current user: public

If you have questions about the server, please let us know.

Query: [E] COG0334 Glutamate dehydrogenase/leucine dehydrogenase, from VFDB

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MTENNNLVTSTQGIIKEALHKLGFDEGMYDLIKEPLRMLQVRIPVRMDDGTVKTFTGYRAQHNDAVGPTKGGVRFHPDVDEEEVKALSMWMTLKCGIVNLPYGGGKGGIVCDPRQMSIHEVERLSRGYVRAISQFVGPNKDIPAPDVFTNSQIMAWMMDEYSALDKFNSPGFITGKPIVLGGSHGRDRSTALGVVIAIEQAAKRRNMQIEGAKVVIQGFGNAGSFLAKFLYDLGAKIVGISDAYGALHDPNGLDIDYLLDRRDSFGTVTNLFEETISNKELFELDCDILVPAAISNQITEDNAHDIKASIVVEAANGPTTPEATRILTERGILLVPDVLASAGGVTVSYFEWVQNNQGYYWSEEEVNEKLREKLEAAFDTIYELSQNRKIDMRLAAYIIGIKRTAEAARYRGWALast
1 -117.0003aog_A mol:protein length:440 Glutamate dehydrogenase  ali model follow..  47  19LGKDGGPWEIFTEQVDRVVPYLGRLAPLAESLKRPKRVLIVDVPVRLDDGSVAYFEGYRVHHNTARGPAKGGVRYHPEVTLSEVMALAGWMTIKNAAVGLPYGGGKGGIRVDPRKLSPGELERLTRRYTSEIGILLGPDRDIPAPDVNTGEREMAWMMDTYSMNVGRTVPGVVTGKPIALGGSLGRRDATGRGVFITAAAAAEKIGLQVEGARVAIQGFGNVGNAAARAFHDHGARVVAVQDHTGTVYNEAGIDPYDLLRHVQEFGGVRGYKAEPLPAADFWGLPVEFLVPAALEKQITEQNAWRIRARIVAEGANGPTTPAADDILLEKGVLVVPDVIANAGGVTVSYFEWVQDFNSYFWTEEEINARLERVLRNAFEAVWQVAQEKKIPLRTAAYVVAATRVLEARALRGL. 432
2 -116.0004xgi_A mol:protein length:436 Glutamate dehydrogenase  ali model follow..  45  22.ADDLGPWGNYLQQVDRVAPYLGSLSRWIETLKRPKRILIVDVPIELDNGTVAHFEGYRVQHNVSRGPGKGGVRYHQDVTLSEVMALSAWMSVKNAAVNVPYGGAKGGIRVDPRKLSRGELERVTRRYTSEIGIIIGPNTDIPAPDVNTNEQIMAWMMDTYSMNQGQTATGVVTGKPISLGGSLGRKEATGRGVFVVGCEAAKKKGVEIEGARIAVQGFGNVGGIAAKLFQEAGAKVIAVQDHTGTIHQPAGVDTAKLLDHVGRTGGVAGFGAEPMPNDEFWTVETEILIPAALENQITEKNASKIRTKIIVEGANGPTTTAADDILSANGVLVIPDVIANAGGVTVSYFEWVQDFSSFFWTEDEINHRLERVMREAFAGVWAVAEEHKVSVRTAAFIVACKRILMAREMRGL. 434
3 -116.0003k92_A mol:protein length:424 NAD-specific glutamate dehydrogenase  ali model follow..  73  12.KEALNLFLSTQTIIKEALRKLGYPGDMYELMKEPQRMLTVRIPVKMDNGSVKVFTGYRSQHNDAVGPTKGGVRFHPEVNEEKVKALSIWMTLKCGIANLPYGGGKGGIICDPRTMSFGELERLSRGYVRAISQIVGPTKDIPAPDVYTNSQIMAWMMDEYSRLREFDSPGFITGKPLVLGGSQGRETATAQGVTICIEEAVKKKGIKLQNARIIIQGFGNAGSFLAKFMHDAGAKVIGISDANGGLYNPDGLDIPYLLDKRDSFGMVTNLFTDVITNEELLEKDCDILVPAAISNQITAKNAHNIQASIVVERANGPTTIDATKILNERGVLLVPDILASAGGVTVSYFEWVQNNQGYYWSEEEVAEKLRSVMVSSFETIYQTAATHKVDMRLAAYMTGIRKSAEASRFRGW. 423
