current user: public

If you have questions about the server, please let us know.

Query: [R] COG4588 Accessory colonization factor AcfC, contains ABC-type periplasmic domain, from VFDB

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWRELast
1 -4.880PB144506 _Gut.Meta.Jp.0101058_ gi|162866171|dbj|BABB01003836.1||1 (- 121:946~0 complete)  ali follow..  13  1MKTKLVAVIALIFCAFMAEASKVIELGGNIEYSGNNFWGNRSNKKFPVFKYTHGRSASLKITIDEN-PLLSIKSNNGRLAIRIQDGTRIKPTQYVIEGSSKTLKYLKTSGPMDFEAQNAFSEDQLEIKI-SGSSDVKFPHNVKLRLGEFSVSGSGDLVFADKNLTSKVSGSGDITLKGKADEARYSV............................................................... 208
2 -4.260PB021443 Q5LG43_BACFN/1-226 PB021443; Pfam-B_21443;  ali follow..  14  1MKTMKFILA------------CVLLLSPLLCQAQKNLFNKYNDMKGVSSVYISKAMMELNPNLFMKDLVLSTHDNKVREEMAKDIRSLVQSSKYELLMKVSGSEVYVNRKGSKVKELIMVMNGASSLKFVYMEGDMTTDDIKKLMLYQ...................................................................................................... 153
3 -4.160HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  14  1MKKLLLAMIAVAA--------LISFAACDHNETYADQRD--RELDSIN---AFLRNENIKVINEAEFEKRFEARKAGDKAVKLTDTDPNNNEYVLFESNGIYMQVINDGCGDYIAKGKT................................................................................................................................... 106
4 -3.680PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  1MKTGIRVTVYALL--------AMILFSCE-----KELCFHHPHMVTLRVDFDWKNAP---QADPEGMCVYFYPEERFDFAGKDGGSVEIKEGRYRILCYNNDTESLLFRGMEGFDTHEGYTRDGNVFESIYGNGAHYAPPAKGSEDERVVICPDMMWGSCARNVEITELGLSYECISFADKDK------VEWIESSEHVITLYPAELICTYTYEVRNVKNMEYMTQACGSLSSMAPS............. 221
5 -3.640HGC00921 gi|162841401|dbj|BABA01003308.1|3.0 TMP01242;  ali follow..  10  11QARIRALKTAVVKGDMCDVYDLPV--SLKTLGEARIFLSKFET-----AHSYYVHCYGEQSRNSKKHQANVKTARLYISHFIQVLNLAVIRMEIKESHKALYGLPVDNFSVPDLSSEASLAEWGQKIIEGERKRTSQGGIPIYNPTIAKVKVHYDIFMEGYEKQKSLQSLTNRSLEQLASMRVQA-LILDIWNQVEAKFQDVSPNEKRLEKCRDYGLIIIGPEKNRIRRFFKICLSKSLQKITFRYG... 260
6 -3.610PB009671 Q5LCM2_BACFN/1-111 PB009671; Pfam-B_9671;  ali follow..  11  1MKKVLVALTMVMGMGSAVDKFTKITVKELPQVVKSTLSKDYEDQSTEEITVLLNEKGEPVNE............................................................................................................................................................................................ 109
7 -2.990PB045072 _Gut.Meta.Jp.0111663_ gi|163310555|dbj|BABD01000145.1||3 (+ 1662:2028~0 complete)  ali follow..  13  1MRKLGFTLVAALAFSVSAFAN----ANDTINVAGKWDGTINKAKLTKYLQLSSQQNEQVAS............................................................................................................................................................................................. 58
8 -2.950HGC00683 gi|163310582|dbj|BABD01000118.1|4.0 TMP00861;  ali follow..  19  1MKTLVMLMTALFLVLPSCSKDDVNVTLTPSEEVVNAFQQKYPDVKNVKWEIL...................................................................................................................................................................................................... 56
9 -2.860PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  1MKRNYFFTMLAAVLLAVAGAN----AQESAEFRPAELAGIWQILKPSNTFKVLSDDGRIVNFTMIPGKDAIITGYGTYQ........................................................................................................................................................................... 88
10 -2.630PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;  ali follow..  11  48FSGCIFGSVLPAWSQEIVAGELERCFLAMPESVLPIVTM------------------------EERNDLCRRAGHLSGFTHTASLESSLGGTVTFLLNRNFIRIQTSTVGEVFMRILPFSDSSSVICVVTTVLHPVADSRIDFYTTE---------WKPLKTDRFWQQPRIEDFFLPHTDRQSYA---YQAIYASLTPSYMQVSLSEESDTLSIRQTVTETLAEEEKPLAAIFLSPEPLVYRWQSGRFVR 261

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.