current user: public

If you have questions about the server, please let us know.

Query: [R] COG4588 Accessory colonization factor AcfC, contains ABC-type periplasmic domain, from VFDB

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWRELast
1 -81.100IDP00164 gene: acfC; accessory colonization factor AcfC VC0841 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  50  1MYFMRFLLISLLSFSTSVFADVNLYGPGGPHVPLIKVAESFEKSQSKRVNITFGPQATWNDKAKKNADILFGASEHSALAIAEGHSERFSKFNIHPVFMREAIILVKKGNPKNIKGMADLLKPGIGIVVNDGAGVSNTSGTAVWEDSVGRMKNVEKLQAFRSNIHVFAPNSGSARAFVDGEDIDAWITWVDWAIANPTIGDMVRMEDEYRIYRDFNVVLAKNPSSEAIDFFDYLKSKDAEAIFQHYGWFK 256
2 -65.300IDP04512 gene: modA; molybdate ABC transporter, molybdate-binding protein [Clostridium perfringens ATCC 13124] CPF_2342 [Clostridium perfringens ATCC 13124]  ali follow..  16  1MRKGMLSLLFVGCTNNKEEKTLTVSIAASLQKPMEKIASNFEKENGVKIQYNVGGSGTLKKQISDGADDLFFSANTKYAKELIDEG-LVNKDESYKILNNQLVLIENNDYNKPINSLEDLKNVEGKI----AIGEISTVPAGQYAKESLE--KVGAYKDIEDKLV-FARSVTNVKTYVENGEANLGFVYKTDALDLKNSKIVYEVPNHKPIEYELCLLKNSKNNKEAKKLIEYLKGEESKKIFSEYGFE. 254
3 -64.800IDP05678 hypothetical protein lmo1041 [Listeria monocytogenes EGD-e] lmo1041 [Listeria monocytogenes EGD-e]  ali follow..  12  1MKKLLLLGACEDTPEKVQTTTIHISAAASLKDSIDDVKPLFEKANTIKLSFDFGGSGQIRERVESGAPDGVLLASKKDADTLIKQNLA---EKTKEFAGNELVLIEPKNVDQKTEANLEQLLNDASKI---AIGDPESVPAGAYAKQTLE--NLNLYNAEKAKLV-LATDVRQVLSYVEAGNADAGFVYQTDALLSKKVQVKAKIDEHDPIAYYSAQVSDSDKKEETATFLDFMNKSEAQKILEKYGFK. 253
4 -62.200IDP05504 gene: modA; putative molybdenum ABC transporter,substrate-binding protein [Clostridium difficile 630] CD0869 [Peptoclostridium difficile 630]  ali follow..  18  1MKKILGILGLVACTKSSDSVELNISAAASLKEAMAKIEEEYKKVSNVKLTVNYGASGSLQQQIEQGAPDLFISAGQKQMKVLDEEK-LLVSDTMKDLVKNDLVLISSADSS--VSGMKDLTTDKVKKI---AVGEAESVPAGKYADEVLT--NLNLKDKLKDKLV-FAKDVKEVLAWVQSGNADVGFVYFSDTVNNDKIKVVEKTDEHSPITYPVSVIKASKNVDAAKKFEEFLLSESGQKIFEEFGYK. 267
5 -61.500IDP91025 gene: modA; molybdate transporter periplasmic protein [Yersinia pestis KIM 10] y3037 [Yersinia pestis KIM10+]  ali follow..  15  17...AGAVLLTAFSGPAFAADKITVFAAASLTNALQDIAVQYKQEKQVDVVASYASSSTLARQIEQGAPDLFISADQQWMDYAIDKQ-QIVANTRYTLLGNELVLIAPQDSQIDKVEIDKKTD-KLLEGGRLAVGDPDHVPAGIYAKESLE--NLGAWSTLAPEMA-RANNVRSAMALVERAEAPLGIVYGSDAVASKKVKVVGIFPEHKPVEYPMAIVKGHDNPT-VTAFYDYLKSPAAAVIFKNYGFT. 261
6 -61.200IDP01311 molybdenum ABC transporter, periplasmic molybdenum-binding protein VCA0726 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  1MPMLLLLCVALNAPLASAKETLHIYAASSMTNAVNALVADYSQQHDVKLVTVYGGSSSLARQIEAGAPDLFISANEEWANYLVEKG-LVKPNKVVTLAANSLVLIRPTAQPVASFELQDAAAWQTALADRLAVAQVDAVPAGMYAKQALQ--HAGVWPELESRLA-QTNNVRLALALVERGESPLGIVYKTDALLSDKVTIVTAFSAHQPIRYPLAQL---NDKAASAEWVAYLRSDAAQQILQRFGFE. 250
7 -54.800IDP01383 thiosulfate ABC transporter, periplasmic thiosulfate-binding protein VC0538 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  1MNRIKSTLTALLLAASAADQTILNSSYDIARELFVAYNPVFAEHKTVEIKQSHAGSSAQARSILQGLADVVTFNQVTDVQILHDKGKLIPANNASSPYYSTTAFLVRKGNPKNIQDWSDLVRDDVKSV----FPNPKTSGNARYTYLAALGFAQEFLKKFLANVAVFDTGRGATTSFVERGIGDVLITFESEVNNIRQQYGADDYQAEFPVAVVEKVAKRNGTYDVATEYVSYLYSEPAQRLLAEFNYR. 284
8 -32.700IDP00471 gene: tbpA; thiamin transporter substrate binding subunit YPO0522 [Yersinia pestis CO92]  ali follow..  13  1MFKHIISCLLLISALAAEKPTLTVYTYDSFAGPGPAIKQAFEAECDCQLKVALEDGVSLLNRLRMEGKDVILGLDNNLVQAAEQTGLFTPSQVDTPYDYGYFAFVYNKEKLKN-KSLHELISSKEPVIYQDPRTSTPGLGLMLWMQKVYGDQAPQAWQQLAQKTVTVTKGWSEAYGLFLKGEADLVLSYTTSPAKNNNYAAADFSEGHYLQVEVAGQLAASKQPELAQRFMQFIVTPAFQNHIPTGNWM. 284
9 -30.300IDP01937 putative periplasmic solute-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0727 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  12  1MSKKFFLSLGLVAKAAQAEGRVNSLAMPDTWANWKDTWADLKNLYDIEHSDTDMSSAQEIAKFKTEGDIGDVGASFGEIAVKQGVAQPFKTSYWDQIYTGTIAFIVNKDVVKDIKTWQDLLKGNYKITVGDVSVAAQAVSA-LGGDEKDLSPALAFFNTLAKQGRLVNND--VSIANLEKGEVEVGLVWDFNGLGYRDKVGLIPADGSVISGYTTIINKYAKHPNAAKLAREFILSDKGQINLAKGYAR. 293
