current user: public

If you have questions about the server, please let us know.

Query: [S] COG3592 Uncharacterized conserved protein, from VFDB

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst MEEETLLEQGYRKYRGADVDIYFNTNICAHSGNCVKGNAELFNLDRKPWIMPDNVPKEEAKRVIHTCPSGALQYIEKLast
1 -31.300IDP06284 ferredoxin [Streptococcus pneumoniae TIGR4] NP_346049 [Streptococcus pneumoniae TIGR4]  ali follow..  18  1..................MKITLIPERCIACGLCQ-TYSDLFDYHDNGIVEKEISPSQDILEAVKNCPTRALIGNQE 67
2 -15.100IDP90516 gene: oorD; 2-oxoglutarate-acceptor oxidoreductase subunit OorD [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0535 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  10  1..........MSMTAPKDTPVWVDEHRCKACNICVSYCPGVLAMRDDV-EVVHPESCIGCTECEIHCPDFAIMVAKR 75
3 -13.500IDP00452 electron transport complex protein RnfB YPO2245 [Yersinia pestis CO92]  ali follow..  111.....................FIDEANCIGCTKCIQACPDAIIGATRAMHTVLSDLCTGCDLCVAPCPTDCIEMIPV 167
4 -12.700IDP91439 ferredoxin [Vibrio vulnificus CMCP6] VV1_0471 [Vibrio vulnificus CMCP6]  ali follow..  14  2....................ALLITDKCINCDMCDPECPGAISMGDKIFEIDPNLCTECKGTCQSVCPITKCIITDP 64
5 -12.400IDP02246 gene: rnfB; Iron-sulfur cluster-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0649c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  78......................IDESMCIGCEKCLLACPDAIVGAKKLMHTIIEAECTGCELCVEPCPMDCISLVDL 133
6 -10.700IDP06055 ferredoxin [Helicobacter pylori J99] NP_222983 [Helicobacter pylori J99]  ali follow..  17  2....................SLLVNDECIACDACREECPAIEEGDPIYSIDPDRGYDDDEPRCVSVCPVDAILPDPN 65
7 -10.400IDP00983 gene: phsB; thiosulfate reductase electron transport protein STM2064 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  81............SYRDENGIVQVDKSRCIGCDYCVAACPQTGVADKCNFCADTRLAAGQSPACVSVCPTDALKFGR. 152
8 -10.100IDP00930 putative hydrogenase protein STM0612 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  74............YTKREDGVVVHNPERCIGCKNCIRNCPPRFNEETRKAEKYERLDIGMNPACVNACPVGALSIID. 144
9 -9.940IDP01006 putative anaerobic dimethylsulfoxide reductase STM2529 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  21  104....................VRVDTDKCVGCGYCAWSCPPQLNEQTGQMSKVDLLAKGEPPVCVATCPLEAIKFGP. 166
10 -9.940IDP93838 nrfc protein [Yersinia enterocolitica subsp. palearctica Y11] YP_006003981 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  16  118....................VDVNPDLCVGCQYCIAACP---TADKCDFCRKTNLKQGKQPACVLSCPTKALTFGN. 181
11 -9.900IDP00878 putative anaerobic dimethylsulfoxide reductase subunit B STM4306 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  92....................VVVDDSVCVGCRYCEMRCPPQFDTQANVMRKLDRLENNLRPICVDSCPQRALDFGP. 154
12 -9.820IDP00453 putative iron-sulphur protein YPO2969 [Yersinia pestis CO92]  ali follow..  18  66.........................QSCTGCGVCVAACENLIVMVNQSTPYFSTPYCSRCQACSTACQTGALS.... 120
13 -9.710IDP00543 gene: fdoH; formate dehydrogenase-O, iron-sulfur subunit YPO4057 [Yersinia pestis CO92]  ali follow..  26  128....................VDFQSEHCIGCGYCIAGCP--MNKDDNRVYKVDRVGVGQEPACVKTCPTGAIHFGTK 191
14 -9.670IDP01812 ferredoxin [Francisella tularensis subsp. tularensis SCHU S4] FTT1764c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  15  6........................TESCIKCGDCVEVCPVDCFYEGPNMLVINPDECIDCALCEPECPVNAIKSSDD 60
15 -9.660IDP01518 formate dehydrogenase, iron-sulfur subunit VC1512 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  74............FVHTEDGIVLHNKDLCIGCGYCLFACPEPGSEEERRKYGANRIAEGKLPMCASLCSTKALLAGD. 167
16 -9.500IDP02723 gene: nuoI; NADH dehydrogenase subunit I [Francisella tularensis subsp. tularensis SCHU S4] FTT0039 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  59.......................GEERCIACKLCEVVCPLAITINSTEREDGTRRTSSYEMDCEESCPVDSIVETNI 122
17 -9.410IDP02074 gene: hybA; hydrogenase 2 protein HybA [Salmonella typhimurium LT2] STM3149 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  138....................VHYDKDVCTGCRYCMVACP--YNVPKYDYNNPFGADKGGLPGCVEVCPAGAVIFGTR 207
18 -9.410IDP01082 gene: nrfC; putative formate-dependent nitrite reductase STM4279 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  118....................VDVNPDLCVGCQYCIAACP---TADKCDFCRKTNLKAGKQPACVESCPTKALTFGN. 181
19 -9.320IDP06075 gene: nuoI; NADH dehydrogenase subunit I [Helicobacter pylori J99] NP_223907 [Helicobacter pylori J99]  ali follow..  14  56.MEQLPLSPRYRAVHHLQRLLDSGSERCIGCGLCEKICTNCIRIITHKGEDNRKKIDSYTINCAEVCPELAIVMGNR 141
20 -9.290IDP00961 gene: ttrB; tetrathionate reductase complex subunit B STM1385 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  123............TFQREDGIVVVDNKRCVGCAYCVQACPRFINHETQTADKVHRLEAGLLPACVESCVGGARIIGD. 193
21 -9.060IDP02316 gene: nuoG; NADH dehydrogenase subunit G [Francisella tularensis subsp. tularensis SCHU S4] FTT0037 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  19  127..TTSEYLESKRTVEDPELGVATDMTRCILCTRCVRFGEEIAGVKESTYISGEMVDSEISANIIDLCPVGALT.... 211

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24