRDECIGCETCLERCQMEALTIDDDSVAVVDPDRCIGCGLCVTTCPTEAISLERKPE...... 331
581 5.000e-19UniRef50_A0A1V1RGW0 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit n=10 Tax=Bacteria TaxID=2 RepI  ali  37  1MRAGVRGSGMDPFAIAMSRPARGEAGRTGDWRNARPVIDASACVACQICWAHCPDACI--EQGAPPSIDLEYCKGCGICAEECPAGAIAMVPEAEH..... 102
582 5.000e-19UniRef50_A0A0H5E6P5 NADH-quinone oxidoreductase subunit I n=3 Tax=Bacteria TaxID=2 RepID=A0A0H5E6P5_9BACT  ali  28  7..IVLKHAFKRPV--TIRYPEERRPRSRGRHFLTKWEDGKERCVGCELCAIVCPSQAIYVKAAKDYQINMLRCIFCGLCEEACPTGAVVLGTDYELS.... 117
583 5.000e-19UniRef50_A0A2D2DHX4 Ion-translocating oxidoreductase complex subunit B n=11 Tax=Burkholderiales TaxID=80840 RepID=A0A2D2DHX4_9BURK  ali  30  71..................NPANGVERARP-----VAFIDEALCIGCTLCIQACPVDAIMGAAKQMHTILPSLCTGCDLCVAPCPVDCISMMPVT....... 141
584 5.000e-19UniRef50_M1M0V0 Ion-translocating oxidoreductase complex subunit B n=3 Tax=Candidatus Kinetoplastibacterium TaxID=33055 RepID=M1M0V0_9PROT  ali  32  76................................LMLAYVEEDECIGCTLCIKACPVSAIIGSNKLMHSVIQDWCTGCELCLKTCPVDCIKMKSSEKIWTKE. 143
585 5.000e-19UniRef50_A0A2E6P5E9 Ion-translocating oxidoreductase complex subunit B n=1 Tax=Acidiferrobacteraceae bacterium TaxID=2024893 RepID=A0A2E6P5E9_9GAMM :  ali  31  84...................................AFIDESACIGCALCIKACPVDAIIGARKLMHTVLTSECTGCELCIEPCPVDCIELIAKDD...... 143
586 5.000e-19UniRef50_A0A062F2T7 Ion-translocating oxidoreductase complex subunit B n=2 Tax=Acinetobacter baumannii TaxID=470 RepID=A0A062F2T7_ACIBA  ali  38  3.......................................EDECIGCTKCINACPVDAIIGSGKLMHTILTDLCTGCELCIPPCPVDCIDLVEDT....... 57
587 5.000e-19UniRef50_A0A1F4YLG5 Pyruvate synthase n=2 Tax=Bacteria TaxID=2 RepID=A0A1F4YLG5_9BACT  ali  45  9.................SAPGSSKSYKTGSWRTNKPIFKHDTCNDCRICVLVCPDACIFGSDK-VYDANLDFCKGCGICAYECPVDDIEMVLE........ 83
588 5.000e-19UniRef50_A7ZM88 Ion-translocating oxidoreductase complex subunit B n=1356 Tax=root TaxID=1 RepID=RSXB_ECO24  ali  32  108.................................MVAVIDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISLQPVAETPD... 172
589 5.000e-19UniRef50_T2LEA1 Ion-translocating oxidoreductase complex subunit B n=81 Tax=Proteobacteria TaxID=1224 RepID=T2LEA1_9GAMM  ali  36  109...................................AFIREAECIGCTKCIQACPVDAIIGAAKLMHTVIEDECTGCDLCLDPCPVDCIDMLPR........ 166
590 5.000e-19UniRef50_A0A1B9JYB5 Ion-translocating oxidoreductase complex subunit B n=2 Tax=Gilliamella apicola TaxID=1196095 RepID=A0A1B9JYB5_9GAMM  ali  29  11................................VYKAFIDEENCIGCGKCIRVCPTDAIVGSKQVLHTILPQFCTSCSNCINTCPTDCITL........... 68
591 5.000e-19UniRef50_U3AV44 Uncharacterized protein n=11 Tax=Pseudomonadaceae TaxID=135621 RepID=U3AV44_PSEA4  ali  29  73.................................QIALIREAECIGCTKCIQACPVDAIVGAAKLMHTVISVECTGCELCVAPCPVDCIDILP---LADAEA 137
592 5.000e-19UniRef50_A0A0W0WW92 Ion-translocating oxidoreductase complex subunit B n=8 Tax=Legionellales TaxID=118969 RepID=A0A0W0WW92_9GAMM  ali  35  77...................................AQIREGECIGCTKCIQACPVDAIIGSAKRMHSILSTECTGCGLCVEPCPVDCIDMVTIPE...... 136
