current user: public

If you have questions about the server, please let us know.

Query: [ET] COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain, from VFDB

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MKKLVLSLSLVLAFSSATAAFAAIPQNIRIGTDPTYAPFESKNSQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGGLast
1 -105.000IDP01430 amino acid ABC transporter, periplasmic amino acid-binding protein VC1863 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  37  1MDKKWLVATALIATTISGVTQAKEWKTVRFGIEGAYPPFSWTEADGSLKGFDVDMANALCAEMQVECKIVPQDWDGIIPSLLARKYDAIIAAMSITEERKKKVDFTGKYAQIPNKFIAKKGADLAFTKEGLKGVKIGVQRATTHDKYITDNYGD-TVDIVRYGSFDEAYLDLANGRIAAVLGDASALEEGMLNKPGGDAYEFVGPSLTDPKWFGEGMGIAVRKQDKELTEKLDAAITALREKGIYQQIQAKYFKYDVYG. 259
2 -101.000IDP02749 amino acid ABC transporter, periplasmic amino acid-binding protein [Coxiella burnetii RSA 493] CBU_0482 [Coxiella burnetii RSA 493]  ali follow..  30  12FFRWIPAFVRMTGTFYFVSCLVFATDTIKFATEATYPPYVYMGPSGQVEGFGADIVKAVCKQMQAVCTISNQPWDSLIPSLKLGKFDALFGGMNITTARQKEVDFTDPYYTNSVSFIADKNTPLTLSKQGLKGKIIGVQGGTTFDSYLQDSFGN-SITIQRYPSEEDALMDLTSGRVDAVVGDTPLIKQWL-KQNGRREYVLIGKPVNDPNYFGKGVGIAVKKGNQALLLKLNKALAAIKANGVYAAIVQKYFGQE.... 269
3 -98.600IDP01901 gene: artI; arginine transport system [Salmonella typhimurium LT2] STM0890 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  37  1MKKVLIAALIAGF-----SLSATAAQTIRFATEASYPPFESMDANNKIVGFDVDLANALCKEIDASCTFTNQAFDSLIPSLKFRRFDAVMAGMDITPEREKQVLFTTPYYDNSALFVGQQGK--YTSVDQLKGKKVGVQNGTTHQKFIMDKHP--EITTVPYDSYQNAKLDLQNGRIDAVFGDTAVVTEWLKANPK---LAPVGDKVTDKDYFGTGLGIAVRQGNTELQQKFNTALEKVKKDGTYETIYNKWFQ...... 242
4 -98.400IDP00526 gene: artI; arginine-binding periplasmic protein 1 precursor YPO1351 [Yersinia pestis CO92]  ali follow..  36  1MKKLIIATVLASI-----SLSASAAETIRFAAEATYPPFEFIDANNKMQGFDIDLANALCKEMQADCTFTNQAFDSLIPSLKFKRFDAVISGMDITPERQKQVAFTQPYYDNSALFIAQKDK--VADLAALKGKRVGMQNGSTHQKYLMEKHP--EITAVPYDSYQNAILDLKNGRLDAVFGDTAVVNEWLKQNDQ---LAAVGDKVTDADYFGTGLGIAVRQSNTELQGKLDAALTKVKADGTYQTIYKKWFQ...... 242
5 -96.400IDP05139 amino acid ABC transporter, solute binding protein [Bacillus anthracis str. Sterne] BAS0353 [Bacillus anthracis str. Sterne]  ali follow..  31  1MKRKLLTIVASITLCTSFILGANGKKEFRYAMSGLYKPFNYKENDGKLVGFDVEIGEALAKKMNMKPTPITNPWETLIQGLKAKKYDVILGSMAITEERLKAVNFSNPYYRSGAQIFVAKKNTSISSPEDLKGKKIGVVKASTFKDLVAKH----TDQITEYDSDITALMDLEPGRIDAVITDQMVGLRMIKEGKSN--------KEAGKPLNLDEMGIAIRKDDKEMVEKVNKALDEIIKDGTYEKISKKWFGRNILG. 258
6 -93.600IDP01925 gene: fliY; cystine transporter subunit [Yersinia pestis CO92] YPO1846 [Yersinia pestis CO92]  ali follow..  25  6VRRRIVLGMVAVALATGLNVKSKQRGTLIVGLEGTYPPFSFQGEDGKLTGFEVDFANALAEHMGVKAKITPTKWDGMLASLESKRIDVAINQVTISDERKKKYDFSTPYTVSGIQVLTKKGNEGFTKPEDLQGKKVGVGLGSNYEQWLRENLK--DVDIRTYDDDPTKYQDLRVGRTDAILVDRLAALDLVKKTND-------ALAVAGPAFARQESGVAMRKNNPELLAAVNNAIAEMQKDGTLAKISEKYFGADVT.. 265
