current user: public

If you have questions about the server, please let us know.

Query: [E] COG0006 Xaa-Pro aminopeptidase, from VFDB

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# Score Template Links and tools%idFirst MNQNPIKRLQDSLVERALDAFLIEKDEDISYFLQDQARSGVLLITRDEAVLFVSPLDKDLYARIQDVVLVSYSKSVDQELGSYIENTGLKTIGFDSEYTPYGIAQKRMNSGYAFSPQSLVAEKLRCVKSTEEIQKMTRAAEIGSAGYDFVLAALRPGITEKELVRMLHVFWANLGIEKVSFPPIIAFGENAAFPHAIPTNRSLKKGDVVLIDIGVCYEGYCSDMTRTVAFGATPEQQLLDGYVAVAEAQRAAIEFCRAGVPCRDVHKEAVRILRAHGMEKAFIHGLGHGVGREVHEYPRLSPFSDATLQLNMAVTVEPGVYFPGVGGIRIEDTIMIGVNENLNLTNRKVSSEIIIILast
1 -65.000sp|Q9Y5B9|SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1  ali   18  2........................................................................................................DCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFEKVRHSKLAESVEKAIEEKKYLAGADEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVD--PSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKLLNKITKNLGFGMGIEFREGSLINSKNQYKLKKGMVFSINLGFSDEKTYALFIGDTVLVDEDGPATVLT-SVKKKVKNV 278
2 -61.000sp|P12955|PEPD_HUMAN Xaa-Pro dipeptidase OS=Homo sapiens GN=PEPD PE=1 SV=3  ali follow..  24  22LFALNRQRLCERLRKNP-GSIVVRQESFFHWAFGVTEPGCYGVIDTGKSTLFVPRL-KEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCSRGGMRHSSYTCICGSGENSAVLHGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEE-GAVFMPHGLGHFLGIDVHDVGGYPEGVERHLQPGMVLTVEPGIYFIGFGGVRIEEDVVVTDSGIELLTCVPRTVEEI.. 475
3 -60.400sp|Q9NQH7|XPP3_HUMAN Probable Xaa-Pro aminopeptidase 3 OS=Homo sapiens GN=XPNPEP3 PE=1 SV=1  ali follow..  22  72.YALRRHKLMSLIQKEAQDQTVVVQDNNFLYLCGFQEPDSILVLQSLKAILFVPRR-TDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQK-ARKYCPHHVGHYLGMDVHDTPDMP--RSLPLQPGMVITIEPGIYIPE--GVRIEDDVVVTQDSPLILSA-DCPKEMNDI 499
4 -46.600sp|Q9Y5B9|SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1  ali   16  9AYYRRVKRLYSNWRKGEDEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIFMASKKKVEFLKQIANLLIREKNESNKSSFDKMIEKNGKKIGVFSKDKFPGEFMKSLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIRHSKLAESVEKAIEEPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQ....................................................................................................................... 299
5 -45.100sp|O43895|XPP2_HUMAN(removed signalp:1-23) Xaa-Pro aminopeptidase 2 OS=Homo sapiens GN=XPNPEP2 PE=1 SV=3  ali   25  1.............................................................................................IGTSYTMYGIYEMIP-KEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKTVDEFSGAEIVDKFRGEEFSSGPSFETISASGLNAALAHYSPLNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGT-PSAFQKEAYTRVLIGNIDLSRLIFPATSGRMVEAFARRALWDAGLN--YGHGTGHGIGLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEATFEVVSFVPYDRNLI.. 278
6 -45.000sp|Q9NQW7|XPP1_HUMAN Xaa-Pro aminopeptidase 1 OS=Homo sapiens GN=XPNPEP1 PE=1 SV=3  ali   30  4.............................................................................................................KDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKGVTEISAADKAEEFRRQQDFVDLSFPTISSTGPNGAIIHYAPTNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGT-PTAYEKECFTYVLKGHIAVSAAVFPGTKGHLLDSFARSALWDSGLD--YLHGTGHGVGLNVHEGPSYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVTFEPLTLVPIQTKMI.. 272
7 -42.900sp|Q6UB28|AMP1D_HUMAN Methionine aminopeptidase 1D, mitochondrial OS=Homo sapiens GN=MAP1D PE=1 SV=1  ali follow..  24  83.........................................................................................................................GDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNV-DECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQ-VCPHFVGHGIGSYFHGHPEIANDSDLPMEEGMAFTIEPIITEDNQRSAQFEHTVLITSRGAQILTKLPHE...... 334
8 -41.000sp|P53582|AMPM1_HUMAN Methionine aminopeptidase 1 OS=Homo sapiens GN=METAP1 PE=1 SV=2  ali follow..  22  125.........................................................................................................................TSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEV-DDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFS-VVRSYCGHGIHKLFHTAPNVKNKAVGVMKSGHVFTIEPMICEDGKRSAQFEHTLLVTDTGCEILTRRLDS...... 377