593 6.000e-19UniRef50_A0A077DBC2 Ion-translocating oxidoreductase complex subunit B n=37 Tax=Proteobacteria TaxID=1224 RepID=A0A077DBC2_9BURK  ali  35  73................................LEVAYIDENHCIGCTLCIQACPVDAIIGVNKYMHTVIPDLCSGCELCVAPCPVDCISMKP......... 132
594 6.000e-19UniRef50_A0A1F8VH29 Ion-translocating oxidoreductase complex subunit B n=1 Tax=Coxiella sp. RIFCSPHIGHO2_12_FULL_44_14 TaxID=1797697 RepID=A0A1F8VH29  ali  30  9............................GNHA-FKAVIREDECIGCTQCLQVCPTDAIVGAARLMHTIITDACTGCGLCVPPCPIDCIDIISVPEPSALE. 79
595 6.000e-19UniRef50_A0A2H5X0H5 NADH-quinone oxidoreductase subunit I n=27 Tax=Bacteria TaxID=2 RepID=A0A2H5X0H5_9BACT  ali  23  20LSITFRHQPPFHEPITVEYPEQKRPMYRWRHVLRRYDNGLERCIGCSLCAGACPARCIYVEAAERYEINMLRCIFCGYCQEACPTGAIVLRDDYELADY.. 136
596 6.000e-19UniRef50_A0A1F2QVL6 NADH-quinone oxidoreductase subunit I n=3 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2QVL6_9BACT  ali  28  16..................EPVRFEARYRGVHVLHRDENGLEKCVACFLCAAACPAQCIYIEAAKVYNIDYSRCIFCGYCVEACPTDAITHGHGFELATY.. 111
597 6.000e-19UniRef50_A6H1Q5 NADH-quinone oxidoreductase subunit I n=165 Tax=root TaxID=1 RepID=NUOI_FLAPJ  ali  30  39..ITIKHFFRKKV--TIHYPEQVREVYRGQHMLKRDEQGRENCTACGLCALSCPAEAITMKAAERYEINMLRCIFCGLCEEACPKDAIYLT.......... 144
598 6.000e-19UniRef50_A0A1A7C4P5 Ion-translocating oxidoreductase complex subunit B n=64 Tax=Bacteria TaxID=2 RepID=A0A1A7C4P5_9BURK  ali  28  70..................NPLNGLERPRSL-----AYIDESLCIGCTLCIQACPVDAITGAAKQMHTVVASLCTGCDLCVAPCPVDCIVMYPVSGEAT... 144
599 6.000e-19UniRef50_F3LS43 Ion-translocating oxidoreductase complex subunit B n=101 Tax=Bacteria TaxID=2 RepID=F3LS43_9BURK  ali  30  67...................PAHGAEGPRGL-----AVVDESWCIGCTLCLKACPVDCIVGANKRMHTVIDALCTGCGLCLPACPVDCITMVE......... 134
600 6.000e-19UniRef50_A0A268IA77 Ferredoxin n=6 Tax=Bacillales TaxID=1385 RepID=A0A268IA77_9BACI  ali  34  219......GYETQALGGVIAAQGNSILKDLGSRQGFLPELNREECIHCAACDNVCPDYCFVWEEGELKGIDYQFCKGCLKCVEACPTSALKEIREKIGFAEE. 322
601 6.000e-19UniRef50_A0A1F2WIR0 Uncharacterized protein n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1F2WIR0_9ACTN  ali  43  10..................KPGSSLKNLTKAWRGKHPVFKQDQCIGCQRCFMGCPEGTIYQLGKKRFDVNLDYCKGCGICANECPVDDIDMVLEA....... 85
602 6.000e-19UniRef50_A0A1V5YCH8 Glutamate synthase (NADPH) small chain n=4 Tax=Bacteria TaxID=2 RepID=A0A1V5YCH8_9CHLR  ali  42  519...................................RCFSCGTCNGCDNCWVYCPDVAISRLNHEDYVIDYDYCKGCGLCAEECPREAIAIEEELKW..... 579
603 7.000e-19UniRef50_A0A2E4KX69 Ion-translocating oxidoreductase complex subunit B n=3 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E4KX69_9GAMM  ali  32  111..................................VALIIEEECIGCTKCIQACPVDAIVGANKLMHTVIIDDCTGCDLCVDPCPVDCIDMVPRPKAPD... 174
604 7.000e-19UniRef50_A0A1G4FKQ9 Pyruvic-ferredoxin oxidoreductase subunit delta n=10 Tax=cellular organisms TaxID=131567 RepID=A0A1G4FKQ9_9FIRM  ali  50  37..............................WRTFRPVIDETKCSMCYVCWLVCPDGVID-KTGTKLEIDYDYCKGCGICAYECPSKAIDMIKESE...... 100