7 -93.200IDP00474 gene: glnH; glutamine ABC transporter periplasmic protein YPO2512 [Yersinia pestis CO92]  ali follow..  27  1MKSLVKVSLAALALAFAVSA-YAAEKELIVATDTAFVPFEFKQ-GDKYVGFDIDLWDAIAKKLDLKYTLKPMDFSGIIPALQTKNVDLALAGITITDERKKAVDFSDGYYNSGLLVMVKADNNDIKSEADLQGKVLAVKSGTGSVDYAKANI--KTKDLRQFPNIDNAYLELGTGRADAVLHDTPNILYFIKTAGNGQ-------KAVGESIKAQQYGVAFPQGS-DLREKVNAALKSLKEDGTYAEIYKKWFGVE.... 245
8 -92.700IDP91975 ABC transporter substrate-binding protein - glutamine transport [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100009843 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  26  1MKKWMLVLVSLMTALFLVACGKQSNKSITIGFDSTFVPMGFAQKDGSYAGFDIDLATAVFEKYGITVNWQPIDWDLKEAELTKGTIDLIWNGYSATDERREKVAFSNSYMKNEQVLVTKKSSG-ITTAKDMTGKTLGAQAGSSGYADFEANPEIANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVLNDYNVFT-----VGLETEAFAVGSRKEDTTLVKKINEAFSSLYKDGKFQEISQKWFGEDVA.. 270
9 -92.500IDP05446 hypothetical protein lmo1738 [Listeria monocytogenes EGD-e] lmo1738 [Listeria monocytogenes EGD-e]  ali follow..  25  1MKKGLLITVMLMVMLALGACSSKKDKEVVIGLDDSFVPMGFRDKDDNLVGFDIDLAKAVFAEYGIKAKFTPIDWTMKESELKNGSIDLIWNGYTVTDARKKQVAFSQPYMKNEQVLVTLKSSN-INQFSDMKNKTLGAQNGASSIDDMAKKPEVNNNEPELYDTFDTAFIDLNNKRIDGLIIDEVYARYYIDKQKNKDDYNIIT-----GGFDATDFAVGMRKSDKELQKKINEAFEKLYKEGKMQEISKKWFGDDEIA. 269
10 -92.000IDP01968 gene: fliY; cystine transporter subunit [Salmonella typhimurium LT2] STM1954 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  28  1MKLALLGRQALMGVMAVALVAGKERGTLLVGLEGTYPPFSFQGEDGKLTGFEVDFAEALAKHLGVKASLKPTKWDGMLASLDAKRIDVVINQVTISDVRKKKYDFSTPYTVSGIQALVKKGNEGIKTAADLQGKKVGVGLGTNYEEWLRQHV--QGVDIRTYDDDPTKYQDLRVGRIDAILVDRLAALDLVKKTKGT--------AVTGDAFSRQESGVALRKGNEDLLKAVDNAIAEMQKDGTLKALSEKWFGADV... 264
11 -91.900IDP05579 amino acid ABC transporter, amino acid-binding protein [Bacillus anthracis str. Ames] BA_0855 [Bacillus anthracis str. Ames]  ali follow..  27  1MKKLFSVLAVTTLAIGIVAGCGKQSGELVIGTEGTYPPFTFHDSSNKLTGFDVELAEEVAKRLGVKPVFKETQWDSLLAGLDAKRFDMVANEVGIREDRQKKYDFSKPYVSSSAALVIAKDKDKPATFADVKGLKGAQSLTSNYADIAKK----NGAEIIGVEGFSQAAELLASGRVDFTINDKLSVLNYLETKKDAK-------KIVDTEKEASESGFLFRKGSTKLVQEVDKALEDMKKDGTYDKITKKWFGENV... 263
12 -90.800IDP91402 ABC-type amino acid transport, signal transduction system [Vibrio vulnificus CMCP6] VV1_1001 [Vibrio vulnificus CMCP6]  ali follow..  27  1MNNWIKASIAAIALSVA-TFQAVAEEVVKVGMSGRYFPFTFVK-QDQLQGFEVDMWDEIGKRNGYKVEYVTANFSGLFGLLETGRIDTISNQITMTDARKAKYLFADPYVVDGAQITVRKGNDSIKGVADLAGKTVAVNLGSNFEQLLRDYDKD--GKINIKTYDTGIEHDVALGRADAFVMDRLSALELIKKT--GLPLQLAGEPFETI---ANAWPFVNNERGVKLQGEVNKALAEMRADGTVEQISIKWFGADI... 248
13 -90.600IDP01356 amino acid ABC transporter, periplasmic amino acid-binding portion VC0010 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  27  1MKHW---FNIALAALALSSATVQAATEVKVGMSGRYFPFTFVK-QDELQGFEVDVWNEIGKRNDYKVEFVTANFSGLLGLLETGRIDTISNQITITDARKAKYLFSDPYVIDGAQITVRKGNEAIKGIDDLAGKTVAVNLGSNFEQLLRNH--DKDGKINIKTYDTGIEHDVALGRADAFVMDRLSALELIEKT--GLPLQLAGSPFETI---ENAWPFVNNEKGQQLQGEVNKALAAMRADGTLSQIALKWFGTDIS.. 247
