current user: public

If you have questions about the server, please let us know.

Query: [ET] COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain, from VFDB

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MKKLVLSLSLVLAFSSATAAFAAIPQNIRIGTDPTYAPFESKNSQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGGLast
1 -108.0002m8c_A mol:protein length:241 Cationic amino acid ABC transporter, periplasmic binding protein  ali model follow..  98  1...................GGMAIPQNIRIGTDPTYAPFESKNSQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG 241
2 -107.0001hpb_P mol:protein length:238 HISTIDINE-BINDING PROTEIN  ali model follow..  98  1......................AIPQKIRIGTDPTYAPFESKNAQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPAVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG 238
3 -107.0005owf_A mol:protein length:259 Lysine/arginine/ornithine-binding periplasmic protein  ali model follow..  66  1.......MGSSSSGLVPRGSHMALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVKQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYG. 252
4 -105.0006ft2_A mol:protein length:246 Lysine/arginine/ornithine-binding periplasmic protein  ali model follow..  70  2......................ALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTAEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYG. 238
5 -99.4003tql_A mol:protein length:227 Arginine-binding protein  ali model follow..  34  1........................TDTIKFATEATYPPYVYMGPSGQVEGFGADIVKAVCKQMQAVCTISNQPWDSLIPSLKLGKFDALFGGMNITTARQKEVDFTDPYYTNSVSFIADKNTPLTLSKQGLKGKIIGVQGGTTFDSYLQDSFGN-SITIQRYPSEEDALMDLTSGRVDAVVGDTPLIKQWL-KQNGRREYVLIGKPVNDPNYFGKGVGIAVKKGNQALLLKLNKALAAIKANGVYAAIVQKYF....... 227
6 -96.8002y7i_A mol:protein length:229 STM4351  ali model follow..  31  1....................ASVSARTLHFGTSATYAPYEFVDADNKIVGFDIDVANAVCKEMQAECSFTNQSFDSLIPSLRFKKFDAVIAGMDMTPKREQQVSFSQPYYEGLSAVVVTRKGA-YHTFADLKGKKVGLENGTTHQRYLQDKQQ--AITPVAYDSYLNAFTDLKNNRLEGVFGDVAAIGKWLKNNPD---YAIMDERASDPDYYGKGLGIAVRKDNDALLQEINAALDKVKASPEYAQMQEKWFT...... 228
7 -96.7004zv1_A mol:protein length:233 AncQR  ali model follow..  35  2.......................MRGTLRVGTEATFPPFGFKDENGKLVGFDIDLAKAIAKKLGVKVEFKPMDFDGIIPALQSGKIDVVIAGMTITEERKKQVDFSDPYFEAGQAIVVKKGNDSIKSLEDLKGKKVGVQLGSTSEQHVKKVAKDAGVKVKKFDNFSEAFQELKSGRVDAVVTDNAVALAYVKQNPNA------GVKIVGETFSGEPYGIAVRKGNSELLEKINKALEEMKKDGTYDKIYEKWFG...... 226
8 -94.8004zef_A mol:protein length:251 Amino acid ABC transporter amino acid-binding/permease  ali model follow..  24  1........MGENLYFQGMKKITPKKEKYVIASDSTFAPFEFQNAQGDYVGIDVDLVKRAAELQGFTVEFKFIGFSSAVQAVESGQADGMVAGMTITDDRKKAFDFSVPYFDSGIQIAVKKGNDKIKSYDDLKGKKVGVKIGTESADFLEKNKKKYDYSIKYLDTTDALYSALEIGEVDAMMDDYPVIGYGVAQNQ--------PLATPIPREKGGSYGFAVKKGNPELLEMFNEGLKEMKRTGEYDKIIGTYVKDG.... 241
