current user: public

If you have questions about the server, please let us know.

Query: [J] COG0018 Arginyl-tRNA synthetase, from VFDB

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .
# Score Template Links and tools%idFirst MNVMQENQIKLIEHIKQAVVQAVGLEETEVPEILLEVPKDKKHGDYSTNIAMQLARVAKKAPRQIAESIVPELKKDTKLIKEVEIAGPGFINFYLDNAYLTDLVPVILTEDKKYGESDFGKGEKFQIEFVSANPTGDLHLGHARGAAIGDSLANIMKMAGFDVSREYYINDAGNQINNLVLSAEARYFEALGLESEFPEDGYRGSDIIALGKDLAAKYGDKYVNASEEERRSVFRVDALAFETGKLRADLEEFRVSFDEWFSETSLYEENKVLPALERLRENGYIYEQDGATWLRTTDFEDDKDRVLIKSDGSYTYFLPDIAYHLNKLERGFDVLIDIWGADHHGYIPRMRAAIEALGYSPNQLEVEIIQLVHLFEDGVQVKMSKRTGKSVTMRDLIEEVGLDATRYFFAMRSSDTHMNFDMSLAKSTSNDNPVYYVQYAHARISSILRSGKEQGLEVSKDANMSLLETEAEYDLLKVLGEFADVVAEAAVKRAPHRIVRYLNDLATAFHRFYNSNKVLDMDNLEVTKARLALIKTAQITLRNGLTLLGVSAPEKMLast
1 -121.000sp|Q5T160|SYRM_HUMAN Probable arginyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=RARS2 PE=1 SV=1  ali follow..  19  1......MACGFRRAIACQLSRVLNLPNLITSISAVPISQKEEVADFQLSVDSLLEKDNDHSRPVQAKRLAEKLRCD-TVVSEIS-TGQRTVNFKINRELLTKTVQQVIEDGSKYGLKSELPQKKIVVEFSSPNVAKKFHVGHLRSTIIGNFIANLKEALGHQVIRINYLGDWGMQFGLLGTGFQLFGYEEKLQSNPLQHEVYVQVNKEAADDKSVAKAAQERLELGDVQALSLWQKF-RDLSIEEYIRVYKRLGVYFDEYSGESFYREKSQ-EVLKLLESKGLLLKTIKGTAVVDLSGNGPSSICTVMRSDGTSLYATRDLAAAIDRMDKNFDTMIYVTDKGQKKHFQQVFQMLKIMGYDWAERCQHVPFGVVQ-------GMKTRRGDVTFLEDVLNEVGLAALIIQDFKGLLLSDYKFSWDRVFQSRGDTG-VFLQYTHARLHSLEETFGCGYLN---DFNTACLQEPQSVSILQHLLRFDEVLYKSSQDFQPRHIVSYLLTLSHLAAVAHKTLQIKD-SPPEVAGARLHLFKAVRSVLANGMKLLGITPVCRM 578
2 -90.500sp|Q5D0E6|DALD3_HUMAN DALR anticodon-binding domain-containing protein 3 OS=Homo sapiens GN=DALRD3 PE=2 SV=2  ali follow..  10  1.......MATRRLGVGETLGALNAALGPGGPWIKETRTRHLRSRDFLAHRALQARFDDGQVPEHLLHALACLQGPGVAPVLRCAPTPAGLSLQLQRSAVFERVLSAVAAYATPASPA--SLGQRVLLHCPALRSSCALRLSQLRTVLVADHLARALRAHGVCVRLVPAVRDPHMLTFLQQLRVDWPAASERASSHTLRSH---------------ALEELTSANDGRTLSPGILGRLCLKELVEE-----QGRTAGYDPNLDNCLVTEDLL-------------------------------SVLAELQEALWHWPEDSHPGLAGASDGTGGCLVVHVVSCEEEFQQQKLDLLWQKLVDKAPLRQKHLICGPVKVAGAPALKHGGDLAQDPAWTEIFGVLSVATIKFEMLSTAPQSQLFLALADSSISTGTKSGTFVMYNCARLATLFESYKCSMEQGLSSLDFSLLHDEGELLLFNSILPFPDLLSRTAVAVRTEMICKFLVQLSMDFSSYYNRVHILGEPRPHLMFVRLQLLRAVREVLHTGLAMLGLPPLSHI 543
3 -75.700sp|P54136|SYRC_HUMAN Arginyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=RARS PE=1 SV=2  ali   20  1...............................................................................IEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLP--ALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRVLLQGKNPDITKAWKLI-CDVSRQELNKIYDALDVSLIER---GESFYQDRMNDIVKEFEDRGFVQVDDGRKIVFVPGCS--IPLTIVKSDGGYTYDTSDLAAIKQRLEEKADMIIYVVDNGQSVHFQTIFAAAQMIGWYDPKVTFHAGFGVVLGEDKK................................................................................................................................................................................. 300
4 -60.700sp|P54136|SYRC_HUMAN Arginyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=RARS PE=1 SV=2  ali   19  1..................................................................................................................................................................................................................................NPDITKAWKLI-CDVSRQELNKIYDALDVSLIER---GESFYQDRMNDIVKEFEDRGFVQVDDGRKIVFVPGCS--IPLTIVKSDGGYTYDTSDLAAIKQRLFEKADMIIYVVDNGQSVHFQTIFAAAQMIGWPKVTRVFHAGFGVVLGEDKK--KFKTRSGETVRLMDLLGEVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTA-AYLLYAFTRIRSIARLANIDEEMLQKRETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDY....................................................... 300
5 -57.700sp|P54136|SYRC_HUMAN Arginyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=RARS PE=1 SV=2  ali   27  71.KNMINIISRLQEVFGHAIKAAY--PDLENPPLLVTPSQQAKFGDYQCNSAMGISKEQKVNPREIAENITKHLPDN-ECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLP--ALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDKFPDYLTVSPPILQVFYKESKKRFDTEEEFKKRAYQCVVLLQGK....................................................................................................................................................................................................................................................................................................................................... 300
