current user: public

If you have questions about the server, please let us know.

Query: [E] COG0334 Glutamate dehydrogenase/leucine dehydrogenase, from VFDB

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MTENNNLVTSTQGIIKEALHKLGFDEGMYDLIKEPLRMLQVRIPVRMDDGTVKTFTGYRAQHNDAVGPTKGGVRFHPDVDEEEVKALSMWMTLKCGIVNLPYGGGKGGIVCDPRQMSIHEVERLSRGYVRAISQFVGPNKDIPAPDVFTNSQIMAWMMDEYSALDKFNSPGFITGKPIVLGGSHGRDRSTALGVVIAIEQAAKRRNMQIEGAKVVIQGFGNAGSFLAKFLYDLGAKIVGISDAYGALHDPNGLDIDYLLDRRDSFGTVTNLFEETISNKELFELDCDILVPAAISNQITEDNAHDIKASIVVEAANGPTTPEATRILTERGILLVPDVLASAGGVTVSYFEWVQNNQGYYWSEEEVNEKLREKLEAAFDTIYELSQNRKIDMRLAAYIIGIKRTAEAARYRGWALast
1 -92.800sp|P00367|DHE3_HUMAN Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens GN=GLUD1 PE=1 SV=2  ali follow..  34  83.....DKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKITRRFTMELAKFIGPGIDVPAPDMSTGEREMSWIADTYASTIGHYDHACVTGKPISQGGIHGRISATGRGVFHGIENFINEMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTVHSGLAYTMERSARQIMRTAMKYNLDLRTAAYVNAIEKVFKVYNEAGVT 556
2 -91.700sp|P49448|DHE4_HUMAN Glutamate dehydrogenase 2, mitochondrial OS=Homo sapiens GN=GLUD2 PE=1 SV=2  ali follow..  34  83.....DKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTENELEKITRRFTMELAGFIGPGVDVPAPDMNTGEREMSWIADTYASTIGHNAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGLDLRTAAYVNAIEKVFKVYSEAGVT 556
3 -8.030sp|Q9UDR5|AASS_HUMAN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens GN=AASS PE=1 SV=1  ali   1..............................................................................................................................................................GQWAGVAGMINILHGMGLRLLALGHHTPFMHIGMAHNYRNSSQAVQMPKSIGPLTFVFTGTGNVSKGAQAIFNELPCEYVEPHERHHHLVRKTDAVYDPAEYDKHPERYISRFNTDIAP-------YTTCLINGIYWEQNTPRLLTRQDAQSLLAPGKFSPAGVEGCPALPHKLVAICDISADTGGSIEFMTE-CTTIEHPFCMYDADQHIIHDSVEGSGILMCSIDNLPAQLPIEATECFGDMLYPYVEEM.... 276
4 -7.630sp|Q13423|NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens GN=NNT PE=1 SV=3  ali   21  74...............................................................................................................................................................................................................KVPPAKILIVGGGVAGLASAGAAKSMGAIVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIQCKEVDILISTALKEMIESMKEGSVVVDLAAEAGGNFETTKPGELYIHKGITHLPSRMATQASTLYS.................................................................. 239
5 -7.440sp|Q16798|MAON_HUMAN NADP-dependent malic enzyme, mitochondrial OS=Homo sapiens GN=ME3 PE=2 SV=2  ali   17  1....................TFRRPRGLFITIHDKGHLATMLNSWPEDNIKAVVVTGERILGLGDLGCYGMGI---PVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRDPQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFEDFANANA----LLNKYRNKYCMFNDDI---------------QGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLPTAIIGVAAIAGAFTEQILRDMASPIIFALSNPTSKAEC........................................................................................... 300
6 -7.300sp|A0AVT1|UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens GN=UBA6 PE=1 SV=1  ali   15  53..........................................................................................................................................................................................................DTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTE--KCQAWDLGTNFFLS---EDDVVNKRNRAEAVLKHIAELNPYVHV-TSSSVPFNETTDLSFLDKVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLT............... 246
7 -6.870sp|Q96HN2|SAHH3_HUMAN Putative adenosylhomocysteinase 3 OS=Homo sapiens GN=AHCYL2 PE=1 SV=1  ali   13  1.......................................................................................................GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVGKAGKLCVPAMNVNDSVTKQKFDNLYCCR-----------------------------ESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQADGFRLVKLNEVIRQVDI--------------------VITCTGNKNVVTREHLDRMKNSCIVCNMGH................................................................................................. 180
8 -6.870sp|P41226|UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7 OS=Homo sapiens GN=UBA7 PE=1 SV=2  ali   15  24..........................................................................................................................................................................................................SPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLTLHDPH--------TCWSDLAAQFLLSEQDLERSRAEASQELLAQLNRAVQV-VVHTGDITEDLLLDFQV-VVLTAAKLEEQLKVGTLCHKHGVCFLAADTRGLVGQL--FCDFGEDFTVQDPTEAEPLTAAIQHISQGSPGILTLRKGANTHYFRDGDLVTFSGIEGMVELND.. 222
9 -6.700sp|Q9UDR5|AASS_HUMAN Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens GN=AASS PE=1 SV=1  ali   13  31...................................................................................................................................................................................................................RKVLVLGSGYISEPVLEYLSRDGNIEITVGS----------DMKNQIEQLGKKYNINPVSMDICKQEEKLGFLKQDLVIPYVLHPLV-AKACITNKVNMVTASYITPALKELEKSVEDAGITIIGELGLDPG....................................................................... 156
10 -6.670sp|Q9UBT2|SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens GN=UBA2 PE=1 SV=2  ali   14  9..........................................................................................................................................................................................................RELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDL-------DTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFQFILVMNALNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTI................................................................. 151

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.