9 -94.5003del_B mol:protein length:242 Arginine Binding Protein  ali model follow..  25  3.................KEGGDSNSEKFIVGTNATYPPFEFVDKRGEVVGFDIDLAREISNKLGKTLDVREFSFDALILNLKQHRIDAVITGMSITPSRLKEILMIPYYGEEIKHLVLVFKGENKHPLPLTQYRSVAVQTGTYQEAYLQSL---SEVHIRSFDSTLEVLMEVMHGKSPVAVLEPSIAQVVLKDFPALSTATID----LPEDQWVLGYGIGVASDRPALALKIEAAVQEIRKEGVLAELEQKWGLNNL... 235
10 -94.4004kqp_A mol:protein length:232 Glutamine ABC transporter permease and substrate binding protein protein  ali model follow..  24  1..................GMATPKKDVYTIASDNSFAPFEFQNDDKQFTGIDVDLLNAIAKNQGFKLKWNFIGFQAAVDSVQSGHADGMMSGMSITDARKQVFDYGSPYYSSNLTIATSSTDDSIKSWKDLKGKTLGAKNGTASFDYLNAHAKEYGYTVKTFTDATTMYSSLNNGSINALMDDEPVIKYAIKQGQK--------FATPIKPIPDGQYGFAVKKGNPELIEMFNNGLANLRANGEYDKIIDKYLESDA... 232
11 -93.9003hv1_A mol:protein length:268 Polar amino acid ABC uptake transporter substrate binding protein  ali model follow..  26  1.....MSLRSHFATQKDQWQTYTKEKKIKIGFDATFVPMGYEEKDGSYIGFDIDLANAVFKLYGIDVEWQAIDWDMKETELKNGTIDLIWNGYSVTDERKQSADFTEPYMVNEQVLVTKKSSG-IDSVAGMAGKTLGAQAGSSGYDAFNASPKIANQKVVQYSTFTQALIDLNSGRIDGLLIDRVYANYYLEKSGVLDQYNVMP-----AGYEGESFAVGARKVDKTLIKKINQGFETLYKNGEFQKISNKWFGEDVAT. 253
12 -93.9004p0i_A mol:protein length:265 Nopaline-binding periplasmic protein  ali model follow..  36  2......................KDYKSITIATEGSYAPYNFKDAGGKLIGFDIDLGNDLCKRMNIECKFVEQAWDGIIPSLTAGRYDAIMAAMGIQPAREKVIAFSRPYLLTPMTFLTTADSPLLKFTKIFEGVKFGVQAGTSHEAFMKQMMP--SVQISTYDTIDNVVMDLKAGRIDASLASVSFLKPLT-DKPDNKDLKMFGPRM-TGGLFGKGVGVGIRKEDADLKALFDKAIDAAIADGTVQKLSQQWFGYDASP. 257
13 -93.7005ore_A mol:protein length:263 Octopine-binding periplasmic protein  ali model follow..  32  2.......................QEKSITIATEGGYAPWNFSGPGGKLDGFEIDLANALCEKMKAKCQIVAQNWDGIMPSLTGKKYDAIMAAMSVTPKRQEVIGFSIPYAAGINGFAVMGDSKLAEISSFLNGTTVGVQGSTTASTFLDKYFKG-SVDIKEYKSVEEHNLDLTSGRLDAVLANATVLAAAI-EKPEMKGAKLVGPLFSGGEF--GVVAVGLRKEDTALKADFDAAIKAASEDGTIKTLSLKWFKVDVTP. 256
14 -93.6004la9_A mol:protein length:254 Glutamine ABC transporter permease and substrate binding protein protein  ali model follow..  28  4MKKLFFALAMMLATVTAFLVAPKAETTVKIASDSSYAPFEFQNGQKKWVGIDVDIMQEVAKINDWKLEMSYPGFDAALQNLKAGQVDGIIAGMTITDERKETFDFSNPYYTSALTIATTKDSK-LSDYSDLKGKAVGAKNGTAAQTWLQENQKKYGYTIKTYSDGVHMFAALSSGNIAGAMDEVPVISYAMKQGQDLA-------MNFPSISLPGGYGFAVMKGNSTLVDGFNKALAEMKSNGDYDKILKKYGIT..... 253