6 -57.600sp|P54136|SYRC_HUMAN Arginyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=RARS PE=1 SV=2  ali   24  1.............................................................................................................................................................................................................................................................................................................................................................................................KFKTRSGETVRLMDLLGEVAYGCIKYADLSHNRLNDYIFSFDKMLDDRGNTA-AYLLYAFTRIRSIARLANIDEEMLQKRETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDYIYELATAFTEFYDSCYCVEKDRQKVNMWRMLLCEAVAAVMAKGFDILGIKPVQRM 210
7 -19.400sp|Q96GW9|SYMM_HUMAN(removed signalp:1-15) Methionyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=MARS2 PE=1 SV=2  ali follow..  13  1...............................................................................................SRLSLLEDFGPRYYSSGSLSAGDDACDVRAYFTTPIFYVNAAPHIGHLYSALLADALCRHRRLRGPSTAATRFSDEHGLKIQQAAATAGLAPTEL------------------------------------------------CDRVSEQFQQLFQEAGISCTDFIRTTEARHRVAVQHFWGVLKSRGLLYKKEENYIFRLSQFRKPPDLSVSRRDALVNYLTV-IGYPNAEFKSWWPATSHIIGKD---KFHAIYWPAFLLGAGMSPPQRICVHSHWTVCGQ---KMSKSLGNVVDPRTCLNRYTVDGFRYFLLRQGVNWDCDYYDEKVVKLLNSELADALGGLLNRCTAKRINCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCVRQTNGFVQRHAVLHVALECLRVFGTLLQPVTPSLADKLLSRLGVSASER. 531
8 -14.700sp|Q9HA77|SYCM_HUMAN Probable cysteinyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=CARS2 PE=1 SV=1  ali follow..  15  69........................................................................................................................HAEAASWYSCGPTVYDHAHLGHACSYVRFDIIRRILKVFGCSIVMVMGITDVDDKI--------------------------------------------KRANEMNISPASLASLY-----EEDFKQDMAALKVLPPTVYLRVTENIPQIIS-FIEGIIARGNAYSAKGNVYFDLKSRGHASDFALWKAPGRPGWHIECSAIASMVFGSQLD--IHSGGIDHENEIAQCEVF-----HQCEQWGNYFLHSGHLHAKGKEEKMSKSLKNYITIKDFLKTFSPDVFRFFCLRSSYRSAIDYSDSAMLQAQQ---------LLLGLGSFLEDARAYMKGQLAC------GSVREAMLWERLSSTKRAVKAAADDFDTPRVVDAILGLAHHGNGQLRA-----SLKEPEGPRSPAVFGAIISYFEQFFETVGISLANQ. 471
9 -13.500sp|Q5JPH6|SYEM_HUMAN Probable glutamyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=EARS2 PE=1 SV=2  ali follow..  15  33........................................................................................................................AGVAVRVRF-APSPTGFLHLGGLRTALYNYIFAK--KYQGSFILR----TDQTRVVPGAAENIEDEWAGIPPDESPRRGGPA-GPYQQSQRLELYAQATEALLKTG-----AAYPCFCSPQRLELLKKEALRNHQRYDN--EQVAQKLAKDPKPAIRFRLEQVVPAFQDGWNRHEVASVEG--DPVIMKSDGFPTY---HLACVVDDHHMGISHVL---GSEWLVSTAKHLLLYQALGWQPPHFA------LPLLLNRDGSKLSKRQGDV-SLLDIITNCG-ELITQFNLTQVTCHSALLDLEKLPEFNRL----HLQRL-GKLQVLVEEAFGCQLQNRDVLNPVYVEDAISEKVDVIAKRVLGLLERSSMSLTQDMLNGELKKLSEGLEGT--------KYSNVMKLLRMALSQQQGPPVAEMMLALG....... 509
10 -13.300sp|P41252|SYIC_HUMAN Isoleucyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=IARS PE=1 SV=2  ali   14  79.....................................................................................................................................................................................................................................................................................................................ESGSMPYAQVHYPFNKREFEDAFPADFIAEGIDQTRGWFYTLLVLATALFGQPPFKNVIVNGLVLASDGQ--KMSKRKKNYPDPVSIIQKYGADALRLYLINSPRAENLRFKEEGVRDVLKD--PWYNAYRFLIQNVLRLQKEEEIEFLYNENTVRESPNITDRWILSFMQSLIGFFETEMAAYRLYTVVPRLVKFVDILTNWY........................................... 284