10 -30.000IDP92649 iron ABC transporter, iron-binding protein [Streptococcus pneumoniae TIGR4] SP_0243 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  1MKKKWMYYAACSSSDKGDGGSLVVYSPNS-EGLIGATIPAFEEKYGIKVELIQAGTGELFKKLESEKEDVIFGGSYTQYTTHGELFENYTSKENDNVTLDGSVLIVNPDKGMNIEGYNDLFKPELK---KIATADPANSSSAFAQLTNMDDKAWSYVKDLFTLIDKIGLSSSGVYKAVADGEMTVGLSYEDPAVKLLNIKVVYPKEGTVFLPASAAIVKKSKNMENAKKFIDFIISQEVQDTLGTTTTN. 287
11 -30.000IDP04509 iron compound ABC transporter, iron compound-binding protein [Clostridium perfringens ATCC 13124] CPF_0440 [Clostridium perfringens ATCC 13124]  ali follow..  17  4RKKLLALTLTALVSTGSGEKVVNVYSSRH-YDIDKQLFKDFESDTGIKVNLVDGKSDELIERMAREGDDVFLTVGAENIAQLNEKDLIKDISSEKGLTSRARIIVYNKENPETIKTYNDLTKDEFKVLTRSSSSSYNNALLSSFIQLDGAEKAKEWAQGIVNNFARTEGNDRDQAKAIMAGIGDVGIMNSAEEAKVGKEIGVLFPENTHLNLSFGAVTKNAKNEENAVALLEYLTEEKAQKAYVDENGE. 304
12 -29.400IDP05164 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_1735 [Bacillus anthracis str. Ames]  ali follow..  13  1MKKFSSLKSLFVCSKTTNEKKIVVYSAGP-KGLAEKIQKDFEKKTGIKVEMFQGTTGKILARMEAEKKDVVVLASLPAMEGLKKDGQTLAYKEAKGYSASALGIVYNTKNVKTAEDWSDITKGEWKVNLPDPALSGSALDFVTGYVKKNGKDGWDLFEQLKKNEVTVAGANQEALDPVVTGAKDMVIAGVDYMTKGEPVDIVYPKSGTVISPRAAGIMKDSKNVEGAKEFIDYLLSDDVQKQISK..... 294
13 -28.300IDP00429 gene: sfuA; iron(III)-binding periplasmic protein YPO2958 [Yersinia pestis CO92]  ali follow..  16  1MKIPIPSIGHVALNAASDEDGIIIYNAQH-ESFAKSWAEGFTKDTGIKVTLRNGKDSELGNQLIQEGSDVFLTENSPAMVLVDNAKLFAPLDAATQIAARSTVFVY---NPAKIKSLMDLAKPEWK-WAASPSGADFQAIVSAMLALKGEQATLEWLKAMKTNATAYKGN-STVMKAVNAGQIDGGVIYHVDQAKTGENSGNIKLPGAFVSISGAGVLASSKHPQQAQKFVQWVTGKAGQDFLRESN... 291
14 -28.200IDP01491 ABC transporter, periplasmic substrate-binding protein VCA0603 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  1MERTLTAIAALMSAHAFAGQEVTVYTAFE-TDLLAKYKSAFEKEPDIEIKWVRDSTGIMTAKLLAEKDEVVWGLAGSSMALLKDQGVLKPYTPKNAVCFNEAVA--KQLNLPKPQSWEDLTNPVYK---HIAMPNPASSGTGAWLQNMGEDKAWDYMQRLDQNIAHYTHSGSKPCVQAGMGEVAIGISMATRGAKLKTQGAPLDVIVPNGIGWESEAVGLVKESDAAKRVVDWSVSKAANELYIE..... 284
15 -27.900IDP01388 iron(III) ABC transporter, periplasmic iron-compound-binding protein VC0608 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  19LLSLSAITLSVLAPSAFAAQEVNVYSYRQ-PFLIEPMFAEFTKETGIKVNVKFAKEGKLAQEGEYSPADVILTSEFSRLFELTEKGLTQPLDSKVALTQRTRSVYSSRDRLGK-FDYMDLAKPEFKICTRSGKHPYNIALVASIIANHGEAEAKAWLEGVKANLARKPGNDRDQVRAIKEGLCDVSLGNSYYLGAMLNDQEQKSWAEAVYINFPMAMAKYSPNRENAQKLMEFLTGETAQKMYAEVNYE. 305
16 -27.400IDP91956 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005733 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  1MFKNFKKIAFTSSGSVDKSQEIVIYTNSA-SNGRADWLQTKASEQGYNLRLVDISGGELADRLIAEKNDMVIGLNKLEFNRIKAEKLLVKYSPKSPIVNQPLVLIGNKDAKM--SDWTDFTDSSYKYGISKLSTGTSKNIFASIGELGISDEGWKVAKAYLKNAHVYAEG-EDYISSIMDNNNDLKYSMMNQKEREYKFQVMSPKVGVPYVTEQVGILNTSKKQALLKEFVDWFGSSELQKEWSDKFGS. 303
17 -25.900IDP04248 ABC transporter, substrate-binding protein [Clostridium perfringens ATCC 13124] CPF_1477 [Clostridium perfringens ATCC 13124]  ali follow..  18  1MKKKILATLLTGLEGAEAGKKLVVSTWGLNEDVLKEVFEPFAKEHGVEIVLDIGNNSERLTKMKNNPDITYLAESFAEQGVEAGIFDKLDYSKIPAYTLNSIGIVVDPSAGIEINSWEDLWKPELKIAIPDITTTNGPAMVGVDVKTDNGEAAFKELEALKPNVVKTYSKSSDLANMFSNGEIVAAVASDFAFKAKPEVINVIPESGTYLNFNTININKNSKNKDLAYEFINYALSKEVQEKTAK..... 294
18 -24.800IDP90995 hypothetical protein y1430 [Yersinia pestis KIM 10] y1430 [Yersinia pestis KIM10+]  ali follow..  15  42...........IVDGAKKEGKVVVYSATD-IKAAAPLIKGFEAAPGIKVEYNDMNSTELYNRYISEGDVVWSSSMDTALKLATDYALEYLSPEQAELIYNK--LIPQADMPDTHIALAKLIVSQ-KFKRKVTTYDIEKSGLGSVQDFKADPNYFTTLANIAKGGLTVQSSTGTMMERVSSGENLIGFNILGSYAETPSLGIAYPKDYTLVLSRVTFISQKAPHQNAAKLWVDYLLSEKGQNILANQS... 312
19 -21.000IDP91988 phosphate-binding protein PstS 1 (PBP 1) [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007640 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  11  1MKKRKKLALSLIASWIDRGESITAVGSTALQPLVEVAADEFGTIVGKTVNVQGGGSGTGLSQVQSGAVDIGNSDVFAEEKDGIDASALVD----HKVAVAGLALIVNKEVD-----VDNLTTEQLRQIFIGEVTNWKEVG-----SVINRAAGSGSRATFDTVIMQEQDSNGAVKSIVSKSPGAISYLSLTYIDDSVKSMKLNGYDLNWPLWSYEHMYTLGQPNELAAEFLNFVLSDETQEIVKGLKY.. 269