15 -93.5004g4p_A mol:protein length:244 Amino acid ABC transporter, amino acid-binding/permease protein  ali model follow..  24  1.............MGENLYFQGMEGKKYTIGTDLTFAPFEFQDSKGKYIGIDVDLLDAIAKDQDFEVDLKPLGFDSAVQAIQSKQIDGMIAGMSITDERKKSFDFSDPYFDSGLQLAVKKGNDKIKSYDDLKGKTVAAKVGTESANFLEKNKEKYDYTIKNFDDATGLYKALENGEADAIVDDYPVLGYAVKNGQK--------LQLVGDKETGSSYGFAVKKGNPELIKKFNAGLKNLKDNGTYDKILNNYLA...... 234
16 -93.4003n26_A mol:protein length:246 Amino acid ABC transporter, periplasmic amino acid-binding protein  ali model follow..  27  1................MCESKIDRNRIWIVGTNATYPPFEYVDAQGEVVGFDIDLAKAISEKLGKQLEVREFAFDALILNLKKHRIDAILAGMSITPSRQKEIALLPYYGDEVQELMVVSKRSLTPVLPLTQHSSVAVQTGTFQEHYLLSQ---PGICVRSFDSTLEVIMEVRYGKSPVAVLEPSVGRVVLKDFPNLVATRLE----LPPECWVLGCGLGVAKDRPEEIQTIQQAITDLKSEGVIQSLTKKWQLSEVA.. 236
17 -93.0003qax_A mol:protein length:268 Probable ABC transporter arginine-binding protein ArtJ  ali model follow..  25  2IKQIGRFFRAFIFIMPLSLTSIDRNRIWIVGTNATYPPFEYVDAQGEVVGFDIDLAKAISEKLGKQLEVREFAFDALILNLKKHRIDAILAGMSITPSRQKEIALLPYYGDEVQELMVVSKRSLTPVLPLTQYSSVAVQTGTYQEHYLLSQ---PGICVRSFDSTLEVIMEVRYGKSPVAVLEPSVGRVVLKDFPNLVATRLE----LPPECWVLGCGLGVAKDRPEEIQTIQQAITDLKSEGVIQSLTKKWQLSEV... 256
18 -92.8004ohn_A mol:protein length:257 ABC transporter substrate-binding protein  ali model follow..  26  10.................NWSKYQSNKSITIGFDSTFVPMGFAQKDGSYAGFDIDLATAVFEKYGITVNWQPIDWDLKEAELTKGTIDLIWNGYSATDERREKVAFSNSYMKNEQVLVTKKSSG-ITTAKDMTGKTLGAQAGSSGYADFEANPEIANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVLNDYNVFT-----VGLETEAFAVGSRKEDTTLVKKINEAFSSLYKDGKFQEISQKWFGEDVA.. 249
19 -92.3001ggg_A mol:protein length:226 GLUTAMINE BINDING PROTEIN  ali model follow..  26  1.......................ADKKLVVATDTAFVPFEFKQ-GDLYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANI--KTKDLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQ-------KAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGTE.... 224
20 -91.6004oen_A mol:protein length:223 Second substrate binding domain of putative amino acid ABC transporter  ali model follow..  27  1.......................GKAKYIIASDSSFAPFVFQNSSNQYTGIDMELIKAIAKDQGFEIEITNPGFDAAISAVQAGQADGIIAGMSVTDARKATFDFSESYYTANTILGVKESSN-IASYEDLKGKTVGVKNGTASQTFLTENQSKYGYKIKTFADGSSMYDSLNTGAIDAVMDDEPVLKYSISQGQ--------KLKTPISGTPIGETAFAVKKGNPELIEMFNNGLANLKANGEFQKILDKYLA...... 223
21 -91.3003i6v_A mol:protein length:232 periplasmic His/Glu/Gln/Arg/opine family-binding protein  ali model follow..  31  2......................SLADTVRMGTEGAYPPYNFINDAGEVDGFERELGDELCKRAGLTCEWVKNDWDSIIPNLVSGNYDTIIAGMSITDERDEVIDFTQNYIPPTASSYVATSDG-----ADLSGI-VAAQTATIQAGYIAE----SGATLVEFATPEETIAAVRNGEADAVFADRDYLVPIVAESGGELMF------VGDDVPLGGGVGMGLRESDGELRGKFDAAITSMKEDGTLNTMIKKWFGEDA... 220