11 -12.900sp|Q9P2J5|SYLC_HUMAN Leucyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=LARS PE=1 SV=2  ali   15  53..............................................................................................................................................................................................................................................................................................................................EKLDQLKQEFEFWYPVDLRVSGKDHLSYYLYNHVAMWPEQSDKWPTAVRANGHLLL--NSE--KMSKSTGNFLTLTQAIDKFSADGMRLALAAGDTVEDANFVEAMA-----DAGILRLYTWVEWVKEMVANWDSLRSGPASTFNDRVF-----------ASELNAGIIKTDQNYEKMMFKEALKTGFFEFQAAKDKYRELAVEGMHRE--------LVFRFIEVQTLLLAPFCPEHI 270
12 -12.500sp|P49589|SYCC_HUMAN Cysteinyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=CARS PE=1 SV=3  ali   15  4..........................................................................................................................................RIQHAVQLATEPLEKAVQSLTGEEVNSCVEVLLEEAK-----------------------------DLLSDWLDSTLGCDVTDNSIFSK-----------PKFWEGDFHRDMEALNVLPPDVLTRVSEYVPEIVN-FVQKIVDNGYGYVSNGSVYFDTAKFASSEDFALWKAKGRPGWHIECSAMAGTLLGASMD--IHGGGFD---HHDNELAQSEAYFENDCWVRYFLHTGHLTIAG---CKMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTM................................................................................................................................... 299
13 -12.100sp|P56192|SYMC_HUMAN Methionyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=MARS PE=1 SV=2  ali   12  4..................................................................................................................................................................................................................................................LPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLE--GFEDKVFYVWFDATIGYLSI-TANYTDQWERWWKDLYQFMAKDNVPFHSLVFPCSALGAEDNYTLVSHLIATEYLNYEDG--KFSKSRGVGVFGDMAQDTIPADIWRFYLLYIRPGQDSAFSWTDLLLKNNSELLNNLGNFINRAGMFVSKFFGGYVPEMV-------LTPDDQRLLAHVTLELQHYHQLLEKVRIRDALRSILTISRHGNQYIQVNERIKGSEADRQRAGTVTGLAVNIA................ 299
14 -11.500sp|P49589|SYCC_HUMAN Cysteinyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=CARS PE=1 SV=3  ali   14  3...............................................................................................................................................................................................................................................................................................DLSISADRLSEKRSPNDFALWKAKGRPGWHIECSAMAGTLLGASMD--IHGGGFD---HHDNELAQSEAYFENDCWVRYFLHTGHLTIAG----KMSKSLKNFITIKDALKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQ---------YEKFLNEFFLNVKDILRAPVDITGQFEKWGEEEAELNKNFYDKKTAIHKACDNVDTRTVMEEMRALVSQCNLY------MAARKAVRKRPNQALLENIALYLTHMLKIFGAVEEDS. 265
15 -11.200sp|Q9NSE4|SYIM_HUMAN Isoleucyl-tRNA synthetase, mitochondrial OS=Homo sapiens GN=IARS2 PE=1 SV=2  ali   15  1............................................................................................................................................................................................................................................................................................................................FDSGTSWSYVLPGPDQRADLYLEGKDQLGGWFQSSLLTSVAARKRAPYKTVIVHGFTLGEKGE--KMSKSLGNVIHPDVVVNPYGADVLRWWVADSNVFTEVAIGPSVLNAARD---------DISKLRNTLR-GNVADFNPETDSIPVNDMYVIDQYMLHLLQDLANKITELYKQYDFGKVVRLLRTYTRELSNFYDRLYCEKENDPKRRSCQTALVEILDVIVRSFAPILPHLAEE.. 244
16 -10.200sp|P07814|SYEP_HUMAN Bifunctional aminoacyl-tRNA synthetase OS=Homo sapiens GN=EPRS PE=1 SV=5  ali   16  32............................................................................................................QDVGKFVELPGAEMGKVTVRF-PPEASGYLHIGHAKAALLNQHYQV--NFKGKLIMR---FDDTNPE------KEKEDFEKVILEDVAMLHIKPDQFTYTSDHFETIMKYAEKLIQEG-----KAYVDDTPAEQMKAEREQ------------RIDSKHRKNPIEKNLQMWEEMKKGSQFGQSCCLRAK--IQPHPRTGNKYNVYPTY---DFACPIVDSIEGVTHAL---TTEYHDRDEQFYWIIEALGIRKPY----IWEYSRLNLNNT--VLSKRKLTWFVNEGLVD.............................................................................................................................................................. 298
