current user: public

If you have questions about the server, please let us know.

Query: [H] KOG1370 S-adenosylhomocysteine hydrolase, from VFDB

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MSDKLPYKVAAWGRKALDIAENKMPGLMRIWERYSASKPLNGARIPGCLHRTVETAVLMSLITLGTEVQWSSCNIFSTQDHAAAAIAKAGISASTGIPVLPLPRLACLEGRNRRGVPVTGDLTNLIHSEYSQLLLSFRGISKETTIGVHNLYKMMVNGILKVPAIDVNDSATKSKFDNLYGCGIKQATDVMIAGKVAVVAGYGDKGKSCAQALRGFRASVIITKTDPIKALQAAMEGYEVTTMDEACQEGDVFVTTTGCVDIILGQHFEQTKDDTIVCNTGYFDVEMDVKWLNKNTVEKVNVKLQVDPYRLKNGRGIILLAEGRLVNLACAMGHPSFVRSNSFTSQVMAQIKLWTHPDKYPVGVHFLPKKLDESVAEAHLGKLNMKLTKLTEKQAQYLGMSCYCPFKPDHYRYLast
1 -107.000[H] KOG1370 S-adenosylhomocysteine hydrolase  ali follow..  100  1MSDKLPYKVAAWGRKALDIAENKMPGLMRIWERYSASKPLNGARIPGCLHRTVETAVLMSLITLGTEVQWSSCNIFSTQDHAAAAIAKAGISASTGIPVLPLPRLACLEGRNRRGVPVTGDLTNLIHSEYSQLLLSFRGISKETTIGVHNLYKMMVNGILKVPAIDVNDSATKSKFDNLYGCGIKQATDVMIAGKVAVVAGYGDKGKSCAQALRGFRASVIITKTDPIKALQAAMEGYEVTTMDEACQEGDVFVTTTGCVDIILGQHFEQTKDDTIVCNTGYFDVEMDVKWLNKNTVEKVNVKLQVDPYRLKNGRGIILLAEGRLVNLACAMGHPSFVRSNSFTSQVMAQIKLWTHPDKYPVGVHFLPKKLDESVAEAHLGKLNMKLTKLTEKQAQYLGMSCYCPFKPDHYRY 413
2 -92.200[H] COG0499 S-adenosylhomocysteine hydrolase  ali follow..  43  7.FKVADLSLAEAGRHQIRLAEYEMPGLMQLRKEFADEQPLKGARIAGSIHMTVQTAVLIETLTALGAEVWASCNIFSTQDEAAAAIVVAGVPVFAWKGESLEEYWWCINQEYIAFLGMLREVLAAEPGKWGKIAEAVKGVTEETTTGVHRLYHFAEEGVLPFPAMNVNDAVTKSKFDNKYGTRINRATDMLMGGKNVLVCGYGDVGKGCAEAFDGQGARVKVTEADPINALQALMDGYSVVTVDEAIEDADIVITATGNKDIISFEQMLKMKDHALLGNIGHFDNEIDMHSLLHDDVTRTTIKPQVDEFTFSTGRSIIVLSEGRLLNLGNATGHPSFVMSNSFADQTIAQIELFQNEGQYENEVYRLPKVLDEKVARIHVEALGGQLTELTKEQAEYIGVDVAGPFKPEHYRY 478
3 -12.900[HE] COG0111 Phosphoglycerate dehydrogenase and related dehydrogenases  ali follow..  12  34.................................................................................VSDSIDQVGIDILKQVAQVDVKTGLSEAEIIDIVPEYDAIMLRSATKVTEKIIQA-LKIIGRAGVGVDNI-DVPAATRQGIVVVNSPEGNTIAAAEHALAMMMALAIGTEVYKKTLGVVGLGKIGSHVAGVAKAMGMKLLAYDP--ISQERADQIGCTLVDLDLLFSEADFITLTPETANLINAETLAKMKPTARIINCSRGGI-IDEEALVTAIETAQIGGAALDVFAQEPLGESRLREFSNVIHLGASTEEAQVNVAVDVAEQIRDV--LLGLPARSAVNIPGLTPDVMEKLR-KLAETLGTLVGQLAGGRIDRLTVCLQGDL....... 384
4 -12.600[CHR] COG1052 Lactate dehydrogenase and related dehydrogenases  ali follow..  15  22......................................................................................SHPGVVVDTYEEPLTAKNKELLKGYEGLVVMQFLAMEDEVYD---YMGACKLKVLSTRTAGFDMY-NATLLKKHGIRLTNVPSYSPNAIGEYALAAALQLTLSKELRCSRVGILGTGRIGQAAARLFKGVGAQVVGFDPYPNDAAKE---WLTYVSMDELLSTSDVISLTKDSHHLINAKTIAQMKDGVYLVNTARGAV-IDSQALLDSLDKGKIAGAALDAYE....................................................................................................... 262