14 -88.900IDP04366 amino acid ABC transporter, amino acid-binding protein [Clostridium perfringens ATCC 13124] CPF_1531 [Clostridium perfringens ATCC 13124]  ali follow..  31  1MKKLLFLLISIVILSILISGTKKDSNTVIIGIDDTFVPMGFKNEKGDIVGFDVDLSKEAFKRMNLKVIFQPIDWSMKETELTNGNIDLIWNGYTMTHEREKKVAFTNSYLKNRQVIVTLSNSN-INTLNDLKGKTVTTQDGSSSLDTLFERPKLKNGEPVLFDSFNDCFMDLEAGRSDAVVCDEILAQYYIFKNDPSK-------HVLTEDLGEESYSIGLRK-NSNLIDHLNKTLEDMKEDGTIAKISNKWFGKDL... 260
15 -88.000IDP91967 amino acid ABC transporter, periplasmic amino acid-binding protein, putative [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100008960 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  24  4MKKVLMTMFGLVMLPLLFACSNKSKGKLVVALNPDFAPFEYQDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLAISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSDLAYQSVNDLAQKKVGAQKGSIQETMAKDLL--QNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPDLAIAD-----LNFEKEQDDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASI... 266
16 -87.900IDP05634 amino-acid ABC transporter,substrate-binding protein [Clostridium difficile 630] CD2174 [Peptoclostridium difficile 630]  ali follow..  20  7IKRNIIKCLVAVLSLTFVITGVKNEKVITVASSNSADPYSYVD-NGEHKGFEVDMWKEIGKRSGYKIKMEPTGFSSIFGMLDSGKVDVAANFFGMSKERLEKYDASIPYGSDSVCIAVKDGNNEINKLEDLKGKVVAVSEGSQGQQVATSVNKDNLFQEKVYGDGTSGLQDLDLGRVSAWIDAELTIVGDAKKANMK-------VRVLDKKLSATNIAYFFKKNDDKIKEDVNKAIEEMLADGTVKKISEKWFGMDVSA. 266
17 -87.800IDP05633 amino-acid ABC transporter,substrate-binding protein [Clostridium difficile 630] CD2177 [Peptoclostridium difficile 630]  ali follow..  26  1MKKLKLIIMFALVSALLVTGNKEEQKVIRVATSGTYYPFAFKD-KDKLKGFEVDFWDEFAKRTNCKVEWVLTDFSGLFGLLEADKADAVSAQLTATPEREKKYAFSDAYNYSGTNIIVREDDTSIKSIDDLVGKKVGVGTGAVANEILKEKYPNDEIKIVNYSTLKGNYQDLEMGRLDAVVAQDVEALIAIKEQKL-------NLKMIEPPIQFGACSFALQKNGEKWTKEINEVIEEMYKDGTLTKISENWLGKDIT.. 261
18 -87.100IDP05630 amino acid ABC transporter, substrate-binding protein [Clostridium difficile 630] CD1774 [Peptoclostridium difficile 630]  ali follow..  26  5LKKVGIFTIMLGLLGGVVGCSKESKKEVVVGFDNTFVPMGFLDEKGDTVGFDVDLAKETFKRLGMEVKFQPIDWSMKETELNSKTVDVLWNGYSITDERKKIVSYTEPYLQNKQIIVTLSDSK-INSKADLKDKEVGTQQGSTALDAVEKDKDFKGGAPVLYDTYDKALRDLEIGRTSAVVGDEVLIRYYMGQKGEDK-------KVLKDDFGLEDYVVATSKENPELCEKINETLKEMKKDGTFDKIYDKWF....... 266
19 -86.800IDP91966 ABC transporter substrate-binding protein - glutamine-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100001092 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  23  3SKKWIFVLCNFLASFFLVACQSKQKGKLVVATSPDYAPFEFVDGKNQVVGADIDMAQAIADELGVKLEILSMSFDNVLTSLQTGKADLAVAGISATDERKEVFDFSIPYYENKISFLVRKADVEYKDLTSLESANIAAQKGTVPESMVKEQLP--KAQLTSLTNMGEAVNELQAGKIDAVHMDEPVALSYAAKNAGLAVAT-----VSLKMKDGDANAVALRKNSDDLKEVVDKVIQKLKDEGTYQSYLEKAASLTEVE. 270