9 -35.800sp|Q9NQW7|XPP1_HUMAN Xaa-Pro aminopeptidase 1 OS=Homo sapiens GN=XPNPEP1 PE=1 SV=3  ali   21  29..KDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDSYAIIGLETIMLFIDGDRIDAPSVKEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIP-KDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVTEISAADKAEFRRQQADFVDLSFPTISSTGPNGAIIHYAPTNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGT-PTAYEKECFTYVLKG............................................................................................................ 300
10 -29.400sp|Q9NQW7|XPP1_HUMAN Xaa-Pro aminopeptidase 1 OS=Homo sapiens GN=XPNPEP1 PE=1 SV=3  ali   33  5...........................................................................................................................................................................................................................................................SAAVFPTGTKGHLLDSFARSALWDSGLD--YLHGTGHGVGLNVHEGPSYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVTFEPLTLVPIQTKMI.. 122
11 -28.900sp|O43895|XPP2_HUMAN(removed signalp:1-23) Xaa-Pro aminopeptidase 2 OS=Homo sapiens GN=XPNPEP2 PE=1 SV=3  ali   25  2.............................................................................................................................................................................................................................................QKEAYTRVLIGNIDLSRLIFPATSGRMVEAFARRALWDAGLN--YGHGTGHGIGLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEATFEVVSFVPYDRNLI.. 128
12 -27.800sp|P50579|AMPM2_HUMAN Methionine aminopeptidase 2 OS=Homo sapiens GN=METAP2 PE=1 SV=1  ali follow..  19  160..............................................................................................................................QASEEIWNDFREAAEAHRQVRKYVMSWIKPGMTMIEICEKLEDCSRKLIKEGLAFPTGCSL--NNCAAHYTPDTTVLQYDDICKIDFGTHISGRIIDCAFTVTFN----PKYDTLLKAVKDATNTGIKCAGIDVRLCDVGEAIQEVMESYEVEIDIRNLNGHSIGQYRIHAGKTKGGEATRMEEGEVYAIETGHYMKNFDVGHVPIRLPRTKHLLNVINE.......... 408
13 -27.600sp|O43895|XPP2_HUMAN(removed signalp:1-23) Xaa-Pro aminopeptidase 2 OS=Homo sapiens GN=XPNPEP2 PE=1 SV=3  ali   20  44..QEKVSGVRSQMQKHVPTAVLLSALEETAWLFNLRASDSYTLLTDSSIRLFANKSRFSSETLSPMCVQIEDYSQVRDSIQAYSLGD--VRIWIGTSYTMYGIYEMIP-KEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKTVDEFSGAEIVDKFRGEEFSSGPSFETISASGLNAALAHYSPLNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSA......................................................................................................................... 300
14 -26.000sp|Q9Y5B9|SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1  ali   17  2.................................................................................................................................................................................................................................................YNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQELLNKITKNLGFGMGIEFREGSVINSKNQYKLKKGMVFSINLGFSEEKTYALFIGDTVLVDEDGPATVLTSVKKK..... 124
15 -24.700sp|Q9UQ80|PA2G4_HUMAN Proliferation-associated protein 2G4 OS=Homo sapiens GN=PA2G4 PE=1 SV=3  ali follow..  16  12..............................................................................................................................IAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKGIAFPTSISV--NNCVCHFSPLDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC-TPIEGMLSHQLK-VIDGEKTIKDHEKAEFEVHEVYAVDVLV-KEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLY.. 343
16 -14.500sp|O43895|XPP2_HUMAN(removed signalp:1-23) Xaa-Pro aminopeptidase 2 OS=Homo sapiens GN=XPNPEP2 PE=1 SV=3  ali   28..TMSLTALRQQMQTQNLSAYIIPGTERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEAGGRVGFDPFLLSIDTWESYDLSNRQLVSITTNLVDLVWGSERPPVPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPETAWLFNLRASD-IPYNPFFYS......................................................................................................................................................................... 241
17 -11.300sp|Q9NQW7|XPP1_HUMAN Xaa-Pro aminopeptidase 1 OS=Homo sapiens GN=XPNPEP1 PE=1 SV=3  ali   12  7..SELLRQLRQAMRNEPIQAYIIPSGCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQSNWTLMKMGLKDTPTQEDWLVSVEGSRVGVDPLIIPTDYWKKLRSAGHHLIPVKNLVDKIWTDRPERPCKPLLLGLDYTGISWKDKVADLRLKMAERNVMWEIAWLFNLRGSD-VEHNPVFFS......................................................................................................................................................................... 224

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.