5 -12.100[K] KOG0067 Transcription factor CtBP  ali follow..  12  45...............................................................................TVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALR-----VIVRIGSGYDNV-DIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLNEHNHHLINDFTIKQMRQGAFLVNAARGGL-VDEKALAQA---------------LKEGR------RGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAIT---SLRNCVNKEFFVTSAPWSVIDQHPELNGATYRY 387
6 -11.400[EH] COG0059 Ketol-acid reductoisomerase  ali follow..  11  7...................................................................................................................................................................TLNLRQKLDQLGRCRFMDREEFADEANFLKGKKIVIVGCGAQGLNQGLNMRDSGLDISYAAEKRASFQRATENGFKVGTYEELIPTADLVVNLTPDKSKVVADVMPLMKKDSAFGYSHG----FNIVEVGEEIRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAAT.............................................................. 198
7 -10.400[E] KOG0068 D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily  ali follow..  12  87.................................................................................VTEKLGEAGVNLLREFGDVDCSYDLSPEDLKKKVAESDALIVRSGTKVTREVFEAAKGVVGRAGVGIDNV-DLQAATEHGCLVVNAPTANTVAAAEHGIALLASMAVGVSLVGKTLAVMGFGKVGTEVARRAKGLGMTVISHDP--APADRARALGVDLVSFDQAISTADFVSLTPATKKVFNDETFSKMKKGVRLINVARGGV-IDEDALVRALDAGIVAQAALDVFC-PPSKDSRLIQHENVTHLGASTKEAQEGVAIEIAEAVAGA--LKGELSATAVNAPMVAPEVLSELT-VLAEKLGRLAVQLASGGKGVQSI............. 433
8 -9.990[C] KOG0069 Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily)  ali follow..  15  2....................................CRKSRGAKSPVNNDVVDLAVGSSRRFHKAFKVLISHPNVPAPALELLRSRGAETIICQSVPPSRDEILQKVPGLRCVSTMSSGIDFVDIPEFQKR-------GIPLGHTPGVVKNAVADLAIGLMIAAGHFHAGRTEIERSQWKIEQINWMMGQEIRDSVIGFFGFGGISQAIAKRLQCWDVAKIIYHTRTRKENDGDF-KAEHVSFEQLLQESDFLVVAAETREKFNGKAFNLMKRSSVFVNVARGGLDV.............................................................................................................................. 249
9 -9.270[R] COG2085 Predicted dinucleotide-binding enzymes  ali follow..  17  1.............................................................................................................................................................................................MSHTKPSIAILGAGRVGSSLARSAVAAGYEVKVAGSGAVDKIALTAEGAVPSTADQAVKDADIVFLAVPLHKF--RSVNPATLEGKIVIDTMN................................................................................................................................... 95
10 -8.570[C] COG0281 Malic enzyme  ali follow..  7.....................................................QAALDFHEFPIPGKIEVTPTKSLATQRDLALAYSPGVAEPCLEEKDPAASYKYTARGNLVAVISNGTAVL-EVNEHDPDKLVDIIASLEPTFGGVN-LEDIKAPECFYIEQKLRERMNIPVFHDDQHGTAIIRIVGKKIEDVRLVASGAGAASIACLNLLLSLGMNITVCDSKGVTKKEYAIEDNGWRKLADAI-PNADIFLGCSAAGALTQDMVKSMAAHPIILALANPNPEITPPEAKAVRPDAIVCTGRSDYPNQVNNVLCFLDVGATTINEEMKRAAVYAIADLALEEQNEVVTSAYGGEGATFGADYVIPRPFDPRLIAVAKAAMESGVATRPIQNWDAYVEKLTQFYKTSL... 429

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.