4 -115.0003aoe_E mol:protein length:419 Glutamate dehydrogenase  ali model follow..  37  9.PEDPGLWDTYLEWLERALKVAGVHPTTLEYLAHPKRLVTLSLPVVMDDGKVRIFQGYRVVHDIARGPAKGGVRLDPGVTLGQTAGLAAWMTLKAAVYDLPFGGAAGGIAVDPKGLSPQELERLVRRYTAELVGLIGPDSDILGPDLGADQQVMAWIMDTYSMTVGSTVPGVVTGKPHALGGSEGRDDAAGLGALLVLEALAKRRGLDLRGARVVVQGLGQVGAAVALHAERLGMRVVAVATSMGGMYAPEGLDVAEVLSAYEATGSL---PRLDLAPEEVFGLEAEVLVLAAREGALDGDRARQVQAQAVVEVANFGLNPEAEAYLLGKGALVVPDLLSGGGGLLASYLEWVQDLNMFFWSPEEVRERFETRVARVVDAVCRRAERGGLDLRMGALALALERLDEATRLRGV. 417
5 -115.0002yfq_A mol:protein length:421 NAD-SPECIFIC GLUTAMATE DEHYDROGENASE  ali model follow..  47  1MTDTLNPLVAAQEKVRIACEKLGCDPAVYELLKEPQRVIEISIPVKMDDGTVKVFKGWRSAHSSAVGPSKGGVRFHPNVNMDEVKALSLWMTFKGGALGLPYGGGKGGICVDPAELSERELEQLSRGWVRGLYKYLGDRIDIPAPDVNTNGQIMSWFVDEYVKLNGEMDIGTFTGKPVAFGGSEGRNEATGFGVAVVVRESAKRFGIKMEDAKIAVQGFGNVGTFTVKNIERQGGKVCAIAEWDYALYNENGIDFKELLAYKEANKTLIGFGAERITDEEFWTKEYDIIVPAALENVITGERAKTINAKLVCEAANGPTTPEGDKVLTERGINLTPDILTNSGGVLVSYYEWVQNQYGYYWTEAEVEEKQEADMMKAIKGVFAVADEYNVTLREAVYMYAIKSIDVAMKLRGW. 420
6 -115.0003k8z_A mol:protein length:423 NAD-specific glutamate dehydrogenase  ali model follow..  73  12.EDKLDVLKSTQTVIHKALEKLGYPEEVYELLKEPMRLLTVKIPVRMDDGSVKIFTGYR-AHNDSVGPTKGGIRFHPNVTEKEVKALSIWMSLKCGIIDLPYGGGKGGIVCDPRDMSFRELERLSRGYVRAISQIVGPTKDVPAPDVFTNSQIMAWMMDEYSRIDEFNSPGFITGKPLVLGGSHGRESATAKGVTICIKEAAKKRGIDIKGARVVVQGFGNAGSYLAKFMHDAGAKVVGISDAYGGLYDPEGLDIDYLLDRRDSFGTVTKLFNDTITNQELLELDCDILVPAAIENQITEENAHNIRAKIVVEAANGPTTLEGTKILSDRDILLVPDVLASAGGVTVSYFEWVQNNQGFYWSEEEVEEKLEKMMVKSFNNIYEMANNRRIDMRLAAYMVGVRKMAEASRFRGW. 422
7 -115.0001v9l_A mol:protein length:421 glutamate dehydrogenase  ali model follow..  45  2..ERTGFLEYVLNYVKKGVELGGFPEDFYKILSRPRRVLIVNIPVRLDGGGFEVFEGYRVQHCDVLGPYKGGVRFHPEVTLADDVALAILMTLKNSLAGLPYGGAKGAVRVDPKKLSQRELEELSRGYARAIAPLIGDVVDIPAPDVGTNAQIMAWMVDEYSKIKGYNVPGVFTSKPPELWGNPVREYATGFGVAVATREMAKKLWGGIEGKTVAIQGMGNVGRWTAYWLEKMGAKVIAVSDINGVAYRKEGLNVELIQKNKGLTGPALVEAEFVKNPDAIFKLDVDIFVPAAIENVIRGDNAGLVKARLVVEGANGPTTPEAERILYERGVVVVPDILANAGGVIMSYLEWVENLQWYIWDEEETRKRLENIMVNNVERVYKRWQREGWTMRDAAIVTALERIYNAMKIRGW. 420
8 -114.0001b26_A mol:protein length:416 GLUTAMATE DEHYDROGENASE  ali model follow..  46  2..PEKSLYEMAVEQFNRAASLMDLESDLAEVLRRPKRVLIVEFPVRMDDGHVEVFTGYRVQHNVARGPAKGGIRYHPDVTLDEVKALAFWMTWKTAVMNLPFGGGKGGVRVDPKKLSRNELERLSRRFFSEIQVIIGPYNDIPAPDVNTNADVIAWYMDTYSMNVGHTVLGIVTGKPVELGGSKGREEATGRGVKVCAGLAMDVLGIDPKKATVAVQGFGNVGQFAALLIQELGSKVVAVSDSRGGIYNPEGFDVEELIRYKKEHGTVVTYKGERITNEELLELDVDILVPAALEGAIHAGNAERIKAKAVVEGANGPTTPEADEILSRRGILVVPDILANAGGVTVSYFEWVQDLQSFFWDLDQVRNALEKMMKGAFNDVMKVKEKYNVDMRTAAYILAIDRVAYATKKRGI. 414