605 7.000e-19UniRef50_A0A1I1KVM0 Electron transport complex protein RnfB n=1 Tax=Kushneria avicenniae TaxID=402385 RepID=A0A1I1KVM0_9GAMM  ali  30  77...................................AVIREAECIGCTKCIQACPVDAILGASKQMHTVIEAECTGCELCVAPCPVDCIDIV.......... 132
606 7.000e-19UniRef50_M7NZZ1 Ion-translocating oxidoreductase complex subunit B n=25 Tax=root TaxID=1 RepID=M7NZZ1_9GAMM  ali  33  104.................................MLAVIDEARCIGCTLCIQACPVDAILGAAKHMHTVIADECTGCELCVAPCPVDCIDMVR......... 162
607 7.000e-19UniRef50_R9SNW8 Pyruvate ferredoxin oxidoreductase delta subunit PorD n=9 Tax=Archaea TaxID=2157 RepID=R9SNW8_9EURY  ali  44  1........MMTSVGCTNNQPGSTVKNKTGSWRTFKPISDREKCVECFNCYIFCPEGCIDTE----FNIDYDYCKGCGICKNECPVNAIEME.......... 79
608 7.000e-19UniRef50_A0A2C6MDN5 Formate hydrogenlyase subunit 7 n=1 Tax=Desulfotomaculum profundi TaxID=1383067 RepID=A0A2C6MDN5_9FIRM  ali  28  14..............ATVEYPFKPLEVAPGFR--GKPVYNFQQCIACGACAIACPANAITMDYNKSWKIFYGRCIFCGRCEEVCPPGAITLSPDFELAA... 100
609 7.000e-19UniRef50_A0A1W9RTS8 NADH-quinone oxidoreductase subunit I n=1 Tax=candidate division KSB1 bacterium 4484_87 TaxID=1970772 RepID=A0A1W9RTS8_9BACT  ali  31  35....LWKWLTFRKGGVILYPEETRANNRGRHILVQRSNGQPRCVACKMCATICPAQCITIEAEEVFEIDLSHCIFCGFCVEACPVDAIRMLPETELVGYD. 147
610 7.000e-19UniRef50_A0A1Y3GDD9 Pyruvate:ferredoxin oxidoreductase delta subunit PorD n=1 Tax=Methanonatronarchaeum thermophilum TaxID=1927129 RepID=A0A1Y3GDD9_9  ali  51  10...................PGTTKKYKTGTWRTYKPILDKDACIGCEKCWEYCPDTCVEHEDDIIFETDLDYCKGCGICAKECPVEAIEMELDEK...... 88
611 7.000e-19UniRef50_A0A1I1Q9F7 Ion-translocating oxidoreductase complex subunit B n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A1I1Q9F7_9GAMM  ali  33  106..................................VAIIDENICIGCTLCVQACPVDAIVGAAKQMHTVIEAECTGCELCIEPCPVDCIYMVPVPETP.... 168
612 7.000e-19UniRef50_A0A0M2U077 NADH-quinone oxidoreductase subunit I n=2 Tax=Clostridia TaxID=186801 RepID=A0A0M2U077_9FIRM  ali  26  18LGVTLRHLFSKPV--TIQYPTERREPFDRFRGLIR--WDQEKCVACVLCEHYCPVKAIDIVTGEHYQVDAIHCMLCGFCVEICPVSALSHSHHYELAVYES 123
613 7.000e-19UniRef50_A0A1C6JZJ9 Pyruvic-ferredoxin oxidoreductase subunit delta n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1C6JZJ9_9CLOT  ali  50  30...........................TGSWRMERPQVDEEACIRCGICSKYCPTACITVKEGCPLEFDWHYCKGCGICANECPRQALSMIPE........ 96
614 7.000e-19UniRef50_A0A2E9MX47 Ion-translocating oxidoreductase complex subunit B n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E9MX47_9GAMM  ali  31  115...................................AAIREAECIGCTKCIQACPVDAILGGPKFMHTVIAAECTGCDLCVEPCPVDCINLVP......... 171
615 7.000e-19UniRef50_A0A1F7LF57 Uncharacterized protein n=1 Tax=Candidatus Rokubacteria bacterium GWA2_70_23 TaxID=1802095 RepID=A0A1F7LF57_9BACT  ali  41  514................................EARRCFTCGFCSMCGNCFTYCPDAAIAQRADWGFEIDLDYCKGCGVCVQECPRSAMTMIPEEE...... 576
616 7.000e-19UniRef50_A0A0S8KF37 Uncharacterized protein n=1 Tax=Anaerolineae bacterium SM23_84 TaxID=1703388 RepID=A0A0S8KF37_9CHLR  ali  40  348...............................REAGRCFSCGRCNSCDNCWIYCPDACISRDEG-VYQIDYDYCKGCTLCAAVCPRDVISIIEEEKW..... 411