20 -84.900IDP91031 solute-binding periplasmic protein precursor for ABC transporter [Yersinia pestis KIM 10] y4125 [Yersinia pestis KIM10+]  ali follow..  21  1MKQDLSIKKSAIALTLLAGLATKQAGVVRIAVFDSNPPFGYIDQTKKLVGYDVDVANAIAKDLGVKVELRATNPANRIPLLASKKVDLIAANFTITDERAKEVNFSLPYFATGQKFIARKGV--LKTPEDIGKLRIGADKGTVQEITLREHYP--TAKVISYDDTPLAFTALRNGNVQAITQDDAKLVGLLGNIPEAQKADF---EISPFSITKEYQGVGIPKGEDRLTAVVNETLIKLEKEGDAVKIYDRWFGPET... 264
21 -83.600IDP04547 amino acid ABC transporter, amino acid-binding protein [Clostridium perfringens ATCC 13124] CPF_0581 [Clostridium perfringens ATCC 13124]  ali follow..  22  6FKKILSVAMIGGLTLSLAGCGAKESGKLVVGLSADYAPYEFKDGKDQIVGLDIDIAKEVAKNLGVDLEIKEMEFGAIIQSVKNGMIDMGISGITPDEKRKEAVDFSDIYYEAEQGILINKDNKEIKGIGDLKGKKVGAQMGSIQAEIAKGI---EGADVKLLDNVNTLILELKTGKLDAVITELPVAKIASEVNSE---LAVADEVIKNSE---GGSAIAIQKGNKDLVDEVNSTIKELKESGKIDQFTNDAIELVPYQ. 274
22 -82.700IDP01699 extracellular solute-binding protein [Yersinia pestis CO92] YPO3343 [Yersinia pestis CO92]  ali follow..  20  3MKKLSLGIMVLALISSQHVLAKKQSGELRIGVPGDYAPLAFHDKQGQLIGYDVDMANAFGEDLKLKVNFVSTSWPTLSDDLAADKFDIAMGGVTATPGREAQFALSHAVVKNGKIALTHCQKVNTLDAIDRQNVKVIVNPGGTNQSFVDANI--KQAQIIRTKDNVANLQGIRNKSADIMFTDLIEGDYYQSKEPGVFCVAT-----EVLAGTGSYKVYMMAKDNQPLLEEVNQWL----AGKTKTLLAQKWNISE.... 256
23 -82.500IDP05245 hypothetical protein lmo2349 [Listeria monocytogenes EGD-e] lmo2349 [Listeria monocytogenes EGD-e]  ali follow..  23  1MKKKYGILALALTAALTLSAANQKVQTITVGTGTQFPNVCFLDENGKLTGYDVELVKEIDKRLGYKFKFKTMDFSNLLVSLGAGKVDIVAHQMEKSKEREKKFLFNDVAYNNFPLLTVLDSNNSINSTKDLAGKRVITSATSNGALVLKKINEEQGNNAYEGQGSNDTANQLKTGRADATISTPFAVDFQNKTSAIK-------EKVVGDVLSNAKVYFMLGKDETKLSKKVDEALQSIIDDGTLKKLSEKWLGADYS.. 265
24 -81.900IDP91962 amino acid ABC transporter, amino acid-binding protein, putative [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007760 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  20  1MKKFSLLLAILPFLVACGNQATSAQKTIVLATAGDVPPFDYED-KGNLTGFDIEVLKAVDEKLSYEIQFQRTAWESIFPGLDSGHYQAAANNLSYTKERAEKYLYSLPISNNPLVLVSNKKNP-LTSLDQIAGKTTQEDTGTSNAQFINNWNQKPATINFSGEDIGKRILDLANGEFDFLVFDKVSVQKIIKDRGLDL------SVVDLPSADSPSNYIIFSSDQKEFKEQFDKALKELYQDGTLEKLSNTYLGGSYL.. 259
25 -80.400IDP91990 ABC transporter substrate-binding protein - unknown substrate [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100004332 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  20  4FKPLLTVLALAFALIFITACSSKKSGELRIAVFGDKKPFGYVDNDGSYQGYDIELGNQLAQDLGVKVKYISVDAANRAEYLISNKVDITLANFTVTDERKKQVDFALPYMKVSLGVVSPKTGL-ITDVKQLEGKTLIVTKGTTAETYFEKNHP--EIKLQKYDQYSDSYQALLDGRGDAFSTDNTEVLAWALENKGFE-------VGITSLGDPDTIAAAVQKGNQELLDFINKDIEKLGKENFFHKAYEKTLHPTY... 271
