current user: public

If you have questions about the server, please let us know.

Query: [F] COG0015 Adenylosuccinate lyase, from VFDB

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MIERYTLPEMGKIWTDTYKLQTWLDVEIAVCEAQAELGYIPQAAVDEIKAKAKFDPQRVLEIEAEVRHDVIAFLTNVNEYVGDAGRYIHLGLTSSDVLDTALALQLVASLDLILEQLEKLIQAIRYQAQQHRYTVMVGRSHGIHAEPITFGFKLAGWLAEVLRNRDRLVRVAQSIAVGKISGAVGTYANIDPKVEAIACQKLGLEPDTASTQVISRDRHAEYVQQLALLAASLERFAVEIRNLQRTDVLEVEEYFSKGQKGSSAMPHKRNPIRSERLTGMARLVRGHAVAALENVALWHERDISHSSVERVAFPDCCILTHFMLKETTDLVKNLLVYPENMKRNMNVYGGVIFSQKVLLALVEKGMNREDAYRVVQGSAHQAWNTEGGNFEELVRADAQVTALLSAEEIDQCFDPQQHLTNLAEIYSRLDILast
1 -107.000sp|P30566|PUR8_HUMAN Adenylosuccinate lyase OS=Homo sapiens GN=ADSL PE=1 SV=2  ali follow..  26  17LASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNNIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLEGDDHKVEQLDKMVAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLA--NLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVKQEGGDNDLIERIQVDAYFSHSQLDHLLDPSSFTGRASQQVQRF.. 460
2 -94.200sp|P04424|ARLY_HUMAN Argininosuccinate lyase OS=Homo sapiens GN=ASL PE=1 SV=4  ali follow..  17  11..GRFVGA-NASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTNSNDEDIHTANERLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVD-RELLRAELNFGAITLNDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLS-DAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALS---PDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAET-KGVALNQLSLQELQTISPLFSGDVICVWDYGHSVGTARSSVDWQ.. 451
3 -67.600sp|P07954|FUMH_HUMAN(removed signalp:1-23) Fumarate hydratase, mitochondrial OS=Homo sapiens GN=FH PE=1 SV=3  ali follow..  19  53.TMNFKIGG-VTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVTQTNMNVNEVISNRAIEMLGGELSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVEVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLFAEKVAAKVAALTGLPFVTAPEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELIPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTERINKLMNESLMLVTA-----------LNPHIGYDKAAKIAKTAHK-NGSTLKETAIEL----GYLTAEQFDEWVKPKDMLG........... 485
4 -5.350sp|Q9C010|IPKB_HUMAN cAMP-dependent protein kinase inhibitor beta OS=Homo sapiens GN=PKIB PE=2 SV=1  ali follow..  1....................................................................................................................MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALS...................................................................................................................................................................................................................................................................... 53
5 -5.180sp|Q6MZT1|R7BP_HUMAN Regulator of G-protein signaling 7-binding protein OS=Homo sapiens GN=RGS7BP PE=2 SV=3  ali follow..  16................................TRSSIFQISKPPLQSGDWERRGSGSESAHKTQRALDDCKMLVQEFNTQVALYRELVSIGDVSVSCPS-------------LRAEMHKTRTKGCEMARQAHQKLAAISGPEDGEIHPEICRLYIQLQCCLEMYTTEMLKSICLLGSLQFHRKGKEPGGGTKSLDCKIEESAETPALEDSSSSPVDSQVSTDIENTERDMREMKNLLSKLRETMPLPLKNQDDSSLLNLTPYPLVRRRK.................................................................................................................................................................. 245
6 -5.030sp|P61925|IPKA_HUMAN cAMP-dependent protein kinase inhibitor alpha OS=Homo sapiens GN=PKIA PE=1 SV=2  ali follow..  13  1...........................................................................................................................MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLD...................................................................................................................................................................................................................................................................... 46
7 -5.020sp|Q9Y2B9|IPKG_HUMAN cAMP-dependent protein kinase inhibitor gamma OS=Homo sapiens GN=PKIG PE=1 SV=1  ali follow..  13  1...........................................................................................................................MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELA...................................................................................................................................................................................................................................................................... 46
8 -5.000sp|Q8IYK2|CC105_HUMAN Coiled-coil domain-containing protein 105 OS=Homo sapiens GN=CCDC105 PE=2 SV=3  ali follow..  11  122........................................TTEVVHAHARGARLTAARLGRAQHQINGRVRQLLRVTDHRLSEVRKGLLINQQSPDKADSMLT-ELKSMKRKMERDMEKSEVLLKTLCRDTLNFCFKERLQAVDLMNQPLDKVLEQARRHSWVNLSRAPTPRTQGQKTPPPDPVGTYNPACALALNEAKRLLEMAKNEVDVREQQLQISDRVCASLAQKASETLELKERLNMTLGLMRGTILRCTKYNQELYTTHGLIKGPLSKVHLETAEKLDRPLVRMY--------QRHVGTQLPEAARLAQGTDKLQCHITYLEKNLDELLATHKNLSWGLNCKNIGHEVDGNVVRLRLRQRQPHVCYEQAQRLVKDWDPRTPPPRSK....................................... 494
9 -4.840sp|Q9BZF2|OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens GN=OSBPL7 PE=2 SV=1  ali   34................................................................................................................................................................................................................VSSWLRDSDGLDRCSHELSECQGKLQELHRLLQSLESLHRIPSAPVIPTHQASVTTERPKKGKRTSRMWCTQSFAKDDTIGRVGRLHGSVPNTRGLPPTDYAHLQRSFWALAQKVHSSLSSVLAALTMERDQLRDMHQGSEGVSEASTGQRRLHSLSTSSDTTADSFSSLNPEEQEALYMKGRELTPQLSQTSILSLADSHTEFFDACEVLLSASSSENEGS. 271
10 -4.810sp|Q9H4L5|OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens GN=OSBPL3 PE=1 SV=1  ali   11  59................................................................................................................................................................................................................VPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQGGSFESPKKEKVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAEENSRDENRALVHQLSNESRLSITDSLSE.... 300

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.