current user: public

If you have questions about the server, please let us know.

Query: [E] COG0334 Glutamate dehydrogenase/leucine dehydrogenase, from VFDB

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MTENNNLVTSTQGIIKEALHKLGFDEGMYDLIKEPLRMLQVRIPVRMDDGTVKTFTGYRAQHNDAVGPTKGGVRFHPDVDEEEVKALSMWMTLKCGIVNLPYGGGKGGIVCDPRQMSIHEVERLSRGYVRAISQFVGPNKDIPAPDVFTNSQIMAWMMDEYSALDKFNSPGFITGKPIVLGGSHGRDRSTALGVVIAIEQAAKRRNMQIEGAKVVIQGFGNAGSFLAKFLYDLGAKIVGISDAYGALHDPNGLDIDYLLDRRDSFGTVTNLFEETISNKELFELDCDILVPAAISNQITEDNAHDIKASIVVEAANGPTTPEATRILTERGILLVPDVLASAGGVTVSYFEWVQNNQGYYWSEEEVNEKLREKLEAAFDTIYELSQNRKIDMRLAAYIIGIKRTAEAARYRGWALast
1 -117.000IDP02649 putative glutamic dehyrogenase-like protein [Salmonella typhimurium LT2] STM1795 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  45  26.DSSTSAWNTYLQQIERVAPYLGELSPWVDTLRHPKRALIVDIPVQMDDGTIRHFEGYRVQHNLSRGPGKGGVRYHPDVDLNEVMALSAWMTIKCAALNLPYGGAKGGIRVDPFSLSEGELERLTRRYTSEIGIIIGPQKDIPAPDVGTNGKVMAWMMDTYSMNHGTTVTGVVTGKPIHLGGSLGREKATGRGVFVSGLEAARRANIAVEGARVAVQGFGNVGSEAARLFAGAGARVVAIQDHTATLFNATGIDMKALTAWQTEHKQIAGFGAETIASDAFWRLEMDILIPAALEGQITRQRAEALTCKLVLEGANGPTYPDADDVLASRGILVVPDVVCNAGGVTVSYFEWVQDMASFFWSEEEINARMDKIMTDAIVHVWEKAAEKSCSLRTAAYIVACERILLARKDRGI. 438
2 -111.000IDP02337 gene: gdhA; glutamate dehydrogenase [Bacillus anthracis str. `Ames Ancestor`] GBAA1511 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  76  15REQHFELLNSTQIVISEALEKLGYPNEVYELLKEPIRMMTVKIPVRMDDGTVKIFTGYRAQHNDAVGPTKGGIRFHPNVTENEVKALSIWMSLKCGIVDLPYGGGKGGIICDPREMSFRELERLSRGYVRAISQIVGPTKDIPAPDVFTNSQIMAWMMDEYSRIDEFNSPGFITGKPLVLGGSHGRETATAKGVTICIREAAKKRDIDIKGARVVVQGFGNAGSFLAKFMHDAGAKVIAISDAYGALHDPNGLDIDYLLDRRDSFGTVTKLFNNTISNKELLELDCDILVPAAIENQITEENANDIKAKIVVEAANGPTTLEATKILTDRGILLVPDVLASAGGVTVSYFEWVQNNQGYYWTEEEVEQRLEKVMVRSFDSIYETAQVRKVNMRLAAYMVGVRKMAEASRFRGW. 427
3 -103.000IDP92108 NADP-specific glutamate dehydrogenase, putative [Toxoplasma gondii ME49] TGME49_093180 [Toxoplasma gondii ME49]  ali follow..  30  57.RFQPEFLQAFHEVFDSVRPVLCSNPRAFKVIVEPERCITFRVPWVDDQGKQHVSRGYRVQYSSAAGPYKGGLRFHPSVTLSVMKFLGFEQIFKNSLTGLSIGGAKGGSDFDPKGRSDNEVMRFCQAFMTELSRYIGPNRDVPAGDIGVGAREIGYLFGQYKLLKAGQFEGALTGKDKNWGGSAMRPEATGYGCVYFVLELLKAQKEGIKGMRCAISGSGNVALYAGEKLATLGAKVMTFSDSSGYIVNEKGFPLGQIQRLKEMKETRSSTTVKFVPDKRAWEVPCDIAFPCATQNEISEEDAQLLGCRIVAEGANMPTTRDAIRLFKQHGVILCPGKAANAGGVAVSGLEMSQNAMRIEWTREVVDEKLRQIMASIFSKCRSYAAKNEFDLVTGANVAGFVKVADCVIDQGY. 488
4 -34.800IDP91367 NAD-specific glutamate dehydrogenase [Vibrio vulnificus CMCP6] VV1_2638 [Vibrio vulnificus CMCP6]  ali follow..  16  1...................................................................................MLGLVKAQQVKNTV--IVPVGAKGGFVCKRQHTMTAEGQRCYKRFIRALLDVSDNIIEVVAADKGT-ATFSDLANSVSAEYNFWLGDAFASGGSN--GYDHKAMGITAKGGWESVKRHFREMGIDCQTTDFTAIGVGDMAGDVFGMLLSKHIRLQAAFNHLHIFIDPNPDSASSWEERDRPRSSWEDYNPKLISKDLLWNGGIGTYVKASSENDVLRIDGRDLNAKVVGEGGNLGMTQKGRIEYALKGGRVNTDFVDNVGGVDCSDNEVNIKISNGDMTVKQRNKILESMQDEVGDIVLDDAYRQSESISVTEQVKEQIRFIHTMEKAG.. 418