20 -20.900IDP04390 gene: pstS; phosphate ABC transporter, phosphate-binding protein [Clostridium perfringens ATCC 13124] CPF_0618 [Clostridium perfringens ATCC 13124]  ali follow..  13  1MNRLAMGFLLTGCGGGSRANIIKISGSSSVGPLVEAEAEVFKKEPDITVEVNQLGSSAGIKDAINGTVEIGISSRDLKEKELESG-------KEKPIAYDGMSVIINNENP-----VQNLTMEQIRDIYTGKITNWKEVG-----VLVSREDGSGTRDAFQEIVAQISDGSGSIKTMVAGNKNAIGYISFSYVDDSVHAVSIDGVKPTAENVQNLLVYKEENLNENSKKFIDFIMSKEGQEIVEEDGL.. 268
21 -20.800IDP91442 ABC-type phosphate transport system, periplasmic component [Vibrio vulnificus CMCP6] VV1_0466 [Vibrio vulnificus CMCP6]  ali follow..  12  1MKRWWLSLLLMGGISASASGNLLSVGSDTLAGMTTLWVEEFKAYPNINAQVQASGSSTAPPALTEQTAQFGPMSRPMRLREVEAFERTHGYKPTARVAIDAIGIFVHQDNP-----VQGLNFPQLDAIFSATLRCGAEDFVSTWAQLFGRNSVSGTYGYFKKHALNEQPGSASVVQSVASTLSGIGYSGVGYRVAGVRLLPIAKQGNEFVYPSRENILTGDALSPIEAEFIKFIYSAQGQALVEKDGY.. 300
22 -20.200IDP05439 hypothetical protein lmo2499 [Listeria monocytogenes EGD-e] lmo2499 [Listeria monocytogenes EGD-e]  ali follow..  16  1MKKKYLGIVAMLAADKEVSGSLTAVGSTALQPLVEAASKEFTNTPKAQINVQGGGSGTGLTQVQQGAVEIGNSDVFAEEKDGVDASKLVD----HRVAVVGMAPVVNKDVGVKTTNWKDVGGKDEKITIINRAEGSGTRATFEKWGLDGKTPIKAQEQDSSGTVRKIVSETPGAISYLAFSYIDASVVGLSLDGVEPTEDKVA--TNDWKIWSYEHMYTNGEPKGLTKTFLKYMTSDEVQNIVPQLGY.. 282
23 -19.900IDP04389 gene: pstS; phosphate ABC transporter, phosphate-binding protein [Clostridium perfringens ATCC 13124] CPF_0617 [Clostridium perfringens ATCC 13124]  ali follow..  15  1MFKKRLIAIIGTISEAKSTNSVSISGSTSVGPVMEAEAEAFTKKPDVSIEINQIGSSAGIKNAMEGVSEIGMASRDLKGEEKQAG-------KEVEIAYDGIALITHKNNPVKITNWKELGGNDAPIVV--------SREDGSGTRDAFQEIVGFKAEELTVNSQISDGS-GNIKSLVQGNENAIGYISFSYV---DDSVSAVKVDGVEATPENVLVYKEENLTESGKSFIDFILSEEGQDIVAKEHL.. 272
24 -18.500IDP01418 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VC1424 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  1MKNKLFASALCAANAMAKDQELYFYNWSEYIPS--EVLEDFTKETGIKVIYSYESNESMYAKLKTQGAGYLVVPSTYFVSKMRKEGMLQEIDHSKPYIWGATGIGINTDDKKSLKNWGDLWDAKWAGQLMLMDDAREVFHIALKLGYSPNTTNPKEIKAAYRELKKLMPNVLFPANPYLAGEVSLGMLWNGSAYEGAPIQIIWPEKGTIFWMDSISIPAGAKNIEAAHKMIDFLLRPENAAKIALE.... 287
25 -18.300IDP01395 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein, putative VC0704 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  15IKRFLSLMVLNTVCYQASALELNVYLWEDTIAP--SVVEAWHKKTGVSVNLFFDNDDERSLLMLKSVQLPFMVLDNVSAFIFSRQNVFEDLTALVPYFWGSVGIAYRKSLDKPPTQWSEVVDIAPAHRGRVGMLKDSVETLLPALYMLNASPITRLLDAANPHILTYEYVLSYVRSHPQTDNLHMAVSYSGDHYSLNRFFNSVPEGRPYLWVDCMAVNSVSPNTVQAKAFLDFLMKPDIAAINAEY.... 296
26 -18.300IDP00421 gene: potF; putrescine transporter subunit: periplasmic-binding component of ABC superfamily YPO1331 [Yersinia pestis CO92]  ali follow..  11  13...AAGLLMAASVSASAEEKILHIYNWSDYIAP--DTLANFQKETGIKVVYDFDSNEVLEGKLMAGSTGFLVVPSASFLERQLSAGVFKPLDKSK-IGYNVEKVKAVLGEDAPVNSWDLVLKPENLVSFLDAPSEIFATVLNYLGKDPNSTLTADYTGSATDLLLKLRPNIRQYINDLANGDICVAVGWAGDIMQASNRAKEAKNGVNVAYSIPFAMPTDAKNQDEAYQFLNYLMRPDVIANISNH.... 310
27 -18.200IDP01506 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VCA1113 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  1MKTFIKGLVLSAVSQVYAEQTLNVYAWGGYLPE--KSLKAFEQQEGVTINYSFENNESMYTKLKLLKDVVFASAYFIEKMGREGLLAEIDHNQIPNMKDAMPTVLGLAHDPQNITKWADLWDKQYEQQVMLIDDIRDVFGMALLNGFSINTKNEEEIKKAYESLVALKKNVLAPHVPYVSGEATLGMQWNGNAYEMPELKFVMPEEGAVLWMDNFTIPSGSKNIPLAHKFINFMYQPENQAEIVQS.... 285
28 -18.100IDP05035 gene: potD; spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Bacillus anthracis str. Ames] BA_1300 [Bacillus anthracis str. Ames]  ali follow..  15  1MKLTKRLAGAAISGCGEKKEELNIYSWADNFDE--QVLRDFEKKYNVKINYDYASNEEMLAKLQAGGAKYLIQPSDYMVKTMAKMDLLAPLDKKNVYTWGVTGIAYNKKYKEAPTSWTDLWNEKYKGHVTLLNDSREVLGMGLKNGFSNSTKDDAQLKTAATDLQKLLPNLLNIKQKFITEDAWIGTVWSGDAADNKDVEYVVPKEGGTIWADTLAIPKGAKNKELAEKFMNYLLDEKVSVKNYES.... 286