26 -80.000IDP91961 ABC transporter substrate-binding protein - amino acid transport [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005438 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  22  1MKKIVKYSSLAALGLVAAGGEAASKKEIIVATNGSPRPFIY-EENGELTGYEIEVVRAIFKDSDYDVKFEKTEWSGVFAGLDADRYNMAVNNLSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQLEAYNAEHTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDN------KVIELPSDQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYL.. 269
27 -78.800IDP91891 putative glutamine-binding protein precursor [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007700 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  22  1MISLFGLAAAKPVQADTSIADIQKRGELVVGVKQDVPNFGYKDPTGTYSGIETDLAKMVADELKVKIRYVPVTAQTRGPLLDNEQVDMDIATFTITDERKKLYNFTSPYYTDASGFLVNKSAK-IKKIEDLNSKTIGVAQGSITQCLITELGKKKTFKFVELGSYPELITSLHAHRIDAFSVDRSILSGYTSKRTE----------LLDDSFKPSDYGIVTKKSNTELNDYLDNLVTKWSKDGSLQKLYDRYKLKPS... 249
28 -76.300IDP06533 extracellular solute-binding protein, family 3 [Enterococcus faecium DO] EAN09753 [Enterococcus faecium DO]  ali follow..  26  4LKKIRLIFLLGIAFLALAGCKGKSTNEIIWGVKYDTRLFGMMDESRTVQGFDVDIAKAITKKINGKTEFVEVTSKTRIPLLKNGNIDAIIATMTITDERKKQVDFSDVYFDAGQALLVKKGSQ-IKSVDDLNASTVLAVKGSTSAANIRQHAP--DAKILELENYAEAFTALQSGQGDAMTTDNAILLGIADENPE---------ELVGGTFTNEPYGIAINKGQENFLKAVNQALEEMHADGTYDKIYQKWFPNET... 266
29 -75.300IDP02641 amino acid ABC transporter amino acid-binding protein [Bacillus anthracis str. `Ames Ancestor`] GBAA0640 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  4MKKLFTLIVFSCLFVLVVAGCGKKRGKLVVGVKNDTNLFGLKNSTGQVEGFDVDVAKALAKKILKKLELKEVTSKTRIPLLKNGDIDAIIATMTITEERKKEVDFSDVYFKAGQSLLVKKGSDIKSIDDVKKGVKVLAVKGSTSTNNIRQKSP--EATVLEFENYSEAFTALKAGKGDVLTTDNAILYGMAKQDSN--------YEVVGKIFTDEPYGIAVQKGADDLTKEINSLIKDMKANGEYDKLYEKWIGQKP... 274
30 -71.100IDP91947 amino acid ABC transporter, amino acid-binding protein/permease protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100001889 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  26  260..................LKAIPVKAKYIIASDSSFAPFVFQNSSNQYTGIDMELIKAIAKDQGFEIEITNPGFDAAISAVQAGQADGIIAGMSVTDARKATFDFSESYYTANTILGVKESSN-IASYEDLKGKTVGVKNGTASQTFLTENQSKYGYKIKTFADGSSMYDSLNTGAIDAVMDDEPVLKYSISQGQ--------KLKTPISGTPIGETAFAVKKGNPELIEMFNNGLANLKANGEFQKILDKYLASE.... 489
31 -70.900IDP90988 gene: gltI; glutamate and aspartate transporter subunit [Yersinia pestis KIM 10] y1189 [Yersinia pestis KIM10+]  ali follow..  24  3MRKLALVLLLAGMTSSVAQAEDKNNGVIVVGHRESSVPFSYYDNQQKVVGYSQDYSNLIVDAIRLEVKLIPITSQNRIPLLQNGTFDFECGSTTNNLERQQQAAFSNTIFVVGTRLLTKKDSE-VKDFKDLAGKAVVVTSGTTSEVLLNKLNEKDNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDEWSIVG-----TPQSEEAYGCMMRKNDPAFKALLDKTIATAQTTGVAEKSFDRWFKNPI... 277
32 -66.600IDP91898 amino acid ABC transporter, amino acid-binding protein/permease protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100003105 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  21  1MRKIYLSIFTSLLLMLGLVNVAQADEYLRIGMEAAYAPFNWTQDNQYANGYDVQIAKKIAKDLGKEPLVVKTKWEGLVPALTSGKIDMIIAGMSPTAERKQEIAFSSSYYTSEPVLLVKKDSAYAKSLDDFNGAKITSQQGVYLYDLIAQI--PGAKKETAMGDFAQMRQALEAGVIDAYVSERPEALTAEAANSKFKMIQVE----PGFKTGEEDTAIAILRKNDNRISQINASIETISKDDQVALMDRMIKEQP.... 265