617 8.000e-19UniRef50_A0A1H0TXG6 4Fe-4S binding domain-containing protein n=1 Tax=Desulforhopalus singaporensis TaxID=91360 RepID=A0A1H0TXG6_9DELT  ali  24  251...............VLKNIKVLEKPAEEVHSNYFAVVDDDECVACGDCEERCHMDAIIVDD--HAEINLDRCIGCGVCVPACPTSAIQLRAKPQENTY.. 332
618 8.000e-19UniRef50_A4SYZ8 Ion-translocating oxidoreductase complex subunit B n=33 Tax=Proteobacteria TaxID=1224 RepID=A4SYZ8_POLAQ  ali  32  78..................NPECGEERPRA-----VAFIDPQKCIGCTLCIQACPVDAIIGASKQMHVVLDACCTGCDLCIPPCPVDCISMINVT....... 148
619 8.000e-19UniRef50_K4MGS6 4Fe-4S ferredoxin iron-sulfur-binding domain-containing protein n=9 Tax=Euryarchaeota TaxID=28890 RepID=K4MGS6_9EURY  ali  29  152.....KGHPASGFGGTVKNLGMGCAGKTLVHKPGVPDIDPEKCTGCSKCISECLWDALYMEGD-TARVNTELCKGDLSCTNSCRYGAIV............ 237
620 8.000e-19UniRef50_A0A133VFF1 Uncharacterized protein n=2 Tax=Euryarchaeota TaxID=28890 RepID=A0A133VFF1_9EURY  ali  29  9....LKNLFSKPF--TLKYPHERKEPPEN--ARGKPIVDREECISCKLCEKICPPKAITLDEDDKPIIDLGICIFCSECADACPKGAIKRSGEYELALYD. 100
621 8.000e-19UniRef50_A0A284VIU6 Putative F(420)H(2) dehydrogenase subunit I n=8 Tax=Methanosarcinales TaxID=94695 RepID=A0A284VIU6_9EURY  ali  24  19..VTLKHHIGNRPTVTVQYPYERAPRFRGRHS-----VDEDACIGCGICEVNCPNSTIRIKNRWFPEFNLGMCLFCGLCLDACPMNAIKMDGGYELADY.. 118
622 8.000e-19UniRef50_A0A1F7TH13 NADH-quinone oxidoreductase subunit I n=3 Tax=Nitrospinae/Tectomicrobia group TaxID=1802340 RepID=A0A1F7TH13_9BACT  ali  27  9LWLTLKHSWRSRV--TVQYPDEREEGYRGLHKLLRWEDGLERCVGCKLCSAACPVDCIFVESAEVYEINELRCIFCGYCEEACPVGAIVLGNEYEF..... 120
623 8.000e-19UniRef50_I1YH66 Ion-translocating oxidoreductase complex subunit B n=37 Tax=Proteobacteria TaxID=1224 RepID=I1YH66_METFJ  ali  32  104.................................MLAVIDEDRCIGCTLCIQACPVDAILGAAKQMHTVIAAECTGCELCVEPCPVDCIDMVE......... 162
624 8.000e-19UniRef50_A0A2D5WBM0 NADH-quinone oxidoreductase subunit I n=3 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5WBM0_9BACT  ali  25  50LSITLTKMFGKSI--TRQYPEEPLPTTRGQPRLVERQDGHLACVSCGLCEAACPAYAITIDGQERFEIDMLRCILCGFCEEACPKDAIFMSSELELADYD. 160
625 8.000e-19UniRef50_A0A1W9S557 Pyruvate synthase n=1 Tax=candidate division Zixibacteria bacterium 4484_95 TaxID=1970781 RepID=A0A1W9S557_9BACT  ali  46  11...................PGTSKVNKTGAWRTLMPVFKHDKCNDCRICVTVCPDACIFGQNN-VYNANLDYCKGCGICAHECPVDDIEMVLEAK...... 85
626 8.000e-19UniRef50_A4BN62 Ion-translocating oxidoreductase complex subunit B n=13 Tax=Proteobacteria TaxID=1224 RepID=A4BN62_9GAMM  ali  30  111...................................AWIDETACIGCTRCIQACPVDAILGTAKQMHTVIRTECTGCALCIAPCPVDCIHLRAVTQDID... 173
627 8.000e-19UniRef50_Q2Z081 Ion-translocating oxidoreductase complex subunit B n=69 Tax=root TaxID=1 RepID=Q2Z081_9GAMM  ali  31  115...................................AFIRENECIGCTKCIQACPVDAILGAAKQMHTVIASECTGCDLCVEPCPVDCIDMIYPEE...... 174
628 9.000e-19UniRef50_A0A1F8NDC3 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_60_13 TaxID=1797635 RepID=A0A1F8NDC3_9CHLR  ali  23  155....VKGHMITGFGGAVKNLAMGCEAKKEQHRANPPLLDEARCDGCEACIRICPAKALTMK-GGKPDREAEKCIFCSTCLFACDSGAFQ............ 241