5 -7.720IDP02524 gene: ilvC-2; ketol-acid reductoisomerase [Bacillus anthracis str. `Ames Ancestor`] GBAA1852 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  10  14................................................................................................................................................................................................................LQGKTVAVIGYGSQGHAQAQNLRDSGVEVVVRPGKSFEVAKADGFEVMSVSEAVRT---------------------AQVVQMLQQAHVYKAEVEENLREGQMLLFSHGPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTALHVALAYAKGVGCTRAGVIETTFQEETETDLFGEQGGVTALVKAGFETLTEGG.. 216
6 -7.660IDP02330 gene: ilvC-1; ketol-acid reductoisomerase [Bacillus anthracis str. `Ames Ancestor`] GBAA1419 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  12  15................................................................................................................................................................................................................LKEKKVAIIGYGSQGHAHAQNLRDNGFDVVVGLRKGKSWDKEDGFSVYTVAEAAKQ---------------------ADVVMILLQPEVYEEEIAPNLQAGNSLVFAHGFNVHFDQVKPPVN-FLVAPRTFSEGGAVPALFAVYQDATGVATEKALSYADGIGATRAGVLETTFKEETETDLFGEQGGVTALVKAGFETLVDAG.. 217
7 -7.280IDP00643 precorrin-2 dehydrogenase SACOL2638 [Staphylococcus aureus subsp. aureus COL]  ali follow..  13  8...............................................................................................................................................................................................................DLTNKNVVIVGGGVVASRRAQTLNQYVEHMTVISPT----------KLQNMVDNGVVIWKEKEFEPSDIV-------DAYLVIAATNEPRVNEAVKKALPEHALFNNVGDA----------SNGNVVFPSAL-HRDKLTIS----VSTDGASPKLTKSIMAELEALYPPSYSSYIDFLYTCRQKIKVLDITYNEKQ........... 174
8 -7.260IDP02833 gene: aroE; shikimate 5-dehydrogenase [Bacillus anthracis str. `Ames Ancestor`] GBAA4561 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  1..........................................................................................MKQLYGVIGNPIGHSLSPVMHNAFLVKEEVLGEAVRGL--KALGISGFNVTTP------KVAIMDYLDEIDPLAKQIGAVNTVVHKDGKLIGY--NTDGIGF-----VRALQSISSEPLQEKRILLLGAGGASRAIYFSLADAGVKEIDVANR----------TVDKAKELIAACTATVHSVALSLEKATKEQGNYDIIIQTTTIGMHPRVEHTPLQISIVSDIIYNPFETKILCEAKEQGAIIQNGIDMFVYQGALAFEMWTGCVPNIERMKQLVIRNLEANIYVNRKTKKIFTCTSTSFNTNFSSRKRRSK........... 308
9 -7.170IDP91958 Trk family potassium uptake protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100004562 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  1................................................................................................................................................................................................................MSDRTIGILGLGIFGSSVLAALAKQDMNIIAIDDHAERINQFEPVLARGVIGDITDEELLRSAGID----------TCDTVVVATGENLLAVMHCKSLGVPTVIAKVK---SQTAKKVLEKIGAVISPEYEMGQ--LFHNSVDVFQLDKNVSIVEMKIPQSWAG----------QSLSKLDLRGKYNLNILGFRE........... 182
10 -6.970IDP00666 TrkA potassium uptake family protein SACOL1096 [Staphylococcus aureus subsp. aureus COL]  ali follow..  16  2..................................................................................................................................................................................................................GKEYVVIGLGRFGGSIVRELNALDMDVMAIDHDENRVNEYSDIATHAVVADTTDEAVMKSLGIR----------NFDHVIVAIGENILTTLILKELGVKKVTAKAQ---NDYHAKILNKIGAVVHPERDMGR--ASASVLDYLELADEHSIVELKATEKMAG----------QSIIDLDIRAQYGINIIAIKR........... 181

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.