33 -46.700IDP01503 amino acid ABC transporter, periplasmic amino acid-binding protein, putative VCA0978 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  23  1MMKSIATLISVVLCSFSAWA-----QTITAAQD-PWPPFVMENAQQK--GLSVDIVTAAFATQGYTVEFTIMPWSRALNDVKEGKIDILP-ATWFTQERTAYLTYSDNYLTNQVKFIKKAGDNFEAGLASLNGKKVGIVRGYG---YGDEFMNDPSFFRPESTDLKQNLQKLQAGRIDLAVEDELVAKSIITEAGMNLA----DFAFTNQAISENPLHVTSGKRSEELVAAFNKGLAEIKANGTFDKLLADY........ 240
34 -33.700IDP00173 putative membrane protein YPO2922 [Yersinia pestis CO92]  ali follow..  16  1MTRIKLSYFTIGLVALLLALALKARGELRVST--ISSPLIYSTEKDTPSGFDYELAKRFADYLGVKLVIIPHNIDDLFDALDNDDTDLLAAGLIYNRERLNRARTGPAYYSVSQQLVYRLGSPRPKSFSDLKGQVVVASGSAHMTTLKRTKYPELNWSSSVDKSGKELLEQVAEGKLDYTLGDSATIALLQRIHPQ--------LAVAFDVTDEEPVTWYFQSDDDSLYAAMLDFYSEMVEDGSLARLEEKYLG...... 266
35 -20.700IDP90302 sensory transduction histidine kinase, putative [Borrelia burgdorferi B31] BB_0420 [Borrelia burgdorferi B31]  ali follow..  14  1MKKALSTNFLILLLVCFVNVNLFSKDIFKFKLVDQFFPFYYKNNKGEYEGLIFSILDKWAKDNNADIMVE---HIDNLNESEIEDEA-IYLGLTYNVKLNDFFYFKSELARSISILFFKNSNKKNTHSTFLSNFNIGVIKNTIYEDILRLKNVN---TIFLADNSQELVLALKNDKVDYIYGDCKTLHYIANNFLSED------VIFTGDVFYSIKNRVAISRNAPEIVKNLNLDLFSY-LMKMPEELVFSF........ 243
36 -20.300IDP93815 sensor kinase protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007719 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  17  1MKFLYKIYLTWALTLLSSTAVYAAEAVVNYGIFPNSYPIEKFNSIGEHIGLTRDYIDIISTVTGIKFKPVFNNDRESVTNLQSGKIS-LLTSTSISFAQTHGLISSVPIFTTWPLTVTRKATRHIATPDDLMEGYVSITDYSSLIEWFTKQFP--GVNYKIVYSPEETIAEVINRQAEAAVVLSPTALYYMNVKYPGQ------LKISRPHSAKISLAMAAHPEDQILINIINKAIASISAK-QQAELTAKWIISD.... 262
37 -18.700IDP05042 putative sulfonate ABC transporter, sulfonate-binding protein [Bacillus anthracis str. Ames] BA_2921 [Bacillus anthracis str. Ames]  ali follow..  15  1MYKKFKVLSFTLAISLFTASSKKEDVTVQIGIQQGLSPLLLAQKKGWF--------EEEFKKEGVKVKWTEFQ-PPYFEAIASNRLDFGEVGSAQAAGIGFTEIANTSYARKGTGILVQKDSK-ITSIKELKGKKIAVAKGSSAFNLLYRALDKEGINAKDVNQPDEAQPAFESGSVDAWAIWDPFISLHTVNKGAKVITDGERLNVSSPEFLIARTKFAKEHPEEKFLKVYEKARVWQDENDEAIKIYTSAKKID.... 267
38 -17.900IDP05398 putative phosphonate ABC transporter, phosphonate-binding protein [Bacillus anthracis str. Ames] BA_3750 [Bacillus anthracis str. Ames]  ali follow..  17  2LKKFFAMSTTVVLAAGLLSGKGYVPKTLNVQFVPSQNADTLEAK---------PLEKLLSDKLNIPVKVISTNYNTIVEAMASKQVDVILQAQRFGVDDETGAPKKDLVDFYKSEFVVKKDSN-INSVKDLKGKKIGYVTSSAGYVWPAAVLLKEGVDPLKDKGHDQSLIALLNGDVDAAVVFQDARNIVKKDYPNIFD----QTKIVKFTEKIPNDTISVRSDDEEWSKKLQDAFIEIGKNEEGHKIIKEVYSHE.... 289