629 9.000e-19UniRef50_A0A1G1LQF6 Uncharacterized protein n=1 Tax=Nitrospirae bacterium RIFCSPLOWO2_12_FULL_63_8 TaxID=1801718 RepID=A0A1G1LQF6_9BACT  ali  36  1...........................MSGWRTFRPVLNPELCNGCWLCFANCPEGAITIKPDGKPAIYYPHCKGCLDCVEVCPTDAMTVQRETEAATN.. 72
630 9.000e-19UniRef50_A0A1F4C741 Ion-translocating oxidoreductase complex subunit B n=4 Tax=Betaproteobacteria TaxID=28216 RepID=A0A1F4C741_9PROT  ali  30  67..................NPANGAERGRA-----VALIDEARCIGCTLCIQACPVDAIVGAAKLMHTVIAGLCTGCDLCLPPCPVDCIDMVP......... 135
631 1.000e-18UniRef50_A0A2H9QJF4 Uncharacterized protein n=3 Tax=unclassified Archaea (miscellaneous) TaxID=93506 RepID=A0A2H9QJF4_9ARCH  ali  31  7....LKNLVKKPF--TIDYPK-GRAKKMPELFRGKHVFHRDKCIGCGLCEKNCPSECIKVKEEKRITIRLDTCIFCGLCRDVCPVDAIEFSDKFELSTKD. 100
632 1.000e-18UniRef50_A0A143PMZ0 NADH-quinone oxidoreductase subunit I n=1 Tax=Luteitalea pratensis TaxID=1855912 RepID=A0A143PMZ0_9BACT  ali  26  10.KTTFGHMFKKPI--TVNYPDEKVPMFRGKQVLMRDENGLEKCVACGLCAVACPADAIYLEAAETYQIHKTRCIFCGYCEEACPVSAIFMGKDYELAVY.. 121
633 1.000e-18UniRef50_A0A2N3AQ72 Dihydroorotate dehydrogenase n=1 Tax=Candidatus Atribacteria bacterium HGW-Atribacteria-1 TaxID=2013676 RepID=A0A2N3AQ72_9BACT :_  ali  29  308.WMDDKGYKSLDEGAVMKNLISGAQLKRGQ-PGVHAVVDEGKCTGCLWCEKICLYEAITVEDA-VAEVNEDKCDGCGMCSQVCPSKAVSMSKTSE...... 401
634 1.000e-18UniRef50_A0A1G1HWD5 NADH-quinone oxidoreductase subunit I n=1 Tax=Nitrospirae bacterium RIFCSPHIGHO2_01_FULL_66_17 TaxID=1801712 RepID=A0A1G1HWD5_9BA  ali  24  19LGLTFRHMFEK--AVTQQYPHTKPDGYRGIMSLLKYDDGTERCVGCALCEIACPSGVIKVVSAETYTFDVTRCVFCGFCVDACPVDALAMTKEYEWASE.. 129
635 1.000e-18UniRef50_A0A2P6LLX0 RnfB n=1 Tax=Nephila clavipes TaxID=6915 RepID=A0A2P6LLX0_NEPCL  ali  30  85..............................HRLV-ALIREDECIGCTKCIQACPVDAIVGAARQMHTVLADECTGCNLCVPPCPVDCIDLVPGPDIP.... 150
636 1.000e-18UniRef50_A0A1M4YJC0 4Fe-4S dicluster domain-containing protein n=9 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1M4YJC0_9DELT  ali  27  253...............ILKNLKRIPEPAKVVMSNYFAEIDRDECIGCETCVDRCQMDAIAMEDD-LAQVNAARCIGCGVCVPSCPQEAITLREKTEE..... 332
637 1.000e-18UniRef50_A0A0B7MLZ7 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A0B7MLZ7_9FIRM  ali  46  22...........................TGKWRTFRPVIDKEKCTDCATCAHYCPVQAMRKDKDSRLYIDLSYCKGCGICEVECPRKAITMVREE....... 91
638 1.000e-18UniRef50_Q0P857 NADH-quinone oxidoreductase subunit I n=308 Tax=root TaxID=1 RepID=NUOI_CAMJE  ali  32  51..............ATIKYPFEKVKRYRAVHRLMRFIESEERCIGCGLCEKICISNCIRMEKVENYSINLGRCIYCGFCAEVCPELAIVHGTEYENAAEQ. 149
639 1.000e-18UniRef50_UPI00098D0BA7 RnfABCDGE type electron transport complex subunit B n=2 Tax=Wohlfahrtiimonas TaxID=582472 RepID=UPI00098D0BA7  ali  31  77....................................YIDETLCIGCTKCIQACPVDAIVGTKKKMHTVIQSECTGCDLCIPPCPLDCIYIKPSEEEFFPE. 140
640 1.000e-18UniRef50_A0A1J5P3I7 Electron transport complex subunit RsxB n=4 Tax=root TaxID=1 RepID=A0A1J5P3I7_9ZZZZ  ali  30  9.............GRAIKNPDHGPEKPR-----TVAFIDEAWCIGCTLCLQACPVDAIFGSNKLMHTVLERYCTGCELCLPVCPVDCIALE.......... 83