29 -17.500IDP91991 spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100001132 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  14  1MKKIYSFLAGIAAINSRDSQKLVIYNWGDYIDP--ELLTQFTEETGIQVQYEFDSNEAMYTKIKQGGTTYIAIPSEYMINKMKDEDLLVPLDYSKPYFWGTLGIVYNETMDEAPEHWDDLWKLEYKNSIMLFDGAREVLGLGLSLGYSLNSKDPQQLEETVDKLYKLTPNIKEMKGYMIQNNVAIGVTFSGEASKNENLRYVVPTEASNLWFDNMVIPKTVKNQDSAYAFINFMLKPENALQNAEY.... 296
30 -17.500IDP04270 gene: potD; spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Clostridium perfringens ATCC 13124] CPF_2226 [Clostridium perfringens ATCC 13124]  ali follow..  13  3LKKFLALTCSTLLTQDKNNNVLYVYNWGDYIDP--ELLTKFKEETGIDVKYDYDTNEIMYQKLNSGNVSYIVIPSDYMIEKMKEEDMLAKIDYSNPYMWGTVGIIYNTKRSDPVDSWNILWNPKYKDQVIMPDSVRDAMAVAEKENLDQIEAAKKELMTQKKDGLILAYMVDQVKDAMVGGEASLAVAWSGDAVRNPDLAYAIPKEGSNKWFDAIAIPKNAKHKENAEKFINFLCDPENAEQNVEY.... 301
31 -17.400IDP05673 hypothetical protein lmo0810 [Listeria monocytogenes EGD-e] lmo0810 [Listeria monocytogenes EGD-e]  ali follow..  14  1MKQLLKIFVPVIVEGYAGSNTLTIYNWGDYIDP--SLITKFEKETGIKVIYQFDSNEAMMTKIEQGGTTFIAVPSDYAISKMKEENLLIPLDHSKPYFWGTLGIIYNKEPDKNFDTWNALFDPELKNQILLIDGAREVMGLGLSLGYSLNDTNKAHLQAARDKLETMTPNVKEIKLLMADNEAGVAVTFSGEAAENEDLEYVIPKDGSNLWFDNMVIPKTAKNVDGAHKFINFMLKPENAAINAEY.... 297
32 -17.400IDP01699 extracellular solute-binding protein [Yersinia pestis CO92] YPO3343 [Yersinia pestis CO92]  ali follow..  14  3MKKLSLGIMVLALISSQQSGELRIGVPGDYAP---DMANAFGEDLKLKVNFVSTSWPTLSDDLAADKFDIAMGGVTATPGREAQFA-------SHAVVKNGKIALTHCQKVNKFPTLDAIDRQNVKVIVNPGGTNQSFV------------------ANIKQAQIIRTKDNVANLQGIRNKSADIMFT-DYYQSKEPGVFCVATPEVLAGTGSYKVYMMAKDNQPLLEEVNQWLAGKTKTLLAQKW.... 252
33 -17.300IDP01419 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VC1425 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  24MKKLATLLAGSACAAAAEDKELVFMNWGPYINS--GILEQFTKETGIKVIYSYESNETLYAKLKTHNQGYLVVPSTYFVAKMRDEGMLQKIDKSKPHVVAITGLAVNTDDPNDFQSWGDLWKPELKGQLMLMDDTREVFHIALKLGYSGNSTDDKQIDEAYAELQKLMPNVLNPAAPYLSGEVGLGMLWNGSAAEGLPIKLVFPKEGGIGWVDNFAISSGAKNVDAAHKMIDFLLRPEIAEQISRD.... 312
34 -17.000IDP05020 gene: potD; spermidine/putrescine ABC transporter,substrate-binding lipoprotein [Clostridium difficile 630] CD1027 [Peptoclostridium difficile 630]  ali follow..  14  16...MIVTLFTGCNKATDSTKVLNVYNVGDYIDE--SLIDKFEKETGIDVQYSYDTNEMMYQKVKSGSTHYLVFPSDYMVEKMKNEGLLEKLDFKNAYMWGTLGILYNKKEKDPMDSWNILWNPKYKGNIMMFDSVRDTIGITLKLGYSMNSVNPKEINEAKNLLMKQKDLVLEGKDRLLGGEVAMGMLYSGDAVQNPDLDYAIPKEGTNKWVDAMCVPTTAQNKKEAELFINFLLDPENAKVNAEY.... 293
35 -16.400IDP01503 amino acid ABC transporter, periplasmic amino acid-binding protein, putative VCA0978 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  2MKSIATLISVVLCSFSAWAQTITAAQDAQQKGLSVDIVTAAFATQGYTVEFTIMPWSRALNDVKEGKIDILPAT------FTQERTAYLTYSD--NYLTNQVKFIKKAGDNFEFAGLASLNGKKVGIVRGYGYGDE--------------------FMNDPSFFRPESTDLKQNLQKLQAGRIDLAVVAKSIITEAGMNLADFAFTNQAISENPLHVTSGKANPRSEELVAAF-ANGTFDKLLADYGIK. 243
36 -14.300IDP91967 amino acid ABC transporter, periplasmic amino acid-binding protein, putative [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100008960 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  4MKKVLMTMFGLVMLEAIKSKGKLVVALNPDFAPFEELAKAIATELGVELELSPMSFDNVLASVQSGKADLAISG----VSKTDERSKVFDFST--PYYTAKNKLIVKKSDLATYQSVNDLAQKKV------------GAQKGSIQETMAK-------DLLQNSSLVSLPKNGNLITDLKSGQVDAVIF-AKGFVENNPDLAIADLNFEKEQDDSYAVAMKKDSKELKEAVDKTIQKLKESGELDK..... 256
37 -13.700IDP01356 amino acid ABC transporter, periplasmic amino acid-binding portion VC0010 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  1MKHWFALAALALSSATVQAATEVKVGMSGRYFPFTDVWNEIGKRNDYKVEFVTANFSGLLGLLETGRIDTISNQITITDARKAKYL-------SDPYVIDGAQITVRKGNE-AIKGIDDLA------------GKTVAVNLGSNFEQLLR-------NHDKDGKINIKTYDTGIEHDVALGRADAFVM-ALELIEKTGLPLQLAGSPFETIENAWPFVNNEKGQQLQGEVNKALAAMRADGTLSQ..... 236
