current user: public

If you have questions about the server, please let us know.

Query: [F] COG0015 Adenylosuccinate lyase, from VFDB

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MIERYTLPEMGKIWTDTYKLQTWLDVEIAVCEAQAELGYIPQAAVDEIKAKAKFDPQRVLEIEAEVRHDVIAFLTNVNEYVGDAGRYIHLGLTSSDVLDTALALQLVASLDLILEQLEKLIQAIRYQAQQHRYTVMVGRSHGIHAEPITFGFKLAGWLAEVLRNRDRLVRVAQSIAVGKISGAVGTYANIDPKVEAIACQKLGLEPDTASTQVISRDRHAEYVQQLALLAASLERFAVEIRNLQRTDVLEVEEYFSKGQKGSSAMPHKRNPIRSERLTGMARLVRGHAVAALENVALWHERDISHSSVERVAFPDCCILTHFMLKETTDLVKNLLVYPENMKRNMNVYGGVIFSQKVLLALVEKGMNREDAYRVVQGSAHQAWNTEGGNFEELVRADAQVTALLSAEEIDQCFDPQQHLTNLAEIYSRLDILast
1 -114.000IDP04633 gene: purB; adenylosuccinate lyase [Francisella tularensis subsp. tularensis SCHU S4] FTT0015 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  38  1MIKRYDVAEISKIWADENKYAKMLEVELAILEALED-RMVPKGTAAEIRARAQIRPERVDEIEKVTKHDIIAFCTSIAEQFAETGKFFHFGVTSSDIIDSALSLQIRDSMSYVIKDLEALCDSLLTKAEETKEIITMGRSHGMFAEPMSFGQKFLGAYVEFKRRLKDLKDFQKDGLTVQFSGAVGNYCILTTEDEKKAADILGLPVEEVSTQVIPRDRIAKLISIHGLIASAIERLAVEIRHLHRSDVFEVYEGFSKGQKGSSTMPHKKNPISTENLTGMARMLRSHVSIALENCVLWHERDISHSSAERFYLPDNFGIMVYALRRMKNTIDNLVVQRDIIEDRVRSTSAYLSSFYLHFLVANTPFMREDCYKIVQQVAFDLKQGESFSKKLQKVMHDEHNIILDIPEMDFEGIKKTYLKEIDHVFDRS.. 429
2 -112.000IDP04255 gene: purB; adenylosuccinate lyase [Clostridium perfringens ATCC 13124] CPF_1922 [Clostridium perfringens ATCC 13124]  ali follow..  24  9LNSRYASKEMSYIFSDDMKFSTWRKLWVALAEGEKELGLNITDEQIEELKSHDINYEEAIKKEKEVRHDVMSHVYAYGLQCPSAKGIIHLGATSCYVGDNTDVIIMRDALLLIKKKIVAVLNNLKRFALEYKDMPTLGFTHFQPAQLTTVGKRATLWMQDLVMDMENIDFLLSTLKLRGVKGTTGTQASFMNLFEEKVKALDKIVAEGVTGQTYPRKLDSIILNTLSEIAQSAYKFSNDLRLLQSMK--EIEEPFEKNQIGSSAMAYKRNPMRSERMGALARYVIVDALNPATASTQWFERTLDDSANKRIAVAEAFLALDGVLNLYINIAENMVVYDKVIEAHVNQELPFMATENIMMESVKKGGDRQELHERIRVHSMDAAQRVGLNNDLIERIINDPSFNLSKEEIIAIIDPVKFVGRAPSQVVEF.. 452
3 -96.400IDP04429 gene: argH-2; argininosuccinate lyase [Bacillus anthracis str. `Ames Ancestor`] GBAA4879 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  17  13.AEAWVEEFGASISFDQQLVNQDINGSIAHVTMLAKQGIVTKEEAEKIKIGLQYLLEEAKQNKSVEAEDIHLNIEKLMEKIGEVGGKLHTGRSRNDQVATDMHLYLKEKVEHIIKAIKQLQTVLVHQAENNIETIMPGYTHLQRAQPISFAHHILAYFWMLERDVNRYEDSLKRINISPLGAGALAGTTFPID-REYSAELLGFNGIYENDAVSDRDFILEFLSNSSMLMMHLSRFCEELILWSSQEFQFIEMS-DQYATGSSIMPQKKNPDMAELIRGKTGRVYGNLFSLLTVMKGLPLAYNKDLQEDKEGMFDTVKTVEGCLHIMAGMLETMTVNKEKMGQAV--TQDFSNATEIADYLANKGLPFRQAHEIVGKLVLHCTQ-KGIYLIDVPLATYKEMSALFEEDLYEVLSPYAAVGTGFEQIEKA.. 448