641 1.000e-18UniRef50_A0A1J5IIH3 Uncharacterized protein n=1 Tax=Candidatus Wirthbacteria bacterium CG2_30_54_11 TaxID=1817892 RepID=A0A1J5IIH3_9BACT  ali  45  4....LKTAREIPIGGMIVEPGNSLNYHTGSWASKQPRLDIAKCTGCAFCMNYCPDDCIKVDGQFRATIKYEYCKGCGVCVAVCKFDALKME.......... 94
642 1.000e-18UniRef50_A0A077F4I6 Ion-translocating oxidoreductase complex subunit B n=29 Tax=Pseudomonas TaxID=286 RepID=A0A077F4I6_9PSED  ali  27  55................LQVPIIALDPERGSAPPQVAFIREAECIGCTKCIQACPVDAIVGAAKLMHTVISAECTGCDLCVAPCPVDCIDLLP......... 130
643 1.000e-18UniRef50_A0A1F4YFV6 NADH-quinone oxidoreductase subunit I n=3 Tax=candidate division Zixibacteria TaxID=1379697 RepID=A0A1F4YFV6_9BACT  ali  25  16LSITFRYLFRKPV--TEQYPKVRPDRYRGLHYLTRYSDGSERCVCCGLCAAACPADCIYMECAEIYEINELRCIFCGMCEEACPEEAIFLGHEFEFSSGD. 125
644 1.000e-18UniRef50_A0A2H0A5R6 NADH-quinone oxidoreductase subunit I n=5 Tax=Candidatus Desantisbacteria TaxID=1819803 RepID=A0A2H0A5R6_9BACT  ali  26  11..VTFKHLFT--PSVTIQYPTQRRPVAEGFRGLQRLNVDENLCVGCGLCARYCPAEAIKIKKVESYIIDISRCIFCGLCVEACPKDAIRMTDCYEMACY.. 122
645 1.000e-18UniRef50_R6HLY6 4Fe-4S ferredoxin iron-sulfur binding domain protein n=1 Tax=Eggerthella sp. CAG:209 TaxID=1262875 RepID=R6HLY6_9ACTN  ali  31  295...............................AGFTAVIDHEKCTGCGNCAKKCPQEIITVNSDGKVTIDQDHCIGCGYCKSVCPNDAITLQQ......... 355
646 1.000e-18UniRef50_A0A2H6GT86 Pyruvate synthase subunit PorD n=11 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2H6GT86_9BACT  ali  41  4..............GAVIKHDIKKAPKTGDWRYMKPEINKEKCTGCGTCVKYCPEAVIELTANRVAGVDYHFCKGCGVCASVCPVKAIHMIKEADCIN... 108
647 1.000e-18UniRef50_A0A1Q9NP51 Pyruvate synthase subunit PorD n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_2 TaxID=1841597 RepID=A0A1Q9NP51_9ARCH  ali  42  15................IVRPMAGVAGRTSEWRTERPELHKENCTKCMACVIHCPDDVIELDKDGFPEIDQFYCKGCMICDAVCPHDAIE............ 87
648 1.000e-18UniRef50_A0A256ZVC3 Uncharacterized protein n=1 Tax=Euryarchaeota archaeon ex4484_162 TaxID=1978125 RepID=A0A256ZVC3_9EURY  ali  29  39....VKGHIQAGFGGAIKNFGMGKETKKLIHSFCEPIYNSENCTLCGICAEVCPFGAISV--NKVWMRNERKCLGCGKCVEACPNNALSYKK......... 127
649 1.000e-18UniRef50_A0A1G1L382 Uncharacterized protein n=1 Tax=Nitrospirae bacterium RIFCSPLOWO2_12_FULL_63_8 TaxID=1801718 RepID=A0A1G1L382_9BACT  ali  42  6.....................PGQKRITGDWRTFMPEVHQEKCIACRMCWVSCPESAITLDKDGYPHINYDICKGCLLCEEVCQPDAITHERDT....... 78
650 1.000e-18UniRef50_A0A2H6GQ10 NADH-quinone oxidoreductase subunit I n=1 Tax=bacterium BMS3Abin14 TaxID=2005722 RepID=A0A2H6GQ10_9BACT  ali  25  16LTLTIRYFFSKPV--TLRYPEEPPPRYRGAQILKRHPDGKERCVGCALCAAICPSDAITIKNVDFYQIDLGLCIYCGFCQEVCPVDAVWMGNDYEL..... 121
651 1.000e-18UniRef50_A0A1F5DFS9 Uncharacterized protein n=1 Tax=Candidatus Bathyarchaeota archaeon RBG_13_38_9 TaxID=1797377 RepID=A0A1F5DFS9_9ARCH  ali  25  157.....KGHVLSGFGGAIKNLAMGCETKAAQHLASRVILNTKECNGCGKCVDACPFNALKIENGKHAKI-LSRCMSCNSCFFACTEGALHL........... 243
652 1.000e-18UniRef50_A0A0T9WCH9 Ion-translocating oxidoreductase complex subunit B n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0T9WCH9_SALET  ali  38  45.................................MLAIIDENNCIGCTKCIQACPVDAIIGATRAMHTVMSDLCTGCNLCVDPCPTHCIELRPVNETPD... 109