39 -17.400IDP05024 ABC transporter, substrate-binding protein, putative [Bacillus anthracis str. Sterne] BAS4675 [Bacillus anthracis str. Sterne]  ali follow..  19  1...MLLAVFTFAACSSKKEGTKEQTQNIRIGESLFYAPLYVGIEKGKDEGLNVDLQTT-------------AGGDKTMTALLSGGIDIALVGSETSGAKDPIINFAQLTQTDGTFLVSRKKLD-SFNWNDVKGVTFLGRKGGMPQMVGEYVLKKNGIDLIQNIEFANIANAYASGTGEFVQLFEPTASI-FEKEGKGYIVASFGNESGTVPYTSFMAKESFLKKDKAAAEKFTRALYKAQQ................... 241
40 -16.900IDP05119 ABC transporter, substrate-binding protein [Clostridium difficile 630] CD2989 [Peptoclostridium difficile 630]  ali follow..  16  3LKKLLIGITILTLATASLAGNGEKLSEINLTYVPLNVPSIIQKQDD--------LFGKEFKKDNIKVNFHEIT-PEQTQALAAGEIDFL-TSALIAASNGVELKILNTYSRSPKGFMILTNNNSIKSAADLVGKKVAGPKGTILHQVLISALDKEGLSMDDVEGIPEASAALSDGSVDAAL----IAGPAALKAMKSGSKLVANGEGLVDGIIVTAVSTDFAEKHPEIVERFMKVEKETLE................... 247
41 -16.700IDP05622 ABC transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD0999 [Peptoclostridium difficile 630]  ali follow..  14  1MKKYISIILLVVLTMVVLVGCSPGKDNPKNKELSVVKQVKVAVPDGPAVAIAKLANENPEIKEGYETVYSIEK-EAISTRVMKKDADIAIVPSNMA-NKTSSYNIVGTVGMGSLYLVSTEN---IKDYSDLVGKEVGCGKGLTPDITIKSLLLQKDIKFNYVSSASELVPLLATGKVKTGIVPEPALSALMSKNPDIKIIKSLNDSWKEVSGSKDGYPQSFLRDNKDFVDSFVGQLSNSID................... 256
42 -16.700IDP04166 sensory box sensor histidine kinase/response regulator VieS [Vibrio cholerae O1 biovar eltor str. N16961] VC1653 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  2.....................................PYWG-GTGQEPIGIEHDFASGIAKELGINIEYKGFTIEALLNAVSTGKAD-MAIGFGQTLAREGKFLFSKPLYENVRVIWLRDKA---MEEKPFASLKWVCIQGTSYCEILKDR---GYPNIIMARNYSSSVEMIRQGIADATVTNYVSLNHYLSQKRLAL------KVIFDPDLGVQTNRILINNNEPLLLSAINKVIDADKQG.................. 194
43 -15.800IDP91135 hypothetical protein SAOUHSC_00137 [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00137 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  11  1MKRLSIIVIIGIFIITGCDWQRTSKERSKNAQNQQVIKIGYLPITHSANLMMTKKLLSQYNHPKYKLELVKNNWPDLMDALNSGRIDGASTLIELAKQKGSNIKAVALGHHEGNVIMGQKGMHLNEFNNNGDDYHFGIHRYSTHYLLLEELRKQLKIKPGHFSSPAEMPAALSEHRITGYSVAEPFGAL-GEKLGKGKTLKHGDDVIPDAYCCVLVLRGELLDQHKDVAQAFVQDYKKMNDRKQSVDIMTHHFKQS.... 268
44 -15.600IDP05207 putative sulfonate ABC transporter,solute-binding lipoprotein [Clostridium difficile 630] CD2365 [Peptoclostridium difficile 630]  ali follow..  15  3LSKKIQALILFGVMGTSEAKTGKDDYTITVGYYNHMTAGPVAESAGKDLGLNVKT----------------VGNGKVPEAMAAGKMDAGYIGTKGAIPKGSPITIAANNHTGGSEYLIVSKD--IKEPKDLIGKKIATDMSDFLWTSDYGPTDPSKYEVVNMDSDKDKYLALKTGKIQAFTSCDPWGSV-AENDGAGKIIASTQYKEKANGKEYNCCSFSLNKEHPDLAKKLVLAHTKAIEPAEAAKIFAKYYNVE.... 273
45 -14.900IDP91987 ABC transporter substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100008765 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  11  1MKKTWKVFLTLVTALVAASKDNKEAELKKVDFILDWTP------NTNHTGLYVAKEKGYFKEAGVDVDLKLPPEESSSDLVINGKAPFAVYYMAKKLEKGAGITAVAAIVEHNTSGIISRKSDNVSSPKDLVGKKYGTWNDPTELAMLKTLVESQGGDFEKVENDSNSITPIANGVFDTAWI---YGWDGILAKSQGVDANFMYLKDYVKEFDYYSPVIIANNDYLKDNKEEARKVIQAIKKG................. 252