22 -91.1003vv5_A mol:protein length:260 Amino acid ABC transporter, binding protein  ali model follow..  28  6...VPRGSHGGSEFQVRSFEEIKRSGEIRIGTEGAFPPFNYFDERNQLTGFEVDLGNAIAERLGLKPRWIAQSFDTLLIQLNQGRFDFVIASHGITEERARAVDFTNPHYCTGGVIVSRKGG--PRTAKDLQGKVVGVQVGTTYMEAAQKIPG--IKEVRTYQRDPDALQDLLAGRIDTWITDRFVAKEAIKERKLEN------TLQVGELVFQERVAMAVAKGNKSLLDALNRALAELMQDGTYARISQKWFGEDVRC. 251
23 -91.0003kzg_A mol:protein length:237 Arginine 3rd transport system periplasmic binding protein  ali model follow..  27  1.......................MSLNLTIGTSKFNPPFEVWSNNSSLYGFDIDLMQEICRRLHATCTFEAYIFDDLFPALKNREVDLVIASMIITDERKKHFIFSLPYMESNSQYITTVDSK-ISTFDDLHGKKIGVRKGTPYARQVLSENR--NNQVIFYELIQDMLLGLSNNQVDASLMDYEAAKYWMASEPYAYKLIGKKYKIGKKISIGEGYSIMANPDQFVLIKKINKILLEMEADGTYLRLYSEYFE...... 230
24 -90.5004f3p_A mol:protein length:249 Glutamine-binding periplasmic protein  ali model follow..  28  1........MAMGTLEAQTQGPGSMAKELVVGTDTSFMPFEFKQ-GDKYVGFDLDLWAEIAKGAGWTYKIQPMDFAGLIPALQTQNIDVALSGMTIKEERRKAIDFSDPYYDSGLAAMVQANNTTIKSIDDLNGKVIAAKTGTATIDWIKAHL--KPKEIRQFPNIDQAYLALEAGRVDAAMHDTPNVLFFVNNEGKGR-------KVAGAPVSGDKYGIGFPKGS-PLVAKVNAELARMKADGRYAKIYKKWFGSEPPK. 241
25 -89.0004dz1_A mol:protein length:259 DalS D-Alanine transporter  ali model follow..  19  2LSKKFGLSMIVLGIMSSSAFADSEGRTLNVAVSPASPPMLFKSADGKLQGIDLELFSSYCQSRHCKLNITEYAWDGMLGAVASGQADVAFSGISITDKRKKVIDFSEPYYINSFYLVSMANHKILNNLNELNKYSIGYPRGMAYSDLIKNDLEPKGSKVKLYPTYNETMADLKNGNLDLAFIEEPVYFTFKNKKKMP-------IESRYVFKNVDQLGIAFKKGS-PVRDDFNLWLKE-QGPQKISGIVDSWM....... 252
26 -88.0004prs_A mol:protein length:227 ABC-type transporter, periplasmic subunit family 3  ali model follow..  34  1.................AIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELKIVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFPKTYEDLVGKTVAVQIGTTGDIEVSKY---DGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPD--------LVISSGVLSSEQYGIAVRKEDTDLLEFINSVLRELK-KSPYDVLIEKWFS...... 226
27 -87.7002yln_A mol:protein length:283 PUTATIVE ABC TRANSPORTER, PERIPLASMIC BINDING PROTEIN, AMINO ACID  ali model follow..  23  10DDKHMAAAGGSEGGSGASSAPANNKGTVTVGTEGTYAPFTYHDKDGKLTGYDVEVTRAVAEKLGVKVEFKETQWDSMMAGLKAGRFDVVANQVGLTPERQATFDKSEPYSWSGAVLVAHNDSN-IKSIADIKGVKTAQSLTSNYGEKAKA----AGAQLVPVDGLAQSLTLIEQKRADATLNDELAVLDYLKKNPNAG-VKIVWSAPADEK---VGSGLIVNKGNDEAVAKFSTAINELKADGTLKKLGEQFFGKDIS.. 271
28 -87.7004i62_A mol:protein length:269 Amino acid ABC transporter, periplasmic amino acid-binding protein, putative  ali model follow..  24  5MKKVLMTMFGLVMLPLLFACSNKSKGKLVVALNPDFAPFEYQDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLAISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSDLAYQSVNDLAQKKVGAQKGSIQETMAKDLL--QNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPDLAIADLNF-----EKEQDDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASI... 267