4 -88.400IDP00537 gene: argH; argininosuccinate lyase YPO3924 [Yersinia pestis CO92]  ali follow..  17  6..GRFSQAANDSLRFDYRLAEQDIIGSVAWSKALVTVGVLNADEQQQLEQALSVLLEEVQANPHAILEDIHSWVETLIDKVGDLGKKLHTGRSRNDQVATDLKLWCKFQITELQTAVQQLQQALVMTAEANQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLSRDESRLQDTLKRLDVSPLGCGALAGTAYAID-REQLAGWLGFASATRNDSVSDRDHVLELLSDASIGMVHLSRFAEDLIFFNSGEAAFV-DLSDRVTSGSSLMPQKKNPDALELIRGKCGRVQGALTGMTMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLHMAALVLDGIQVKRPRCKEAAE--QGYANATELADYLVAKGVPFREAHHIVGEAVVEAIR-QGKALEALALSDLQQFSSVIGDDVYPILALQSCLGVSPQQVASA.. 448
5 -86.900IDP92060 adenylosuccinate lyase, putative [Toxoplasma gondii ME49] TGME49_063190 [Toxoplasma gondii ME49]  ali follow..  18  48LVQKRAFVMSEWLACLATNARVQRQSAADASESPAPFPSLSEEGKAALRQMGRFDVRRVKEVEKTANHDLKAVEYVLKGKLMPLAALTHFGCTSEDVNNLSWALCFKEATEHLLPAVDDLAASLHMRAVEFAEVPMLSLTHGQPATPSTFGKEIANFEWRVKNAIKRVRDVEFRGKYNGAVGCFNALVVADAEVARDFVESLGLTYQPYSTQIEQHDWIAELCDALARLNSILLDFSRDMWLYISRDVLKLRVV--AGEVGSSTMPHKVNPIDFENAEGNLELANALLRFLSTKLPVSRMQRDLSDSTVLRNVGVAFGHCLVAYESAKKGLDRVDVNSEKMLKELDEN-WAVLGEPVQTLL--RKRGVRNAYEKLKSATRGQDI-DKERMQDIVETCSKDLL-PEDLEILRSLTPATYTGLAPELAKKV.. 484
6 -86.500IDP90621 gene: argH; argininosuccinate lyase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0931c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  16  8..GRFSGASNASLNVDKTLFNEDIQGSIAHATMLESCGILKKEELDAIIKGLEQVRSEIEQGDIKDEDIHMAVEKRLSEIIGEIGGRLHTARSRNDQVATDFKLFVKKSHIELIKLLKELIQTMLEHAKVHKKTIMPSFTHLQHAQPVSFSFYILAYAFMLMRDIKRLQNSLELADFSPLGSCACAGTSYAIN-RELSAKILGFKDIMPNDGVSDRDFALDLLYDIAVIFTHTSRLCEEMILFSSSEFSFITIS-DSFSTGSSIMPQKKNPDVCELIRGKTGRVYGNLISLLTIMKALPLAYNKDMQEDKEGIFDSVKTAKDSLIILNAMLKEIQINKENMLNACKKGHLLATDLADYLVR-EKNIPFRKAHFIVGNVVAQAEA-QGIDISEI--KDLSKIDPVFDEKAMELLNFEFSLSSSIASVEKQ.. 449
