|
current user: public |
|
Query: [S] COG3592 Uncharacterized conserved protein, from VFDB |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . | |||||||
# | Score | Template | Links and tools | %id | First | MEEETLLEQGYRKYRGADVDIYFNTNICAHSGNCVKGNAELFNLDRKPWIMPDNVPKEEAKRVIHTCPSGALQYIEK | Last |
1 | -50.600 | [S] COG3592 Uncharacterized conserved protein | ali follow.. | 100 | 1 | MEEETLLEQGYRKYRGADVDIYFNTNICAHSGNCVKGNAELFNLDRKPWIMPDNVPKEEAKRVIHTCPSGALQYIEK | 77 |
2 | -24.800 | [C] COG1141 Ferredoxin | ali follow.. | 17 | 41 | ..............ILRQKGVYVDEITCIGCKHCAHVARNTFYIEPDY-IRQDGDAEEVIQEAIDTCPVDCIHWVDY | 107 |
3 | -16.200 | [C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit | ali follow.. | 11 | 42 | ................RTFMPVIDESKCVKCYICWKFCPPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMVRE | 103 |
4 | -13.800 | [C] COG1146 Ferredoxin | ali follow.. | 12 | 33 | ..............KEIEWYPTIDYDKCVTCGICFVTCGDFDKKEGKVIVARPYNCMVACQTCMNLCPTGAISFPDA | 99 |
5 | -13.400 | [C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB | ali follow.. | 8 | 111 | .....................VIDENNCIGCTKCIQACPDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISLQPV | 167 |
6 | -10.600 | [C] COG1145 Ferredoxin | ali follow.. | 15 | 273 | ...........NTIAHSSYLATVDTSRCIACGICMLRCPAIKAKINREPASVDAEKCLGCGVCVPTCPMEAIELVER | 340 |
7 | -10.400 | [C] COG0437 Fe-S-cluster-containing hydrogenase components 1 | ali follow.. | 14 | 84 | ............MHKREDGFVVVDEDVCIGCRYCHMACPPQYNAEKGHMTKYSRVAEGKQPICVESCPLRALEFGP. | 154 |
8 | -10.000 | [C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit | ali follow.. | 9 | 113 | ......................SGEERCIACKLCEAICPQAITIEAEERADGSRRTTRYDIDCQEACPVDAIVEGPN | 177 |
9 | -9.450 | [C] COG1034 NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) | ali follow.. | 16 | 126 | ..SFRRYRFTKRTHRNQDLGISHEMNRCIACYRCVRYYKDYADGTDLGVYGAHDNESEFSGNLVEICPTGVFT.... | 209 |
10 | -9.340 | [C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) | ali follow.. | 14 | 58 | .......................GEERCVACNLCAVACPGCISLQKAETEDGRWYPEFFRINCEEACPTTAIQLTPD | 121 |
11 | -9.290 | [C] COG2440 Ferredoxin-like protein | ali follow.. | 11 | 8 | LRVEEKLYQNRYLVDPGRPHIKVRPHERPSANLLTHICPKCYELNDKGQVETTSDGCMECGTCRVLCEASG...... | 81 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Igarashi Y, Eroshkin A, Gramatikova S, Gramatikoff K, Zhang Y, Smith JW,Osterman AL, Godzik A. CutDB: a proteolytic event database. Nucleic Acids Res. 2007 Jan;35(Database issue):D546-9. Epub 2006 Nov 16. |