653 1.000e-18UniRef50_A0A177R2Y5 Ion-translocating oxidoreductase complex subunit B n=1 Tax=Betaproteobacteria bacterium SCGC AG-212-J23 TaxID=1799662 RepID=A0A17  ali  33  3...............................RDAVALVDEARCIGCTHCIDACPVDAIVGAQGLMHTVVEAWCIGCALCLPPCPVDCIDMV.......... 62
654 1.000e-18UniRef50_T0AS58 Ion-translocating oxidoreductase complex subunit B n=14 Tax=Proteobacteria TaxID=1224 RepID=T0AS58_9RHOO  ali  29  106...................................AVIDENTCIGCTLCIQACPVDAIVGAAKQMHTVVEPLCTGCELCVAPCPVDCITMEVVADTV.... 167
655 1.000e-18UniRef50_A0A0S4M3P1 Ion-translocating oxidoreductase complex subunit B n=29 Tax=Bacteria TaxID=2 RepID=A0A0S4M3P1_9BACT  ali  31  108...................................AVIDEFTCIGCTLCIQACPVDAIVGAAKQNHTVIKEYCTGCELCIAPCPVDCIEMISTED...... 167
656 1.000e-18UniRef50_A0A2E9ICS0 Ion-translocating oxidoreductase complex subunit B n=2 Tax=Acidiferrobacteraceae bacterium TaxID=2024893 RepID=A0A2E9ICS0_9GAMM :  ali  29  78.................................QYAVVDEPXCTGCTLCIQACPVDAIVGAAKYMHSVIISFCTGCERCLPVCPVDCILLEP......... 136
657 1.000e-18UniRef50_A0A1Z9E095 Ion-translocating oxidoreductase complex subunit B n=1 Tax=Gammaproteobacteria bacterium TMED119 TaxID=1986671 RepID=A0A1Z9E095_9  ali  31  10...................................AVIDETRCIGCTLCIKACPFDAILGCSQKLHSVISAYCTGCNLCIAPCPVDCIKLVKNNHFPSE.. 73
658 1.000e-18UniRef50_A0A0M1ELN2 Ion-translocating oxidoreductase complex subunit B n=106 Tax=Bacteria TaxID=2 RepID=A0A0M1ELN2_STEMA  ali  27  56............LAQVLGTPAIPFDRSRGEHKAQVALIVEADCIGCTKCIQACPVDAIVGGAKYMHTVIADLCTGCELCIPPCPVDCIELVH......... 136
659 1.000e-18UniRef50_A0A1F4X3F8 Pyruvate synthase n=1 Tax=candidate division Zixibacteria bacterium RBG_16_50_21 TaxID=1802786 RepID=A0A1F4X3F8_9BACT  ali  39  8................IAEPGSSVGNRTGSWRTEKPVFLNKKCTDCKLCIILCPDG-VVFAVNKVYQANLDFCKGCGICAEECPTKDIQMVRE........ 83
660 1.000e-18UniRef50_A0A0E1UNI5 Ion-translocating oxidoreductase complex subunit B (Fragment) n=208 Tax=Proteobacteria TaxID=1224 RepID=A0A0E1UNI5_BURPE  ali  33  80...................................AFIDEQLCIGCTLCMQACPVDAIVGAPKQMHTIVAELCTGCDLCVPPCPVDCIAMIPVT....... 138
661 1.000e-18UniRef50_A6Q6Q0 Pyruvate:ferredoxin oxidoreductase, delta subunit n=100 Tax=root TaxID=1 RepID=A6Q6Q0_SULNB  ali  48  65............................ASWRVEKPVFNIDVCIDCQNCWVWCPDTSIISRDKQMLGIDYDHCKGCGVCVEVCPTN............... 122
662 1.000e-18UniRef50_A0A2D8Y090 Ion-translocating oxidoreductase complex subunit B n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2D8Y090_9GAMM  ali  34  104...................................AFIKEENCIGCALCLPACPVDAIIGAKDYLHTVVADECTGCELCVTACPVDCIVMQENTKVISQ.. 167
663 1.000e-18UniRef50_B5F6I9 Ion-translocating oxidoreductase complex subunit B n=478 Tax=Bacteria TaxID=2 RepID=RSXB_SALA4  ali  35  108.................................MLAVIDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCIELRPVNETPD... 172