38 -13.700IDP91402 ABC-type amino acid transport, signal transduction system [Vibrio vulnificus CMCP6] VV1_1001 [Vibrio vulnificus CMCP6]  ali follow..  16  1MNNWIKASIAAIATFQAVAEEVVKVGMSGRYFPFTDMWDEIGKRNGYKVEYVTANFSGLFGLLETGRIDTISNQITMTDARKAKYL-------ADPYVVDGAQITVRKGND-SIKGVADLA------------GKTVAVNLGSNFEQLLR-------DYDKDGKINIKTYDTGIEHDVALGRADAFVM-ALELIKKTGLPLQLAGEPFETIANAWPFVNNERGVKLQGEVNKALAEMRADGTVEQ..... 238
39 -13.600IDP05446 hypothetical protein lmo1738 [Listeria monocytogenes EGD-e] lmo1738 [Listeria monocytogenes EGD-e]  ali follow..  11  1MKKGLLITVMLMVMSRIKKDKEVVIGLDDSFVPMGDLAKAVFAEYGIKAKFTPIDWTMKESELKNGSIDLIWNG----YTVTDARKKQVAFSQ--PYMKNEQVLVTLKSS--NINQFSDMKNKTL------------GAQNGASSIDDMAKKPEVLTDIINNNEPELYDTFDTAFIDLNNKRIDGLII-ARYYIDKQKNKDDYNIITGGFDATDFAVGMRKSDKELQKKINEAFEKLYKEGKMQE..... 257
40 -13.400IDP00474 gene: glnH; glutamine ABC transporter periplasmic protein YPO2512 [Yersinia pestis CO92]  ali follow..  14  1MKSLLAALALAFAVSAYAAEKELIVATDTAFVPFEDLWDAIAKKLDLKYTLKPMDFSGIIPALQTKNVDLALAG----ITITDERKKAVDFSD--GYYNSGLLVMVKADNN-DIKSEADLQ------------GKVLAVKSGTGSVDYAK-------ANIKTKDLRQFPNIDNAYLELGTGRADAVLNILYFIKTAGNGQFKAVGESIKAQQYGVAFPQGSDLREKVNAALKSLKEDTYAEIYKKW.... 241
41 -13.400IDP91966 ABC transporter substrate-binding protein - glutamine-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100001092 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  11  3SKKWIFVLCNFLASEAIKQKGKLVVATSPDYAPFEDMAQAIADELGVKLEILSMSFDNVLTSLQTGKADLAVAG----ISATDERKEVFDFSI--PYYENKISFLVRKADVEKYKDLTSLESANI------------AAQKGTVPESMVK-------EQLPKAQLTSLTNMGEAVNELQAGKIDAVHM-ALSYAAKNAGLAVATVSLKMKDGDANAVALRKNSDDLKEVVDKVIQKLKDEGTYQS..... 258
42 -13.300IDP04366 amino acid ABC transporter, amino acid-binding protein [Clostridium perfringens ATCC 13124] CPF_1531 [Clostridium perfringens ATCC 13124]  ali follow..  11  1MKKLLFLLISIVILSTKKDSNTVIIGIDDTFVPMGDLSKEAFKRMNLKVIFQPIDWSMKETELTNGNIDLIWNGYTMTHEREKKVA-------TNSYLKNRQVIVTLSNS--NINTLNDLKGKTV------------TTQDGSSSLDTLFE-RPKLTKSFKNGEPVLFDSFNDCFMDLEAGRSDAVVLAQYYIFKNDPSKFHVLTEDLGEESYSIGLRKNSNLIDHLNKTLEDMKEDTIAKISNKW.... 255
43 -13.300IDP05633 amino-acid ABC transporter,substrate-binding protein [Clostridium difficile 630] CD2177 [Peptoclostridium difficile 630]  ali follow..  13  1MKKLKLIIMFALVSKNKEEQKVIRVATSGTYYPFADFWDEFAKRTNCKVEWVLTDFSGLFGLLEADKADAVSAQ----LTATPEREKKYAFSD--AYNYSGTNIIVREDD-TSIKSIDDLV------------GKKVGVGTGAVANEILKEKYPNDEIKIV---NYSSATLKGNYQDLEMGRLDAVVA-ALIAIKEQKLNLKMIEPPIQFGACSFALQKNEKGEKWTKEINEVIEEMYKDGTLTK..... 250
44 -13.300IDP01901 gene: artI; arginine transport system [Salmonella typhimurium LT2] STM0890 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  1MKKVLIAALIAGFSLSATAAQTIRFATEASYPPFEDLANALCKEIDASCTFTNQAFDSLIPSLKFRRFDAVMAG----MDITPEREKQVLFTT--PYYDNSALFVGQQGKYTSVDQLK---------------GKKVGVQNGTTHQKFIM-------DKHPEITTVPYDSYQNAKLDLQNGRIDAVFGDTAVVTNPKLAPVGDKVTDKDYFGTGLGIAVRQGNTELQQKFNTALEKVKKDGTYET..... 235
45 -13.300IDP91975 ABC transporter substrate-binding protein - glutamine transport [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100009843 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  13  1MKKWMLVLVSLMTASKYQSNKSITIGFDSTFVPMGDLATAVFEKYGITVNWQPIDWDLKEAELTKGTIDLIWNG----YSATDERREKVAFSN--SYMKNEQVLVTKKSS--GITTAKDMT------------GKTLGAQAGSSGYADFEANPEILKNIVANKEANQYQTFNEALIDLKNDRIDGLLI-ANYYLEAEGVLNDYNVFTVGLETEAFAVGSRKEDTTLVKKINEAFSSLYKDGKFQE..... 259
46 -13.200IDP00526 gene: artI; arginine-binding periplasmic protein 1 precursor YPO1351 [Yersinia pestis CO92]  ali follow..  11  1MKKLIIATVLASISLSASAAETIRFAAEATYPPFEDLANALCKEMQADCTFTNQAFDSLIPSLKFKRFDAVISG----MDITPERQKQVAFTQ--PYYDNSALFIAQKDKVADLAALK---------------GKRVGMQNGSTHQKYLM-------EKHPEITAVPYDSYQNAILDLKNGRLDAVFGDTAVVQNDQLAAVGDKVTDADYFGTGLGIAVRQSNTELQGKLDAALTKVKADGTYQT..... 235
47 -13.000IDP02726 maltosaccharide ABC transporter, maltosaccharide-binding protein, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA4229 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  1MKKALSLLTVSALSKAKKDYDLLVWEDDKKGVGLEPAVKSFEEKYKVKVKVVEMQMTDQVKKLRLDGPDVVTLPHDQIGNAVTEGLLSEVKADDAPKAIETPVFIYNKK-PKAPETMDELFNFSKEFVFGEKDGKPNASDVGLNNSGAVQGAEY-YKEKLFPKGIIGESGGPAADGLFNEGKAASIMN--QAMEKNGIDYGVAPMPKLPN--KGWHVTSFSKQNDLATKFTEWVTNEENAKIRFE..... 333