7 -80.200IDP02396 gene: argH-1; argininosuccinate lyase [Bacillus anthracis str. `Ames Ancestor`] GBAA3604 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  19..KTYVDCVLQHVFDRNYLLKDMFQVHKAHIVMLTEENLMKKEEAKFILHALKEIPEEQLLYTEQHEDLFFLVEHLISQEAKDFVSNMHIGRSRNDMGVTMYRMSLRRYVLRLMEHHLLLQESILQLAADHKETIMPAYTHTQPAQPTTFGHYTLAIYDTMQRDLERMKKTYKLLNQSPMGAAALSTTSFPIK-RERVADLLGFTNVIENDAVAGADYLLEVSSLLMIMMTNTSRWIHDFLLLATKEYDGIAVA-RPYVQISSIMPQKRNPVSIEHARAITSSAPGEAFTVFQMIHNTPFGEIVDEDDLQPYLYKGIEKAIRVFCILNAVIRTMKVEEDTLKRRSYK--HAITITDFADVLTNYGIPFRHAHHAASVIANMSLE-QKKELHELCFKDVNFKIQLLEKEWEEIISPEAFIGPSKKEMERM.. 463
8 -55.400IDP02169 gene: fumC; fumarate hydratase [Francisella tularensis subsp. tularensis SCHU S4] FTT0306 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  17  28.IEHFS---IGSDLMPIEVIKALAIIKKAAAITNHQLGILARTKKEIIIKVADEIIAGELDEHTQSNMNVNEVINRAIELLGHPNDDVNMSQSSNDTFPSAMYIATALEINRLLPALEYMQQQLADKAKQWDDIVKIGRTHMQDAVPLTLGQEFSGYAALLENNIQRIKDTLKYVYQLALGGTANAPDGFAEITAKYIATITSLAFVSATNVQGSHDALVAVMGQLKTLANSLFKIANDIRLLSCGPRAGFHELLPENEPGSSIMPGKVNPTQCEAMAMVAAQVIGYDVAVGIGGSAGYLEMNVYKPLIIFNIIQSIKIISDSCVNFTKLLEGMKPNHDKIEFYLKNSLMLVTA-------LSPVIGYDKAAKLAHYAE-----QKNISLAEANQE----LKFLSKEEFDKVVDPYKMTKGG......... 461
9 -52.500IDP02640 gene: aspA; aspartate ammonia-lyase [Bacillus anthracis str. `Ames Ancestor`] GBAA0609 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  17  59..........ALANMDTGYLAKDIGHEIAEAAQEIVDGKFHDQFIVDPIQGGAGTSINMNTNEVIANRALERMGYEKGEAKISPNTHVNMAQSTNDAFPTGIHIATLMRLEELLITMEELHAAFRAKAKEFDHVIKMGRTHLQDAVPIRLGQEFEAYSRVLARDIKRIKQSRQHLYEVNMGAAVGTGLNANPTYIEQLRTFSGFPLVGAEHATQNTDAYTEVSAALKVCMMNMSKIANDLRIMASGPRVGLAEIQPARQPGSSIMPGKVNPVMAEVINQVAFQVIGNDHTICLASEAGQLELNVMEPVLVFNLIQSISIMNNGFRVFRECIKGITANEELLKQYVEKS-----------VGIITAVNPHIGYEAASRIAREAIE-TGKSVRELCLEH----GVLTEEELDIILDPFEMTHP.......... 464
10 -51.900IDP02192 gene: aspA; aspartate ammonia-lyase [Yersinia pestis CO92] YPO0348 [Yersinia pestis CO92]  ali follow..  14  39..........SKISDVPEFVRGMVMVKKAAAMANKELHTIPRKIADIIIQACDEVLDKMNTNEVLANIGLELMGHQGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYASILKLIDAINQLGEGFGRKSKEFEKILKMGRTQLQDAVPMTLGQEFRAFQVLLNEETKNLQRTAELLLEVNLGATANTPEGYSQLAVQKLAEISGLACVPAEDATSDCGAYVMVHSALKRLAVKMSKICNDLRLLSSGPRTGLNEILPELQAGSSIMPAKVNPVIPEVVNQVCFKVIGNDTCITMAAEAGQLQLNLMEPVIGQAMFESIHILTNACYNLLECINGITANKEVCERYVF--NSIGIVTYLNPFIGHNGDIVGKICAETGKNVREVVLERGL---------------LTEAELDDIFSVENLMH........... 464

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.