9 -113.0001euz_A mol:protein length:419 GLUTAMATE DEHYDROGENASE  ali model follow..  48  2..VEIDPFEMAVKQLERAAQYMDISEEALEWLKKPMRIVEVSVPIEMDDGSVKVFTGFRVQHNWARGPTKGGIRWHPAETLSTVKALATWMTWKVAVVDLPYGGGKGGIIVNPKELSEREQERLARAYIRAVYDVIGPWTDIPAPDVYTNPKIMGWMMDEYETIMRRPAFGVITGKPLSIGGSLGRGTATAQGAIFTIREAAKALGIDLKGKKIAVQGYGNAGYYTAKLAKEQGMTVVAVSDSRGGIYNPDGLDPDEVLKWKREHGSVKDFGATNITNEELLELEVDVLAPAAIEEVITEKNADNIKAKIVAEVANGPVTPEADDILREKGILQIPDFLCNAGGVTVSYFEWVQNINGYYWTEEEVREKLDKKMTKAFWEVYNTHKDKNIHMRDAAYVVAVSRVYQAMKDRGW. 416
10 -113.0001bvu_A mol:protein length:418 PROTEIN (GLUTAMATE DEHYDROGENASE)  ali model follow..  48  2...EQDPFEIAVKQLERAAQYMDISEEALEFLKRPQRIVEVSIPVEMDDGSVKVFTGFRVQYNWARGPTKGGIRWHPEETLSTVKALAAWMTWKTAVMDLPYGGGKGGVICNPKEMSDREKERLARGYVRAIYDVISPYTDIPAPDVYTNPQIMAWMMDEYETISRRPSFGVITGKPPSVGGIVARMDATARGASYTVREAAKALGMDLKGKTIAIQGYGNAGYYMAKIMSEEGMKVVAVSDTKGGIYNPDGLNADEVLAWKKKTGSVKDFGATNITNEELLELEVDVLAPSAIEEVITKKNADNIKAKIVAELANGPTTPEADEILYEKGILIIPDFLCNAGGVTVSYFEWVQNITGDYWTVEETRAKLDKKMTKAFWDVYNTHKEKNINMRDAAYVVAVSRVYQAMKDRGW. 415
11 -111.0004fcc_A mol:protein length:450 Glutamate dehydrogenase  ali model follow..  27  22.PNQTEFAQAVREVMTTLWPFLEQNPSLLERLVEPERVIQFRVVWVDDRNQVQVNRAWRVQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALTTLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDVPAGDIGVGGREVGFMAGMMKKLSN-NTACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGSGNVAQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKSSRDGRGLVYLEGQQPWSVPVDIALPCATQNELDVDAAHQLIANGVKAVAEGANTIEATELFQQAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGEGEQTNYVQGANIAGFVKVADAMLAQGV. 449
12 -110.0001aup_A mol:protein length:449 NAD-SPECIFIC GLUTAMATE DEHYDROGENASE  ali model follow..  28  16.ADEPEFVQTVEEVLSSLGPVVDAHPALLERMVIPERVIEFRVPWEDDNGKVHVNTGYRVQFNGAIGPYLGGLRFAPSVNLSIMKFLGFEQAFKDSLTTLPMGGAKGGSDFDPNGKSDREVMRFCQAFMTELYRHIGPDIDVPAGDLGVGAREIGYMYGQYRKIVGGFYNGVLTGKARSFGGSLVRPEATGYGSVYYVEAVMKHENDTLVGKTVALAGFGNVAWGAAKKLAELGAKAVTLSGPDGYIYDPEGITTEEKINYMLEMRASGRNGVQFFPGEKPWGQKVDIIMPCATQNDVDLEQAKKINVKYYIEVANMPTTNEALRLMQQPNMVVAPSKAVNAGGVLVVGFEMSQNSERLSWTAEEVDSKLHQVMTDIHDGSAAAAERYGLNLVAGANIVGFQKIADAMMAQGI. 447