46 -14.900IDP05357 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_0382 [Bacillus anthracis str. Ames]  ali follow..  11  1MKKGLKVMLAALLAVGVAGCNPAKKEESASKDQKVKVVLDWF-PNTNHTGLYVAQAKDYYKKQGLDVEIIQPG-VTAEQMIASGKADFAISNVTLARVEGIPVVSVGAIIQHNTSAFASLKKDNMTSPKDFEGKRYGGWGGPAEEATLKTIMDKHQADVEKIILGQTDFFKSIGRDADFEWI---YGWDGIEAKRQGKELNTIMVKDLDPALDFYSPVMITSEKHTKQDKDFVKKFMSATTEG................. 247
47 -14.300IDP05631 ABC transporter, substrate-binding protein [Clostridium difficile 630] CD1979 [Peptoclostridium difficile 630]  ali follow..  14  4KKLGILGLVSVFTLATITGCSSNNNKDKNNDKDTSSKKVTMV-PNTNHTGLFVALDKGYYKEEGLDVEIVQPPESGAETLVATGKADFGISYYAKTSEDPLPIKAVATVIQHNTSGFASPKEKNITTAKDFEGKTYGGWGSPSEEAVFKAVMKKNRADFNKLKNTGQDDFFAAMKTVDFAWI--FEGWDAVKADLIGYDLNFIPVKDLDERLDYYTPLIISNKDNPELAKKFLKATTK...................... 253
48 -11.100IDP05415 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_5219 [Bacillus anthracis str. Ames]  ali follow..  14  1MKKILLSVVTALSVFTLAACGGKEENKLVVGASNV---LEKAQPILEKKGIKLEIKK--------------QDYVLPNKALADKEIDA------------QHIPYLDKEIQEKGYKIVNAGSKRYKSLKDLDGGTVIMSNNVAERGRMLALLQKGGV--DGVDVVKATVKDVVENNLKFKTDVEPGLSPKLYENNEGDALFINSNYAIDAKLNPTKDAIAIEGSDSPYANII-AVRKGDEKKKEIKELVEVLHSKEI... 251
49 -10.600IDP91956 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005733 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  11  1MFKNFKKIAFTSSLILLAACSNNASNTNQSTDEGS------VDKSQEIVIYT-DWLQTKASEQGYNLRLVDISGGELADRLIAEKADMVIGLNKLEFNRIKAEKLLVKYVNQPLVLIGNKDAKMPSDWTDFKGK-YGISKLSTGTSKN-KVAKAYLKNAHVYAEGEDYISSIMDNNNDLKYSMMWGSGVLQNQKEREYKFQVMSPK-VGVPYVTEQVGILNTSKKQALLKEFVDWFGSSELQKEWSD............. 299
50 -9.370IDP05714 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_0175 [Bacillus anthracis str. Ames]  ali follow..  16  1MKKVLLSIVSGAVLLLGAEVKALDEKKITVGVTGG---FEKVKEVAAKDGLEIDVKV--------------NDYVAPNVSLDEKSLDVSYQTKSYLDVFKAERNMKLTEVFSTVTFPMGVYSKSLKDVKDLDGDAIAVPNDPTNELRALKLFEKAGLKVDPKATEKATAKDVIENPKNLKIVSEVKAAAINTNFALGAKLSPAKDSIFREGKDSPYVNWVVVRTENKDDAVVNKLKKAYQSKEVKEFIEKKFDGSVL... 267
51 -9.360IDP05370 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_5220 [Bacillus anthracis str. Ames]  ali follow..  12  1MKKLLLTALISTSIFGLAACGGKDNDEKKLVVGASNVPLEKAKPLLEKKGIELEVKK--------------QDYVLPNKSLADKDLDA------------QHIPYLEKEIKDKKYEFEVAGSQKYKSLKELDGATIIMSNSVADHGRGLAILQKEGI--DGVDPVKATPKDIADNPKNLKFKKEGDAVLINSNYAIDTKLNPEKDAIAIESNDSPYANVVAVRKGDKDKKEIKELVEVLHSKEIEDFINKEYKGAVV... 266
52 -9.150IDP05563 hypothetical protein lmo2417 [Listeria monocytogenes EGD-e] lmo2417 [Listeria monocytogenes EGD-e]  ali follow..  10  1MKKVLGLIFTLSLVLVLTACGGSDDKQLVVGASNT---LEQAKPILKDKGIDLKIVK--------------TDYVMPNKALEEGDLDAYFQHKPYLELEEKEKGYKFADVGAIHIEPMGIYSKKVKDIKDLDGAQVLLSNSKSDWPRVIGIFVDNGLKFKYDFDPAYLMTAYNNEEGDVVAINSNFVVD--------QGLNPSKDAIAIESKDSPYANIVVTTEKKKDDKNITELVKVLHSKEIQDYITKEWDGAVV... 272

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.