current user: public

If you have questions about the server, please let us know.

Query: [S] COG3592 Uncharacterized conserved protein, from VFDB

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst MEEETLLEQGYRKYRGADVDIYFNTNICAHSGNCVKGNAELFNLDRKPWIMPDNVPKEEAKRVIHTCPSGALQYIEKLast
1 -50.600[S] COG3592 Uncharacterized conserved protein  ali follow..  100  1MEEETLLEQGYRKYRGADVDIYFNTNICAHSGNCVKGNAELFNLDRKPWIMPDNVPKEEAKRVIHTCPSGALQYIEK 77
2 -24.800[C] COG1141 Ferredoxin  ali follow..  17  41..............ILRQKGVYVDEITCIGCKHCAHVARNTFYIEPDY-IRQDGDAEEVIQEAIDTCPVDCIHWVDY 107
3 -16.200[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  11  42................RTFMPVIDESKCVKCYICWKFCPPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMVRE 103
4 -13.800[C] COG1146 Ferredoxin  ali follow..  12  33..............KEIEWYPTIDYDKCVTCGICFVTCGDFDKKEGKVIVARPYNCMVACQTCMNLCPTGAISFPDA 99
5 -13.400[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  111.....................VIDENNCIGCTKCIQACPDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISLQPV 167
6 -10.600[C] COG1145 Ferredoxin  ali follow..  15  273...........NTIAHSSYLATVDTSRCIACGICMLRCPAIKAKINREPASVDAEKCLGCGVCVPTCPMEAIELVER 340
7 -10.400[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  14  84............MHKREDGFVVVDEDVCIGCRYCHMACPPQYNAEKGHMTKYSRVAEGKQPICVESCPLRALEFGP. 154
8 -10.000[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  113......................SGEERCIACKLCEAICPQAITIEAEERADGSRRTTRYDIDCQEACPVDAIVEGPN 177
9 -9.450[C] COG1034 NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G)  ali follow..  16  126..SFRRYRFTKRTHRNQDLGISHEMNRCIACYRCVRYYKDYADGTDLGVYGAHDNESEFSGNLVEICPTGVFT.... 209
10 -9.340[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  14  58.......................GEERCVACNLCAVACPGCISLQKAETEDGRWYPEFFRINCEEACPTTAIQLTPD 121
11 -9.290[C] COG2440 Ferredoxin-like protein  ali follow..  11  8LRVEEKLYQNRYLVDPGRPHIKVRPHERPSANLLTHICPKCYELNDKGQVETTSDGCMECGTCRVLCEASG...... 81

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24