29 -87.7003k4u_A mol:protein length:245 BINDING COMPONENT OF ABC TRANSPORTER  ali model follow..  23  2......................SLRGELRVGLEPGYLPFEMKDKKGNVIGFDVDLAREMAKAMGVKLKLVPTSWDGLIPGLVTEKFDIIISGMTISQERNLRVNFVEPYIVVGQSLLVKKGLEKVKSYKDLDKPTLVTKFGVSAEYAAKRLFK--NAKLKTYDTEAEAVQEVLNGKADMFIFDLPFNVAFMAQKGQGY------LVHLDTSLTYEPLGWAIKKGDPDFLNWLNHFLAQIKHDGSYDELYERWFVDTKW.. 232
30 -87.0004ymx_A mol:protein length:260 ABC-type amino acid transport system, periplasmic component  ali model follow..  24  1MNKKSLFLAFAVVFALAFMLSGKQKGVIVMGTSADFPPFEFHKVEGEIVGFDIDIANAIAKKLGVKLEIKDMDFKGLIPALQAGRVDMVIAGMTPTAERKKSVDFSDLYYDSRQVVVVKNDSP-ISKFDDLKVKTIAVQIGTTSEEAAKKI---PNVKLKQLNRVSDEFMDLQNGRCDAIVVEDTVAKAYLKEYKDMKILY-----MDEINNVENGSAVAVAKGNKSLLDVVNEVIKELKQSGEYDKLVDKWFK...... 259
31 -87.0004f3s_A mol:protein length:255 Putative periplasmic binding protein  ali model follow..  19  3...................DSIVEGRTLNVAVSPASPPMLFKSADGKLQGIDLELFSSYCQSRHCKLNITEYAWDGMLGAVASGQADVAFSGISITDKRKKVIDFSEPYYINSFYLVSMANHKILNNLNELNKYSIGYPRGMAYSDLIKNDLEPKGSKVKLYPTYNETMADLKNGNLDLAFIEEPVYFTFKNKKKMP-------IESRYVFKNVDQLGIAFKKGS-PVRDDFNLWLKEQ-GPQKISGIVDSWMKAENLY. 238
32 -86.2005l9m_A mol:protein length:269 Deoxyfructosyl-amino Acid Transporter Periplasmic Binding Protein  ali model follow..  27  3...SSSSGLVPRGSHMDNPLGLIDPTTISVGTMGDAKPYAFTTADGNFTGFDIELFLNVAGRLGFKVVFTGQEFSALMPSVANGRFDVAAAAIGTTAKRKETVDFSDGYLAGFLSVLTSEAG--ITDAAGLKGKRLGVVQGTLQEIYAEKNFA--GTDLVKFPDNNSAVSALNNGTVDAHFLDFEAAKDYSARYPALK-------IAVNIPSFDAPAGFVIRKGNDALRNALDKGLKEAMQDGTWKKLHEKWFPGTPM.. 249
33 -86.1003h7m_A mol:protein length:234 Sensor protein  ali model follow..  19  1...............GSADAPRDRHRTIVVGGDRDYPPYEFIDQNGKPAGYNVELTRAIAEVMGMTVEFRLGAWSEMFSALKSGRVDVL-QGISWSEKRARQIDFTPPHTIVYHAIFARRDSPPAAGLEDLRGRKVALHRDGIMHEYLAERG--YGKDLVLTPTPADALRLLAAGGCDYAVVAMVPGMYIIRENR------LTNLVPVARSIAAQRYGYAVRQGDAELLARFSEGLAILRKTGQYEAIRAKWLGVL.... 232
34 -86.1002pvu_A mol:protein length:272 ArtJ  ali model follow..  24  1MGSSSSGLVPRGSHMGGGRSTETTKKKVVVGTDAAFAPFEYMQ-KGKIVGFDVDLLDAVMKAAGLDYELKNIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEATQVILVKQGSP-VKNALDLKGKTIGVQNATTGQEAAEKLFG-KGPHIKKFETTVVAIMELLNGGVDAVITDNAVANEYVKNNPNKKLQVIE----DPKNFASEYYGMIFPK-NSELKAKVDEALKNVINSGKYTEIYKKWFGKEPKL. 261
35 -86.0004h5f_A mol:protein length:243 Amino acid ABC superfamily ATP binding cassette transporter, binding protein  ali model follow..  22  4.................AVEAIKQKGKLVVATSPDYAPFEFQDGKNQVVGADIDMAQAIADELGVKLEILSMSFDNVLTSLQTGKADLAVAGISATDERKEVFDFSIPYYENKISFLVHKADVEYKDLTSLESANIAAQKGTVPESMVKEQLP--KAQLTSLTNMGEAVNELQAGKIDAVHMDEPVALSYAAKNAGLAVAT-----VSLKMKDGDANAVALRKNSDDLKEVVDKVIQKLKDEGTYQSYLEKAASLTEVE. 242
