current user: public

If you have questions about the server, please let us know.

Query: [I] COG0020 Undecaprenyl pyrophosphate synthase, from VFDB

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MKSSTQAVLEHTAIPKHIAVIMDGNGRWAKKRFLPRIMGHKRGLDALENMVKHCAKLGVQYLTVFAFSTENWRRPEDEVSFLMGLFLQALQKQVRRLHENNMRLKILGSRERFNRQILKGIEEAEALTANNTGLTLSIAADYGGRWDILQAANKLIAEGVSEITEDTLAKYLMLGDAPEPDLFIRTGGETRISNFLLWQMAYAELYFTDILWPDFDGKALDDAVASFQKRERRFGRTSEQLPIEQQRNLast
1 -98.100sp|Q86SQ9|DHDDS_HUMAN Dehydrodolichyl diphosphate synthase OS=Homo sapiens GN=DHDDS PE=2 SV=3  ali follow..  32  12WERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNAVREMAWGDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQ 268
2 -50.900sp|Q96E22|NGBR_HUMAN(removed signalp:1-23) Nogo-B receptor OS=Homo sapiens GN=NUS1 PE=2 SV=1  ali follow..  16  62.MRWRADGRSLEKLPVHMGLVITEV-------------EQEPSFSDIASLVVWCMAVGISYISVYDHQGIFKRNNSRLMDEILKQQQELL------------------GLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDGKADIVRAAQDFCQLRPTDLDVDTLASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHL-NISYEDFFSALRQYAACEQRLGK............ 270
3 -7.410sp|Q96RT7|GCP6_HUMAN Gamma-tubulin complex component 6 OS=Homo sapiens GN=TUBGCP6 PE=1 SV=3  ali   47........VKECELVKDVLNVLIGCQPAQAFVVKRGVHVSGASPESISSLLSEVAEYGTCYTRLSHFSLQPVLDSLYSKGLVFQAFTSGLRRYLQYYRACVLSTRYLAELCGVGAVLPGTCGGGPRAAFPTGVKLLSYLYQENCSNEHYPVLLSLLKTSCEPY--RFIHDWVYSGVFRDAEFMIQVNHELSFRDKLYWTHGYV----VEDCVPVF--------LKHIAHDIYVCGK............ 300
4 -7.140sp|Q5T013|HYI_HUMAN(removed signalp:1-26) Putative hydroxypyruvate isomerase OS=Homo sapiens GN=HYI PE=2 SV=2  ali follow..  12  20..EALARAAREAGLRLVLINTPPGDQEKGEMGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQEDLVGLLINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIV------GHVQVAQVPG------SPGELNFPYLFLEDEGYKGFVGCE-YQPRGDTVEGLSWLRSYWDR.................. 243
5 -6.630sp|Q9BSJ2|GCP2_HUMAN Gamma-tubulin complex component 2 OS=Homo sapiens GN=TUBGCP2 PE=1 SV=2  ali   13  62........SQESAVVEDLLYVLVGDGRYVSAQPLAGRQSRTFLVDSIRELVHRILPVAASYSAVTRFIEEKSSFEYAAMRTLVKEHLILVSQLEQLHRQGLLSLQKLWFYIQPAMRTMDILASLATSVDKGESLLHDRSFSYTGDSQAQELCLYLTKAASAPY--EVLEKWIYRGIIHDPEFMVEEHELRKERI--YWDQRYT---IVQQQIPSF................................. 292
6 -6.440sp|O00507|USP9Y_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-Y OS=Homo sapiens GN=USP9Y PE=1 SV=2  ali   12  80......................................GTLNGFQILHDRFFNGSALNIQIIAALILSQHTLKKYFIPVEIVPHLLENLTDEELKKEAKNEAKNDALSMIIKSLKNLASRISGQDETIKNLEIFRLKMILRLNALNEINKVISSVSYYTHRHIQQNNILSIVLQDSLHQPQYVEKLE---KILRFVIKEKALTL---LDNIW.................................... 286
7 -6.400sp|Q5T2L2|AKCL1_HUMAN Aldo-keto reductase family 1 member C-like protein 1 OS=Homo sapiens GN=AKR1CL1 PE=2 SV=2  ali follow..  16  14..................................................................................................NDGPFMPVLGGTYAPDHTPKSQAAEATKVAIDVGFRHIDSAYLYQNEEEVGQAIWEKIADGTVKREEIFYTIKLWATFFRAEL--VHPALERSLKKL---GPDYVDLFI--IHVP................................... 122
8 -6.390sp|Q9Y6R7|FCGBP_HUMAN(removed signalp:1-23) IgGFc-binding protein OS=Homo sapiens GN=FCGBP PE=1 SV=3  ali   13  1............................................................................QAVSYTRSVTLQIYNHSLTLSARWPRKLQVDGVFVTLPFQLDSLLHAHLSGADVVVTTTSGLSLAFDGDSFVRLRVPAAYAGSLCGLCGNYNQDPADDLKAVG-GVISATDGPLAPCHGLVPPAQYFQGCLLDACQVQGHPGGLCPAVATYVAACQAAG............. 198
9 -6.200sp|Q00534|CDK6_HUMAN Cell division protein kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1  ali follow..  15  16..........................................................VAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIRVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEH--DQDLTTYLDKVPEPGVPTETIKDMMFQLLRGDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSTLWPEV................................. 190
10 -6.190sp|Q8WWF1|CA054_HUMAN(removed signalp:1-16) Uncharacterized protein C1orf54 OS=Homo sapiens GN=C1orf54 PE=2 SV=1  ali follow..  17  5............................................................................................................DEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYS-DKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSRSPIPLLLSCAFVQVGMYFM........................................ 115

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.