current user: public

If you have questions about the server, please let us know.

Query: [ET] COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain, from VFDB

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MKKLVLSLSLVLAFSSATAAFAAIPQNIRIGTDPTYAPFESKNSQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGGLast
1 -112.000[ET] COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain  ali follow..  100  1MKKLVLSLSLVLAFSSATAAFAAIPQNIRIGTDPTYAPFESKNSQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG 260
2 -30.600[M] COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein  ali follow..  20  5...................................HTPLTYNEINGKPFGLDYELAKQFADYLGVKLKVTRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQPGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVGSAELMEDVIEGKLDYTIADSVAISLFQRVHPE--------LAVALDITDEQPVTWFSLDGDNTLSAALLDFFNEMNEDGTLARIEEKYLG...... 221
3 -24.500[PET] KOG4440 NMDA selective glutamate-gated ion channel receptor subunit GRIN1  ali follow..  15  450..........................................TVPQCCYGFCIDLLIKLARTMNFTYEVHLVAWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRITGINDPRNPSDKFIYATVKQSSVDIYFRRQVMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQK---------DLVTTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTWVRYQ.... 796
4 -23.300[PET] KOG1052 Glutamate-gated kainate-type ion channel receptor subunit GluR5 and related subunits  ali follow..  12  427.....................SLSNRSLIVTTILE-EPYVLFYGNDRFEGYCIDLLRELSTILGFTYEIANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTIDSADDLAKQEYGAVEDGATMTFFKKSKISTYDKMWAFKSNEEGIQRVLTSDY-AFLMESTTIEFVTQRN---------NLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWWRGN.... 802
5 -23.100[PET] KOG1054 Glutamate-gated AMPA-type ion channel receptor subunit GluR2 and related subunits  ali follow..  15  427.......................................NQFEGNDRYEGYCVELAAEIAKHVGYSYRLETKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSIESAEDLAKQAYGTLEAGSTKEFFRRSKIAVFEKMWTYTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKP-------CDTMKVGGNLDSKGYGIATPKGSA-LRNPVNLAVLKLNEQGLLDKLKNKWWYDK.... 784
6 -18.500[P] COG4521 ABC-type taurine transport system, periplasmic component  ali follow..  16  1...MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTFA-----------KESGATVDWRKFD-ASIVRALASGDVQIGNLGVAASQQVPIEVFLLASKLGNSEALVVKKT---ISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEQPPAIIAAWQRGDIDGAYV.............................................................................. 175
7 -14.500[P] COG3221 ABC-type phosphate/phosphonate transport system, periplasmic component  ali follow..  14  3SRRSALVIAAGLSALALASCSGKSDNEVTFSILSTESTQNMESY---------PILKDMEKQTGLKVKPFSSNYSSLIVAMGAKQTDLGWQSGLEAVRRSNGEVFARTFDPSGSVIIVPADSK-IQSVQDLKSLDFGIGDKKSTSGTLAPMTPETCFKTVISANHQANLFAVANGKLDASTNNSTAIGLSKARGEGVTD----KIRVIWESPTLPEDPLVWRKDDPVVKEKLRQFFLTYAQGDT................ 262
8 -12.500[K] COG3888 Predicted transcriptional regulator  ali follow..  10  47IIKRRTIGGKIKHVWLAEYYPYYDEKLLRIGCSTEYVKF-------------VSVAKNYSESKGIDLIVRFYD--SLMNDLSQGLLEFALAPIF------TEIIYSISNRNSIILGAVASGGSGVYKNVNCNCGKILTSESSSMMILAREFAKTRKISEIAFKDPRRAIKDYESFKAEYIVI.............................................................................. 213
9 -12.200[R] COG2358 TRAP-type uncharacterized transport system, periplasmic component  ali follow..  15  1MSSRRFGLFTLAATVTFSTSVFAAPTFINILT-------------GGTSGVYYPIGVGLSQIYGHDIQGAKTSVQATLNLLQAGRGELALALGDSVKAPLKKLRAIGNTYPNYIQVVASQASG-IKTLADLKGKRISVAPKSGTELNARAIFKAAGLSYVEYLPYAESVELIKNRQLDATLQSSGLGMAAIRDLASTMPITFVA........................................................ 215
10 -11.600[E] COG2113 ABC-type proline/glycine betaine transport systems, periplasmic components  ali follow..  12  1MLKQITAMTAGLLMTVAAAAEPESCKTVRFSDVG---------TDITSTT---AVASTILEALGYAPQSKLLSIPVTYASMKNKDIDVYLADRKPFLEDKSIEVIGPNLTGAKYTFAVPK-SDLQKFPDKFGRKIYGIEPGNNGNRMILDMINKGDFGLTGWELVESSEQGMLAEVERATKDDQWIVFLGWAPHPMNTRYQIDADAYFGPNYGGADIYTNIRAGYAQECPNVARFVTNLRDGNDPKDAAADWLKAH.... 283
11 -10.500[H] COG2998 ABC-type tungstate transport system, permease component  ali follow..  13  5MKKTTFTLAAASLILVSYSASSADDARIRLATTTSTYD----------SGLLDYLLPKFEQDTGYKVDVIATGTGKALKMGENGDVDLVMTHAPKAEASAGFGVLPRKLMYNDFVVVGPESDPAIADEKNIAKVFENIAKSGA..................................................................................................................... 141
12 -10.000[R] COG4588 Accessory colonization factor AcfC, contains ABC-type periplasmic domain  ali follow..  11  1MKKIITLFGACAL-----AFSMANADVNLYGPGGPHTALK-------------DIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASLAIASDFGKDFNVSKPLYFREAIILTQKGNPLIKGLKDLANKKVGVWEDMIGRTQDIKTIQNFRNNIVAFPNSGSARKLFAQDQADAWIT--------WIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKK............. 245

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.