current user: public
If you have questions about the server, please let us know.

Query: [S] COG3767 Uncharacterized low-complexity protein, from VFDB

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MNKNIAAALAGALSLSLAAGAVAANKPASNATGVHKSAHGSCGASKSAEGSCGAAGSKAGEGKCGEGKCGATVKKTHKHTKASKAKAKSAEGKCGEGKCGSKLast
1 -10.600IDP05117 putative collagen-binding protein [Clostridium difficile 630] CD2831 [Peptoclostridium difficile 630]  ali follow..  11  39.QIQSGSTNSSTGEEKESDNKKPEQTPEKDKATDNKKPEQTPEEEKPTDNK--KPEQTPEEDKSTDNKKPEQTPEGEKPIDNKKPEQIPEEDKSTDNKKSEQ 137
2 -9.010IDP05315 cell wall anchor domain-containing protein [Bacillus anthracis str. Sterne] BAS0383 [Bacillus anthracis str. Sterne]  ali follow..  19  80.......GSGDNGSGGNGSGGNGSGENGSGGNGSGSSGSGDNGSGGNGSGGNGSGSSGSGENGSGGNGSGSSGSGENGSGGNGSGSSGSGENGSGGNGSGG. 173
3 -8.700IDP92737 platelet-binding glycoprotein [Streptococcus sanguinis SK36] YP_001034807 [Streptococcus sanguinis SK36]  ali follow..  8  1MFFKRQKGKYHEVERVTRFKLIKSGKHWLRAATSQ................................................................... 35
4 -8.140IDP92738 gene: hsa; streptococcal hemagglutinin [Streptococcus gordonii] BAA97453 [Streptococcus gordonii]  ali follow..  8  1MFFKRQKGQYHEVERVTRFKLIKSGKHWLRAATSQ................................................................... 35
5 -7.650IDP05372 LPXTG-motif cell wall anchor domain protein [Bacillus anthracis str. Ames] BA_0397 [Bacillus anthracis str. Ames]  ali follow..  20  55.......PGNGGSQDDSGSDGNGSDGSGSGDNGSGDNGSGGNGSGGNGSGENGSGGN--GSGSSGSGDNGSGGNGSGGNGSGSSGSGENGSGGNGSGSSGS. 146
6 -6.870IDP92612 gene: gbs1529; Unknown [Streptococcus agalactiae NEM316] CAD47188 [Streptococcus agalactiae NEM316]  ali follow..  5  1MSQKTFGKQLTVVDTKS..................................................................................... 17
7 -6.140IDP05677 hypothetical protein lmo1068 [Listeria monocytogenes EGD-e] lmo1068 [Listeria monocytogenes EGD-e]  ali follow..  19  18.............................GACGNNDNEKDQEDKSTTDSTTKKAKSSSNESNKAAETKENDTNDKAATTDKGSSNPTKEEKDTSTTTDTPKK 90
8 -5.680IDP05543 hypothetical protein CD2628 [Clostridium difficile 630] CD2628 [Peptoclostridium difficile 630]  ali follow..  9  485.NNNNENDDSDEKQPNTPKDDVESSTDSNENKNPHDIPKDGNKENNSDKEKGFYNKNSITENDDNYDLSSKSVFGTNEHSFPYRESISNKNQDTNKNKSNIS 585
9 -5.410IDP05182 gene: gerHA; spore germination protein GerHA [Bacillus anthracis str. Ames] BA_4984 [Bacillus anthracis str. Ames]  ali follow..  8  6LRKKKKLNTTEKNETDNSEQKPNNQEDDNKEQTRSTKHNKSNNSEQKKEEHKESSQDKQQNQSNQNQQQSAKQDESSQGQQNHSKQDDSDQGQQQHSKQGNS 107
10 -4.820IDP05070 putative surface protein [Clostridium difficile 630] CD3246 [Peptoclostridium difficile 630]  ali follow..  10  14.DEVTSNDTILNGEEQSNGQTPDVEKPSDGQ-GEKPSDSQVPDGEKPSDGQVPDGEKPSDGQIPDGEKPSDGQIPD---GEKPSDGQIPDGEKPSDGQ-GEK 115
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.