48 -12.600IDP05761 hypothetical protein lmo2125 [Listeria monocytogenes EGD-e] lmo2125 [Listeria monocytogenes EGD-e]  ali follow..  12  1MKRLVMALSLAACGGGKDTSTLTVSVDAGYKDYVNKIKGDFEKDNDVKVKVVEKDMFETLEALPLDAPDVMMSAFDRIGSLGQQGHLAEVKLGNKPAIIETLVLYYNKD-PATFKDLETLSKDGGYVFGDEGTNPKDIGLNNKGSVEGITYATKWFQDVWPKGMQDNKSADDFIQDQFVKGKAAAILG--ANYKEAKINYGVAKIPTLNN--KGWVVSNYSKNKDVAQKWLDYVTNQKNQETLYDMT... 337
49 -12.600IDP04547 amino acid ABC transporter, amino acid-binding protein [Clostridium perfringens ATCC 13124] CPF_0581 [Clostridium perfringens ATCC 13124]  ali follow..  14  6FKKILSVAMIGGLTAKIKESGKLVVGLSADYAPYEDIAKEVAKNLGVDLEIKEMEFGAIIQSVKNGMIDMGISG----ITPDEKRKEAVDFSD--IYYEAEQGILINKDNKESIKGIGDLKGKKVGAQMG--------------------SIQAEIAKGIEGADVKLLDNVNTLILELKTGKLDAVIVAKIASEVNSELAVADEVIKNSEGGSAIAIQKGNKDDEVNSTIKELKESGKIDQFTNDA.... 267
50 -12.600IDP02597 putative sugar binding protein [Yersinia pestis CO92] YPO3472 [Yersinia pestis CO92]  ali follow..  14  1MKTSLLLLTYLAMGIPSLHAAETLRASNDSKNIYKKEADTFEKKTGIKIEYFNATTDRLARAAAGNALPDLIFNDAVAIGQFVQLGIVEPIEPKVPTSAQTFALFVRKDEKLGLENWQDISTLAKAFTFNDPDGNGKNDTYGFI-EEPAATETLSFMRGMVCDKTVQPGTTADAIPSFRSGQSGMFFIALFDKDPGTEAFEVIPPPTGPK--TTVFMMKSSQKKAAAQKFIEFMISPEGQQI........ 341
51 -12.400IDP01925 gene: fliY; cystine transporter subunit [Yersinia pestis CO92] YPO1846 [Yersinia pestis CO92]  ali follow..  13  6VRRRIVLGMVAVALEQVKQRGTLIVGLEGTYPPFSDFANALAEHMGVKAKITPTKWDGMLASLESKRIDVAINQ----VTISDERKKKYDFST--PYTVSGIQVLTKKGNEGQFTKPEDLQ------------GKKVGVGLGSNYEQWLR-------ENLKDVDIRTYDDDPTKYQDLRVGRTDAILVDRLAALDVKKTNDALAVAGPAFARQESGVAMRKNNPELLAAVNNAIAEMQKDGTLAK..... 254
52 -12.400IDP91962 amino acid ABC transporter, amino acid-binding protein, putative [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007760 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  11  1MKKFSLLLAILPFPKETSAQKTIVLATAGDVPPFDEVLKAVDEKLSYEIQFQRTAWESIFPGLDSGHYQAAANNLSYTKERAEKYL-------SLPISNNPLVLVSNKKN--PLTSLDQIA------------GKTTQEDTGTSNAQFINNWNQKHTDNPATINFSG-EDIGKRILDLANGEFDFLVF-SVQKIIKDRGLDLSVVDLPSADSPSNYIIFSSDQKEFKEQFDKALKELYQDGTLEK..... 248
53 -12.100IDP04377 putative maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein [Clostridium perfringens ATCC 13124] CPF_2652 [Clostridium perfringens ATCC 13124]  ali follow..  13  1MGKMLFAGSLVGCGGKSDSGELTVWSTTPEVEELNKMASKWGEENGVKVKVVEDKSQAYIQAANSSGPDIMFGLAHDNLGTFQKAGLLAEVPEGIPIAQETSALFYNKD-PKTMEDLVKVAEEGAGFVYKDNNGTLDPTDIGLGTPGAIKGYQFVQDLVQKDKLMPADITGDIAKGDFLSKNTGFYISWDVSAFKDGGVFGVAPMPTLFGKQVPAFVSEKSQNKDLAWKLVKYLSENSGDVLLNKGN... 329
54 -12.000IDP90739 lipoprotein, NLPA family [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0772c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  1MKIKSLFIASILTLSANALETITVAATPVPHAEILEQVKPDLEKQGYKLEIEFTDYVLPNLAVDNGEADANFFQHTPYLEEFNK-------NKGTKLIKVAAIHIEPMA-SKKYKSLDDI-KEGVKIAIPNDPTNESRAKKGLVKFKDKALKTPLDIIDNPKKIKFVELKPAQLPRAL--NDVDFAVIYALSANLNPAKDSVFIEDKESPYANILVVRVGHENDPKIKALIQALQSDKIKQFIIE..... 247
55 -12.000IDP90590 lipoprotein, NLPA family [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0770c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  3IKKIFLSVLFTISLSFGADKTIIIGATPTPYAEILNFSKPLFQEKGWKLIVEFNDYNIPNIALNEKDLDANLYQHKPFLDDFNT-------HKGTKLSSLGAIVLVPMA-SNSIKDIKDI-PNGAKIAIPNDATN-ESRALDLLAKANLIEFKSQSTLKTPIDISKNPKKLKAAQLPRALNDTDLAIIYALGAGLNPLKDGIFMEDKDSLYAIVLATRKGEETSQKSLVIKEILTSDKIKNFIIE..... 248
56 -12.000IDP01968 gene: fliY; cystine transporter subunit [Salmonella typhimurium LT2] STM1954 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  69...................................DFAEALAKHLGVKASLKPTKWDGMLASLDAKRIDVVINQ----VTISDVRKKKYDFST--PYTVSGIQALVKKGNEGTIKTAADLQ------------GKKVGVGLGTNYEEWLR-------QHVQGVDIRTYDDDPTKYQDLRVGRIDAILVDRLAALDVKKTKGTLAVTGDAFSRQESGVALRKGNEDLLKAVDNAIAEMQKDGTLKA..... 254