13 -110.0003r3j_A mol:protein length:456 Glutamate dehydrogenase  ali model follow..  31  31.PEFLQAFEEVLSCLKPVFKKDNVYIGVLENIAEPERVIQFRVPWINDKGEHKMNRGFRVQYNSVLGPYKGGLRFHPAVNLSVIKFLGFEQIFKNSLTTLPMGGGKGGSDFDPKGKSENEILKFCQSFMTNLFRYIGPNTDVPAGDIGVGGREIGYLFGQYKKLKN-SFEGVLTGKNIKWGGSNIRAEATGYGVVYFAENVLKDLNDNLENKKCLVSGSGNVAQYLVEKLIEKGAIVLTMSDSNGYILEPNGFTKEQLNYIMDIKNNQRLRTAKYFENQKPWNIPCDIAFPCATQNEINENDADQNKCKMIVEGANMPTHIKALHKLKQNNIILCPSKAANAGGVAVSGLEMSQNSMRLQWTHQETDMKLQNIMKSIYEQCHNTSKIYLSDLVAGANIAGFLKVADSFLEQGG. 455
14 -109.0002yfh_A mol:protein length:448 GLUTAMATE DEHYDROGENASE, NAD-SPECIFIC GLUTAMATE DEHYDROGENASE, GLUTAMATE DEHYDROGENASE  ali model follow..  28  16YADEPEFVQTVEEVLSSLGPVVDAHPALLERMVIPERVIEFRVPWEDDNGKVHVNTGYRVQFNGAIGPYKGGLRFAPSVNLSIMKFLGFEQAFKDSLTTLPMGGAKGGSDFDPNGKSDREVMRFCQAFMTELYRHIGPDIDVPAGDLGVGAREIGYMYGQYRKIVGGFYNGVLTGKARSFGGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGSGNVAQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKASRDGRGLVYLEGQQPWSLPVDIALPCATQNELDVDAAHQLIANGVKAVAEGATTIEATELFQQAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARLHHIMTDIHDGSAAAAERYGLNLVAGANIVGFQKIADAMMAQGI. 446
15 -108.0005gud_A mol:protein length:471 Glutamate dehydrogenase  ali model follow..  31  35.AGEPEFHQAVAEVLESLKIVLEADYGLIQRLCEPERQLIFRVPWVDDQGQVHVNRGFRVQFNSALGPYKGGLRFHPSVNLGIVKFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGKSDLEIMRFCQSFMTELHRHIGEYRDVPAGDIGVGGREIGYLFGHYRRMANQHESGVLTGKGLTWGGSLVRTEATGYGCVYFVSEMIKAKGESISGQKIIVSGSGNVATYAIEKAQELGATVIGFSDSSGWVHTPNGVDVAKLREIKEVRRARVSVGATYHTDGSIWDLKCDIALPCATQNELNGENAKTLGCRFVAEGANMPSTPEAVEVFRERDIRFGPGKAANAGGVATSALEMQQNASRDSWSFEYTDERLQVIMKNIFKTCAETAAEYGNDYVVGANIAGFKKVADAMLAQGV. 462
16 -107.0001gtm_A mol:protein length:419 GLUTAMATE DEHYDROGENASE  ali model follow..  49  2...EADPYEIVIKQLERAAQYMEISEEALEFLKRPQRIVEVTIPVEMDDGSVKVFTGFRVQHNWARGPTKGGIRWHPEETLSTVKALAAWMTWKTAVMDLPYGGGKGGIIVDPKKLSDREKERLARGYIRAIYDVISPYEDIPAPDVYTNPQIMAWMMDEYETISRRKTFGIITGKPLSIGGSLGRIEATARGASYTIREAAVLGWDTLKGKTIAIQGYGNAGYYLAKIMSEDGMKVVAVSDSKGGIYNPDGLNADEVLKWKNEHGSVKDFGATNITNEELLELEVDVLAPAAIEEVITKKNADNIKAKIVAEVANGPVTPEADEILFEKGILQIPDFLCNAGGVTVSYFEWVQNITGYYWTIEEVRERLDKKMTKAFYDVYNIAKEKNIHMRDAAYVVAVQRVYQAMLDRGW. 416
17 -106.0002bma_A mol:protein length:470 GLUTAMATE DEHYDROGENASE (NADP+)  ali model follow..  28  44.VEFLQAFHEILYSLKPLFMEEPKYLPIIETLSEPERAIQFRVCWLDDNGVQRKNRCFRVQYNSALGPYKGGLRFHPSVNLSIVKFLGFEQIFKNSLTGLSMGGGKGGSDFDPKGKSDNEILKFCQAFMNELYRHIGPCTDVPAGDIGVGGREIGYLYGQYKKIVN-SFNGTLTGKNVKWGGSNLRVEATGYGLVYFVLEVLKSLNIPVEKQTAVVSGSGNVALYCVQKLLHLNVKVLTLSDSNGYVYEPNGFTHENLEFLIDLKEEKKGRTAKYFPNEKPWGVPCTLAFPCATQNDVDLDQAKLLQKNGVGEGANMPSTVDAINLFKSNNIIYCPSKAANAGGVAISGLEMSQNFQFSHWTRETVDEKLKEIMRNIFIACSENALKNKYDLQAGANIAGFLKVAESYIEQGC. 469