17 -10.200sp|P56192|SYMC_HUMAN Methionyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=MARS PE=1 SV=2  ali   11  109.....................................................................................................................PVAGERNVLITSALPYVNNVPHLGNIIGCVLADVFARYSRLRQWNTLYLCGTDEYGTATET------------------------------------------------KALEEGLTPQEICDKYHIIHADIYRWFNISFDIFGRTTTPQQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLADRFV......................................................................................................................................................................................................................................................... 251
18 -10.000sp|Q9P2J5|SYLC_HUMAN Leucyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=LARS PE=1 SV=2  ali   16  16..............................................................................................IEKEIQQKWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLKRE-IELYGCPPDFPDEKAKGKKSKAAAKAGSSKYQWGIMKSLGLSDEEIVKEHWLDYFPPLAIQDLKRMGLKVDFITTDVNPYYDSFVRWQFLTLRERNKIKFGKRYTIY...................................................................................................................................................................................................................................................................... 240
19 -9.840sp|P41252|SYIC_HUMAN Isoleucyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=IARS PE=1 SV=2  ali   12  1..............................................................................................................................................................................................................................................................................................................................................................................................MSKRKKNYPDPVSIIQKYGADALRLYLINSPRAENLRFKEEGVRDVLKD--PWYNAYRFLIQNVLRLQKEEEIEFLYNENTVRESPNITDRWILSFMQSLIGFFETEMAAYRLYTVVPRLVKFVDILTNWYVRMNRRRLKGENGMEDCVMALETLFSVLLSLCRLMAPYTP... 174
20 -9.730sp|Q9P2J5|SYLC_HUMAN Leucyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=LARS PE=1 SV=2  ali   11  18................................................................................................................................YLKGFYEGIMLVDGFKGQKVQDVKKTIQK-----------MIDAGDALIYMEPEKQVMSRSSDECVVALCDQWYLDYGEENWKKQTSQCLKNETFCEETRRNFEATLGWLQEHACSRTY-----LGTHLPWDEQWL----ESLSDSTIYMAFYTVAHLLQGGNLHGQAESPLGIRPQQMTKEVWDYVFFKEAPF-LKQEFEFWYPVDLRVSGKDPNHLSYYLYNHVAMWPEQSDKWPTAVRANGHLLLNSE--KMSKSTGNFLTLTQAIDKFSADGMRLALADAGDT............................................................................................................................................. 299
21 -9.200sp|P26640|SYVC_HUMAN Valyl-tRNA synthetase OS=Homo sapiens GN=VARS PE=1 SV=4  ali   19  27..................................................................................................................NVSAANPRGVFMMCIPPPNVTGSLHLGHALTNAIQDSLTRWHRMRGETTLWNPGCDHAGIATQVVV------------------------------EKKLWREQGLSRHQLGREAFLQEVWKWKEEK--DRIYHQLKKLGSSLD-WDRACFTMDPKAVTEAFVRLHEEGIIYRST-----------------LVNWSCTLNSAISDIEVDKKELT---RTLLSVPGYKEKVEFGVLV---------------SFAYKVQGSDSDEEVVVATTRIETM-LGDVAVAVHPKDTRYQHLKGKNSRSLPIVFDEFVDMDFGTGAVKITPAH................................................................................................................... 296
22 -9.100sp|P49589|SYCC_HUMAN Cysteinyl-tRNA synthetase, cytoplasmic OS=Homo sapiens GN=CARS PE=1 SV=3  ali   16  1........................................................................MADSSGQQGKGRRVQPQWSPPAGTQPCRLHLYNSLTRNKEVF------DGKKVTWYCCGPTVYDASHMGHARSYISFDILRRVLKYFKFDVFYCMNITDIDDKIIKRANHLFEQYREKRPEAAQLLEDVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLP-KFWEGDFHRDMEALNVLPPDVLTRVSEY--PEIVNFVQKIVDNGYGYVSNGSVYFDTAKFPEAVGDQKALQEG.................................................................................................................................................................................................................................................... 300

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]