57 -11.900IDP91126 extracellular solute-binding protein, putative [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00176 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  11  1MSKILKCITLAVVNSKDKPNQLTMWVDGD-MAFYKKITDQYTKKTGIKVKLVNIGQNDQLENISLDGPDIFFLAHDNTGSAYLQGLAAEIKLSKDPAIVETTALFYNKK-KNAPQTLEEVEANAAKLIFKKNGSEYDIHQLGLNSKHVVKNAER-LQKWYDKGYLPKAATHDVMIGLFKEGKVGQFVNINEYQETFGKDLGVTTLPTDGG--RGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTD..... 338
58 -11.900IDP05433 hypothetical protein lmo1730 [Listeria monocytogenes EGD-e] lmo1730 [Listeria monocytogenes EGD-e]  ali follow..  14  1MKKKMFVVLALVLANSGDSKVLNVWAMGDEAKSLKELAQKFTKDTGIEVKVQVIPWANAHDKLLTAGPDVVQMGTTWMPEFVEAGALLDITKETRVLFYRT--LLKKVGYNEAPKTWDELSDAALKLSKRGK-SPLFDKDGTPVFNKKPFVDTVTYLDSFIKNAPDTDLGLDASQSFGGDGIVPMFMTLKDTAPDIDGKWATAVLPKKEN--ANLSIFKYSDKKDDALKFMDYMSQPDVQLSWLK..... 334
59 -11.900IDP05398 putative phosphonate ABC transporter, phosphonate-binding protein [Bacillus anthracis str. Ames] BA_3750 [Bacillus anthracis str. Ames]  ali follow..  13  2LKKFFAMSTTVVLAKGYVPKTLNV-NADTLEAKAKPLEKLLSDKLNIPVKVSISTNNTIVEAMASKQVDVGFLPPTAYVLAHEKKAANVILQAQRFGVDDETEFVVKKDSN--INSVKDLKGKKI------GYQDVTSSAGYVWPAAVLLKEGVDPLKDVK---PVTLKGHDQSLIALLNGDVDAAVVFQDARNIVKKD-QTKIVKFTEKIPNDTISVRSDLDEEWSKKFIEIGKNEEGHKIIKE..... 284
60 -11.700IDP05245 hypothetical protein lmo2349 [Listeria monocytogenes EGD-e] lmo2349 [Listeria monocytogenes EGD-e]  ali follow..  13  1MKKKYGILALALTAAANQKVQTITVGTGTQFPNVCELVKEIDKRPGYKFKFKTMDFSNLLVSLGAGKVDIVAHQMEKSKEREKKFL-------NDVAYNNFPLQLTVLDSNNSINSTKDLA------------GKRVITSATSNGALVLKKINEEQGNNFE--IAYEGQGSNDTANQLKTGRADATIS-FAVDFQNKTSAIKEKVVGDVLSNAKVYFMLGKDETKLSKKVDEALQSIIDDGTLKK..... 254
61 -11.600IDP05370 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_5220 [Bacillus anthracis str. Ames]  ali follow..  16  1MKKLLLTALISTSGKDNDEKKLVVGASNVPHAEILEKAKPLLEKKGIELEVKFQDYVLPNKSLADKDLDANYFQHIPYLEKEIK-------DKKYEFEVAGKIHLEPIG-SQKYKSLKELPDGATIIMSNSVADHGRGLAILQKEGILKIKDGVDPVKATPKDIADNPKNLKLLPQVYNNKEGDAVLIYAIDTKLNPEKDAIAIESNDSPYANVVAVRKGDKDKKEIKELVEVLHSKEIEDFINK..... 259
62 -11.600IDP05024 ABC transporter, substrate-binding protein, putative [Bacillus anthracis str. Sterne] BAS4675 [Bacillus anthracis str. Sterne]  ali follow..  2LLAVFTFAACSSKKEGTKEQTQNIRIGLFYAPLYVGIEKGFFKDEGLNVDLQTAGGDKTMTALLSGGIDIALVGSETSIYVHQQGAKDPIINFAQLTQTDGTFLVSRKKLD--SFNWNDVKGVTFLGQRKGGMPQ-------MVGEYVLKKNGIDPHKDTN---LIQNIEFANIANAYASGTGEFVQLTASIFEKEGKGYIVASFGNESGTVPYTSFMAKKKDKAAAEKFTQWVDTHSPEEI........ 251
63 -11.600IDP05634 amino-acid ABC transporter,substrate-binding protein [Clostridium difficile 630] CD2174 [Peptoclostridium difficile 630]  ali follow..  11  21...LTFVITGCSKKEEVKNEKVITVASSNSADPYSDMWKEIGKRSGYKIKMEPTGFSSIFGMLDSGKVDVAANFFGMSKERLEKYD-------SIPYGSDSVCIAVKDGN-NEINKLEDLK------------GKVVAVSEGSQGQQVATSVNKDNLFQEKV------GDGTSGLQDLDLGRVSAWIDAELTIVGDAKKANMKVRVLDKKLSATNIAYFFKKNDDKSKTIKEDV--NKAIEEMLADG... 250
64 -11.600IDP05415 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_5219 [Bacillus anthracis str. Ames]  ali follow..  17  1MKKILLSVVTALSVGGKEENKLVVGASNVPHAVILEKAQPILEKKGIKLEIKFQDYVLPNKALADKEIDANYFQHIPYLDKEIQ-------EKGYKIVNAGKIHLEPMG-SKRYKSLKDLPDGGTVIMSNNVAERGRMLALLQKGGVIKLKDGVDVVKATVKDVVENPKNLK-SPKLYENNEGDALFIYAIDAKLNPTKDAIAIEGSDSPYANIIAVRKGDEKKKEIKELVEVLHSKEIQDFINK..... 257
65 -11.500IDP06544 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09718 [Enterococcus faecium DO]  ali follow..  13  1MKKIIVTTCLLATSNESQQTTIQFMVEQERLSVINELVADFEKEPDIKIKQVPVEESAFNTKIVTKLPEVMEVSQDFAKVMDKDELIDQTAVQNVPISGWVQGIWYDKESEAGFSNWDDILKIAQHFTDKEN-ANVLDDEGEVTIDTEKMREALSFYQNLSQYTMPGSNDVTEIKDAFMNGTAPMAIILPSVYEAGNSENIGFAIPTQKD--LTISSGLDEKQKEAAEAFTAFLSQPKNMEKWVL..... 336
66 -11.500IDP91891 putative glutamine-binding protein precursor [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007700 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  1...MISLFGLAAAKPVQADTSIDIQKRGELVVGVKDLAKMVADELKVKIRYVPVTAQTRGPLLDNEQVDMDIATFTITDERKKLYN-------TSPYYTDASGFLVNKSA--KIKKIEDLNSKTI------------GVAQGSITQCLITELGKKKGLTFK---FVELGSYPELITSLHAHRIDAFSVDRSILSGYTSKRTELLDDSFKPSDYGIVTKKSNTEDYLDNLVTKWSKDGSLQKLYDRY.... 244