18 -101.0001hwy_A mol:protein length:501 GLUTAMATE DEHYDROGENASE  ali model follow..  34  26.....DKLVEDLKTRQTQEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSHQRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDEDLEKITRRFTMELAKKGGPGVDVPAPNMSTGEREMSWIADTYASTIGHNAHACVTGKPISQGGIHGRISATGRGVFHGIENFIENMTPGFGDKTFAVQGFGNVGLHSMRYLHRFGAKCVAVGESDGSIWNPDGIDPKELEDFKLQHGTILGFPKAKIYEGSILEVDCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPQADKIFLERNIMVIPDLYLNAGGVTVSYFQILKNLNHVSYGRLTVHSGLAYTMERSARQIMRTAMKYNLDLRTAAYVNAIEKVFRVYNEAGVT 499
19 -97.4001l1f_A mol:protein length:505 Glutamate Dehydrogenase 1  ali model follow..  34  25ASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKITRRFTMELAKFIGPGIDVPAPDMSTGEREMSWIADTYASTIGHNAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTVHSGLAYTMERSARQIMRTAMKYNLDLRTAAYVNAIEKVFKVYNEAGVT 503
20 -97.1005xvi_A mol:protein length:460 Glutamate dehydrogenase  ali model follow..  26  1MSNLPH-FEQAYKELASTLENSTLFQKALAVVSVPERVIQFRVVWEDDAGNVQVNRGFRVQFNSALGPYKGGLRFHPSVNLSILKFLGFEQIFKNALTGLNMGGGKGGSDFDPKGKSDNEIRRFCVSFMTELCKHIGADTDVPAGDIGVTGREVGFLFGQYRKIRN-QWEGVLTGKGGSWGGSLIRPEATGYGVVYYVEHMIAHATESFKGKRVAISGSGNVAQYAALKVIELGGSVVSLSDSQGSLIINGEGEIELIAQTKVERKQLASIKYIAGARPWVHVGKVDVALPSATQNEISGEEAQVLGCKFIAEGSNMGCTQEAIDTFEAHAIWYAPGKAANAGGVAVSGLEMAQNSARLSWTSEEVDARLKDIMRDCFKNGLETAQEYATSLVTGSNIAGFTKVAAAMKDQG.. 457
21 -94.2006dhm_A mol:protein length:582 Glutamate dehydrogenase 1, mitochondrial  ali model follow..  35  107.....DKLVEDLKTRETEEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKITRRFTMELAKFIGPGVDVPAPDMSTGEREMSWIADTYASTIGHNAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEATPGFGDKTFAVQGFGNVGLHSMRYLHRFGAKCVAVGESDGSIWNPDGIDPKELEDFKLQHGTILGFPKAKIYEGSILEVDCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTVHSGLAYTMERSARQIMRTAMKYNLDLRTAAYVNAIEKVFRVYNEAGVT 580
22 -93.3005k12_A mol:protein length:558 Glutamate dehydrogenase 1, mitochondrial  ali model follow..  35  83.....DKLVEDLKTRETEEQKRNRVRSILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKITRRFTMELAKFIGPGVDVPAPDMSTGEREMSWIADTYASTIGHYAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCITVGESDGSIWNPDGIDPKELEDFKLQHGTILGFPKAKIYEGSILEVDCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTVHSGLAYTMERSARQIMRTAMKYNLDLRTAAYVNAIEKVFRVYNEAGVT 556