664 1.000e-18UniRef50_A4CB99 Ion-translocating oxidoreductase complex subunit B n=7 Tax=Proteobacteria TaxID=1224 RepID=A4CB99_9GAMM  ali  35  107...................................AYIREDECIGCTKCIQACPVDAIIGATRQMHTVLIDECTGCDLCVEPCPVDCIDMLPVQETS.... 168
665 1.000e-18UniRef50_A0A1G1JTA7 Uncharacterized protein n=4 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1JTA7_9BACT  ali  34  214....FWGYLTAPIGGAIIQAGNSVINDLSASRGFAPRFHKDLCNHCGVCDMVCPDYCLVWEEDIFHGIDYRFCKGCLRCVETCPSGALT............ 317
666 1.000e-18UniRef50_A0A090PSZ7 Ion-translocating oxidoreductase complex subunit B n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A090PSZ7_9VIBR  ali  36  56...................................AFIHEDMCIGCTKCIQACPVDAIVGGTKALHTVIKDECTGCDLCVSPCPTDCIEMIP......... 112
667 1.000e-18UniRef50_A0A1H0S0S3 Pyruvate ferredoxin oxidoreductase gamma subunit n=1 Tax=Bacillus salsus TaxID=930152 RepID=A0A1H0S0S3_9BACI  ali  35  219......GYETQEIGGVIIANANSILKDLGSRQGFIPKFEVDKCISCAACDTVCPDYCFVWEEGELKGIDYQYCKGCLKCIEACPTVALTEIREEIGYSEE. 322
668 1.000e-18UniRef50_A0A0S2TF27 Uncharacterized protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0S2TF27_9GAMM  ali  45  476.............................AWREAGRCLSCGVCFECDNCWHFCPDAAVIKKEGGYA-IDYDYCKGCGICAAECPCGHIDMEREA....... 539
669 1.000e-18UniRef50_A0A2M7KJN8 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A2M7KJN8_9BACT  ali  31  521................................EAKRCFHCGLCNMCGNCLVFCPDSSVLPRDDWGFDIDLDHCKGCGVCVEECPRDAMSMVPEHEVRDD.. 587
670 2.000e-18UniRef50_A0A1T5KGJ6 Pyruvate ferredoxin oxidoreductase delta subunit n=2 Tax=Maledivibacter halophilus TaxID=36842 RepID=A0A1T5KGJ6_9CLOT  ali  44  32...........................TGIWRFKRPVVNHEECIKCKMCVEYCPCGVI---DKETIGIDYYFCKGCGICVEICPKKAIDFVSEKDILAKE. 101
671 2.000e-18UniRef50_A0A0M2TZW7 Uncharacterized protein n=4 Tax=cellular organisms TaxID=131567 RepID=A0A0M2TZW7_9FIRM  ali  53  13...........................TGSWRVFRPVIEPEKCNGCLVCWLYCPDGAIERTAEDRPSIFLDFCKGCGICASECPRQAVFMREE........ 78
672 2.000e-18UniRef50_T2GL48 Truncated ferredoxin n=1 Tax=Methanothermobacter sp. CaT2 TaxID=866790 RepID=T2GL48_9EURY  ali  24  7....FKGHGMSGFGGALKNLAMGCAGKIEQHECAKPVVRGE-CTECGECVYECPVDAMKLHDGIM--IEYDRCIACMNCLDTCPSEVFDLDWERDIP.... 99
673 2.000e-18UniRef50_A0A2V7YSF3 NADH-quinone oxidoreductase subunit I n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7YSF3_9BACT  ali  28  47.......YKKLPI---ISYPEVKRERFRGRHILTTREDGTTRCVACYMCSTACPAECITIEAGERYDIDLLRCVFCGYCVDACPEDAIYMTRDYEMA.... 146
674 2.000e-18UniRef50_A0A1F8M138 Uncharacterized protein (Fragment) n=4 Tax=root TaxID=1 RepID=A0A1F8M138_9CHLR  ali  22  14MALTFKHLFRAPI--TVQYPEEKLVVSR-RIRGNELVWYLDRCTGCATCAKACPQGNIEIVTHDKFEVDCGRCMFCGLCVEACPYDALAMGRSYERAQY.. 118
675 2.000e-18UniRef50_A0A2N3EQ35 Uncharacterized protein n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-9 TaxID=2013654 RepID=A0A2N3EQ35_9ACTN  ali  45  10........EEFPRAAVIPECGNSDDYDVGGWRSERPWRDPDVCTQCMLCWVFCPDSAVLVEDEKMVGFDLTKCKGCGICASECPKKAIEMVLE........ 101
676 2.000e-18UniRef50_A0A0W0W190 Ion-translocating oxidoreductase complex subunit B n=3 Tax=Legio