67 -11.400IDP05563 hypothetical protein lmo2417 [Listeria monocytogenes EGD-e] lmo2417 [Listeria monocytogenes EGD-e]  ali follow..  15  1MKKVLGLIFTLSLSSSKDDKQLVVGASNTPHAQILEQAKPILKDKGIDLKIKYTDYVMPNKALEEGDLDANYFQHKPYLELEEK-------EKGYKFADVGAIHIEPMG-SKKVKDIKDLKDGAQVLLSNSKSDWPRVIGIFVDNGLLTLKDGVKPQDATFDDIKDNPKNLKYLMTAYNNEEGDVVAIFVVDQGLNPSKDAIAIESKDSPYANIVVTTEKKKDDKNITELVKVLHSKEIQDYITK..... 265
68 -11.400IDP05042 putative sulfonate ABC transporter, sulfonate-binding protein [Bacillus anthracis str. Ames] BA_2921 [Bacillus anthracis str. Ames]  ali follow..  17  1MYKKFKVLSFTLASSKKEDVTVQIIQQGLSPLLLAQKKGWFEEEEGVKVKWTEFQSGPPYFEAIASNRLDFGEVGNSPVISAQAAGIGFTEIANTSYARKGTGILVQKDSK--ITSIKELKGKKI--------AVAKGSSAFNLLYRALDKEGIN-----AKDVNVIQLQPDEAQPAFESGSVDAWAIWDSLHTVNKGAKVITDGERLNVSSPEFLIARTKEHPELVEKFLKVYEKDEAIKIYTS..... 262
69 -11.400IDP05630 amino acid ABC transporter, substrate-binding protein [Clostridium difficile 630] CD1774 [Peptoclostridium difficile 630]  ali follow..  12  5LKKVGIFTIMLGLLASKESKKEVVVGFDNTFVPMGDLAKETFKRLGMEVKFQPIDWSMKETELNDSKTVDVLWNGYSITDERKKI-----VSYTEPYLQNKQIIVTLSDS--KINSKADLKDKEV------------GTQQGSTALDAVEK-DKDFMNSLKGGAPVLYDTYDKALRDLEIGRTSAVVGDEVLIRMGQKGEDKYKVLKDDFGLEDYVVATSKENPELCEKINETLKEMKKDKIYDKW-FK. 267
70 -11.300IDP05714 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_0175 [Bacillus anthracis str. Ames]  ali follow..  15  1MKKVLLSIVSGAVVKALDEKKITVGVTGGPHEQIFEKVKEVAAKDGLEIDVVFNDYVAPNVSLDEKSLDVNSYQTKSYLDVFKA-------ERNMKLTEVFSTVTFPMG-SKSLKDVKDL-KDGDAIAVPNDPTNELRALKLFEKAGVLKVDPKATEKATAKDVIENPKNLKASQLPTQLSEVKAAAIFALGAKLSPAKDSIFREGKDSPYVNWVVVRTENKDDAVVNKLKKAYQSKEVKEFIEK..... 260
71 -11.200IDP05525 putative sugar transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD2550 [Peptoclostridium difficile 630]  ali follow..  15  9LKKLCSLAMVAIMTTDGEKEKLVLWVENNMKEVWDPILDKFEEKNNCEVDLQIIPWDNYSEKFATAGPDVGYMYAEMYPQFIESYGMPFQAANPGVLYYNK--ILEKLG-PKTWEDFKRICKK----ATQDTDGDGKIDQWGLAQGPYLWQAGGDIFNDDLKSVKFNDKSGLEAAKFLKPGKAAFTIMLSSAATSVFDESGFVTGLEDKKAATHLSLMSSAKNKELAYKLIQHMLSVESMTEFHK..... 353
72 -11.100IDP91961 ABC transporter substrate-binding protein - amino acid transport [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005438 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  1MKKIVKYSSLAALGEAASKKEIIVATNGSPRP---EVVRAIFKDSDYDVKFEKTEWSGVFAGLDADRYNMAVNNLSYTKERAEKYL-------AAPIAQNPNVLVVKKDD-SSIKSLDDIG------------GKSTEVVQATTSAKQLEAYNAEHTDNPTILNYTK-ADFQQIMVRLSDGQFDYKIF-VETVIKNQGLDNLKVIELPSDQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEK..... 258
73 -11.000IDP05119 ABC transporter, substrate-binding protein [Clostridium difficile 630] CD2989 [Peptoclostridium difficile 630]  ali follow..  14  17...TASLAGCAKKNNGEKLSEINLTYVKSPLNVPSIIQKQFGKKDNIKVNFHITTGPEQTQALAAGEIDFLHALGGTSALIAASNGVELKILNTYSRSPKGFMILTNNNS---IKSAADLVGKKV--------AGPKGTILHQVLISALDKEGLS-----MDDVEFVNMGIPEASAALSDGSVDAALIAGPAALKAMKSGSKLVANGEGLVDGIIVTAVSEKHPEIVERFMKVEKEDEAMEKVAK..... 262
74 -10.900IDP90639 lipoprotein, NLPA family [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0771c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  5...KIIILACILNLSSLFAQNITIGATPNPFGSLLELMKDDFKNKGYELKIEFSDYILPNRALEEKELDANLYQHKPFLEEYNL-------KKGSNLIATTPVLIAPVG-SKKIKNLENL-KEGARVAIPNDATNESRAKAKLIELNKNTLKTPLDINKNPKKLKFIELKAAQLPRAL--DDVDIAIIFALGAGLNPSKDTIFREDKNSPYVNYVVVRSEGKNSEKTKVIDEILRSDKFKAIINE..... 246
75 -10.700IDP02207 putative sugar binding protein [Yersinia pestis CO92] YPO0612 [Yersinia pestis CO92]  ali follow..  11  1MKILYYIAIAIASLPLMAAERLEIMSGSYVSFMRNTVTPEFNKYPEVNLVVSN--DEQLDTRMAAGNPNVYIGVFGYQPAKLAKLGKLAYLDKFIPWNATTQMMIYNKEAEAGLATWDEFLLAAEKISALPP-RSDGSKVYGTVTDIVFDRPDANMAQFMRTMQQAQRFAPLTMEKSFFSRNIGMWLQFGFGWKATLSSAAIAPIPVQTKGDIHYSVLDEARKEQLSWALLNLLMRDDINLQANI..... 333

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.