23 -76.7001leh_A mol:protein length:364 LEUCINE DEHYDROGENASE  ali model follow..  23  1............................MEIFKYMEKYDYEQLVFCQDEAS--GLKAVIAIHDTTLGPALGGARMWTYNAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPFADKNEDMFRALGRFIQGL-----NGRYITAEDVGTTVDDMDLIHQETDY---------VTGISPAFGSSGNPSPVTAYGVYRGMKAAAKEASDSLEGLAVSVQGLGNVAKALCKKLNTEGAKLVVTDVNKAAVSAAVAEE-----------------GADAVAPNAIYGVTCDIFAPCALGAVLNDFTIPQLKAKVIAGSADNQLKPRHGKYLHELGIVYAPDYVINAGGVINVADELYG------YNRTRAMKRVDG-IYDSIEKIFAISKRDGVPSYVAADRMAEERIAKVAKARSQ. 352
24 -75.6003vpx_A mol:protein length:364 Leucine dehydrogenase  ali model follow..  23  1............................MEIFKYMEHQDYEQLVICQDKAS--GLKAIIAIHDTTLGPALGGTRMWTYASIEDALRLARGMTYKNAAAGLNLGGGKTVIIGNPKTDKNDEMFRAFGRYIEGL-----NGRYITAEDVGTTEADMDLINLETDY---------VTGTSAGAGSSGNPSPVTAYGIYYGMKAAAKEGDDSLAGKTVAVQGVGNVAYALCEYLHEEGAKLIITDINEEAVQRAVDA-----------------FGATAVGINEIYSQEADIFAPCALGAIINDETIPQLKAKVIAGSANNQLKETRGDLIHEMGIVYAPDYVINSGGVINVADELDG------YNRERALKRVEG-IYDVIGKIFAISKRDNIPTYVAADRMAEERIARVANTRST. 352
25 -73.7001bw9_A mol:protein length:356 PHENYLALANINE DEHYDROGENASE  ali model follow..  26  14............................................TVTRFDSMTGAHFVIRLDSTQLGPAAGGTRAAQYSNLTDAGKLAGAMTLKMAVSNLPMGGGKSVIALPAPRHSIDPSTWILRIHAENIDKLSG--NYWTGPDVNTNSADMDTLNDTTEF---------VFGRSLERGGAGSSAFTTAVGVFEAMKATVAHRLGSLDGLTVLVQGLGAVGGSLASLAAEAGAQLLVADTDTERVAHAVALGHTAV------------------ALEDVLSTPCDVFAPCAMGGVITTEVARTLDCSVVAGAANNVIADAASDILHARGILYAPDFVANAGGAIHLVGREVLG-----WSESVVHERAVA-IGDTLNQVFEISDNDGVTPDEAARTLAGRRAREASTTTATA 356
26 -73.7005b37_A mol:protein length:361 Tryptophan dehydrogenase  ali model follow..  22  1............................MLLFETVRE--MGHEQVLFCHSKNPEIKAIIAIHDTTLGPAMGATRILPYINLKDALRLSRGMTYKAACANIPAGGGKAVIIANPENKTDDLLRAYGRFVDSLNGRFIGQDVNITPDDVRTISQETKYVVGVSEKS-----------------GGPAPITSLGVFLGIKAAVESRWQSKRLDGMKVAVQGLGNVGKNLCRHLHEHDVQLFVSDVDPIKAEEVKRLF-----------------GATVVEPTEIYSLDVDIFAPCALGGILNSHTIPFLQASIIAGAANNQLENEQSQMLAKKGILYSPDYVINAGGLINVYNEMIG------YDEEKAFKQVHN-IYDTLLAIFEIAKEQGVTTNDAARRLAEDRINNSKRSKSKA 350
27 -11.0004q39_A mol:protein length:260 PYLD, pyrrolysine synthase  ali model follow..  11  22.................................................................................SAVQEVTGLDIKGICKALYGTFSSSEKVGIVPVTSGNGIIGNFSAS-LHAITQYFGFDSFVT------DMPDVSGYYEAVQEIILMADDRTFLAHNLKNGKMANNQPCTGIIYAEIASRYL-----KADSKDVLVVGLGKVGFPGAEHLVQKDFRVYGYD-----------------ADETLLERATSNLGIIPFDPANPKKFSI-IFEATPCANTIPEAV---LSENCVLSTPGIPCAISEELRDKYEVQLIAEPLGIGTASMLYSVL................................................................ 260
28 -10.4003d4o_A mol:protein length:293 Dipicolinate synthase subunit A  ali model follow..  20  141....................................................................................................................................................................................................TIMMAIQHTDFTIHGANVAVLGLGRVGMSVARKFAALGAKVKVGARES------------------DLLARIAEMGMEPFHISKAAQEDVDVCINTIPALVVTANVLAEMPHTFVIDLASKPGGTD-FRYAEKRGIKALPGIVATAGRILADVL................................................................ 285
29 -10.2002rir_A mol:protein length:300 Dipicolinate synthase, A chain  ali model follow..  19  143....................................................................................................................................................................................................TIMLAIQHTDYTIHGSQVAVLGLGRTGMTIARTFAALGANVKVGARSS------------------AHLARITEMGLVPFHTDELKEHDIDICINTIPSMILNQTVLSSMTKTLILDLASRPGGTD-FKYAEKQGIKALPGIVATAGQILANVL................................................................ 287
30 -9.4802a9f_A mol:protein length:398 putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating))  ali model follow..  12  70..............................................................................VISDGTAVLGLGDIGPEAAMPVMEG-AFAGVDAIPIVLDTKDTEE----IISIVKALAPTFGGINLEDISAPR-----IEQRLIKECHIPV--------------HDDQHGTAIVVLAAIFNSLKLLKKSLDEVSIVVNGGGSAGLSITRKLLAAGATKVTVVDKFGIINEQEAAQLAPHHLDIAKVTNREFKSGTLEDALE----GADIFIGVSAPGVLKAEWISKMAARPVIFAMANPIPEEAGAYIVGTGRSDFPNQINNV-GALDA-------------RAKTITVEMQIAAAKGIASLVPDDALSDAFKEGVAEIVAKSVRSVVLKSEG.. 392
31 -9.2002hae_A mol:protein length:386 Malate oxidoreductase  ali model follow..  20  159...........................................................................................................................................................................................QGTAVVVSAAFLNALKLTEKKIEEVKVVVNGIGAAGYNIVKFLLDLGVKNVVAVDRKGILNENDP---TCLNEYHLEIARITNPERLSGDLETALE-GADFFIGVSRGNILKPEWIKKMSRKPVIFALANPVPREAGAFIVATGRSDHPNQVNNL-GAVEKRSKITKNML-------SAVEAIARSCEPEPERIIPEAFDMKVHLNVYTAV--------KGSAEG.. 380

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.