36 -85.6005t0w_A mol:protein length:247 AncCDT-1  ali model follow..  31  1.........MRGSIAASTLDEIMKRGTLRVGTDADYKPFSFKDKNGQYTGFDIDLAKALAKELGVKVEFVPTTWDGIIPALQTGKFDIVMSGMTITPERKKKVDFSDPYMTAGQTILVKKDNADIKSFEDLNKPKVAVQLGTTSEQAAKEFLP--KAKIRTFENNAEAFQEVVSGRADAMVTDSPVAAYYAKKNPG------LAVVVVDEPFTHEPLGFAIRKGDPELLNWVNNWLKQMKKDGTYDKLYEKWFKL..... 241
37 -83.4004gvo_A mol:protein length:243 Lmo2349 protein  ali model follow..  22  1.................SNAANQKVQTITVGTGTQFPNVCFLDENGKLTGYDVELVKEIDKRLGYKFKFKTMDFSNLLVSLGAGKVDIVAHQMEKSKEREKKFLFNDVAYNNFPLLTVLDSNNSINSTKDLAGKRVITSATSNGALVLKKINEEQGEIAYEGQGSNDTANQLKTGRADATISTPFAVDFQNKTSA-------IKEKVVGDVLSNAKVYFMLGKDETKLSKKVDEALQSIIDDGTLKKLSEKWLGADYS.. 239
38 -83.1005jos_A mol:protein length:247 Cyclohexadienyl dehydratase  ali model follow..  27  1.........MRGSIAASRLDEIMERGTLRVGTTGDYKPFSYRDPDGQYTGFDIDVAKSLAKSLGVKVEFVPTTWPTLMSDLQADKFDIAMGGVTVTPERQKKADFSDPYMTFGKTPLVRKEDADFKSLEDINRPRVAVNPGGTNEKFAREHLK--KAKITVYENNVEIFQEVASGRADVMITDTVEALYYAKKHPG------LAAVLVDKPFTHSEKGYMMPKGDQEFLNYVNQWLDQMKQQGTYEKLYEKWLKL..... 241
39 -83.0002iee_A mol:protein length:271 Probable ABC transporter extracellular-binding protein yckB  ali model follow..  20  13.................GWEQIKDKGKIVVATSGTLYPTSYHDTDDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVNSGQVDAAANDIDVTKDREEKFAFSTPYKYSYGTAIVRKDDLSIKTLKDLKGKKAAGAATTVYMEVARKYGAK--EVIYDNATNEQYLKDVANGRTDVILNDYYLQTLALAAFPDLN------TIHPDIKYMPNKQALVMKKSNAALQKKMNEALKEMSKDGSLTKLSKQFFNKADV.. 250
40 -81.7002o1m_A mol:protein length:258 Probable amino-acid ABC transporter extracellular-binding protein ytmK  ali model follow..  23  8.................TGAGQKKVQTITVGTGTQFPNICFIDEKGDLTGYDVELIKELDKRLHYKFTFKTMEFSNLLVSLGQHKVDIVAHQMEKSKEREKKFLFNKVAYNHPLKITVLQNNDTIRGIEDLKGKRVITSATSNGALVLKKWNEDNGEIAYEGQGANETANQLKSGRADATISTPFAVDFQNKTST-------IKEKTVGNVLSNAKVYFMFNKNEQTLSDDIDKALQEIIDDGTLKRLSLKWLGDDYS.. 246
41 -81.3004eq9_A mol:protein length:246 ABC transporter substrate-binding protein-amino acid transport  ali model follow..  21  1..................SNAAASKKEIIVATNGSPRPFIY-EENGELTGYEIEVVRAIFKDSDYDVKFEKTEWSGVFAGLDADRYNMAVNNLSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQLEAYNAEPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGL-DNLKVIELPSDQQ----PYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYL.. 239
42 -80.3002pyy_A mol:protein length:228 Ionotropic glutamate receptor bacterial homologue  ali model follow..  25  2........................QQPLLVATR-VIPPFVLSN-KGELSGFSIDLWRSIATQIGIESKLIESSVPELISAIKDNKVNLGIAAISITAEREQNFDFSLPIFASGLQIMVRNLESGIRSIDDLPGKVVATTAGSTAATYLRE----HHISVLEVPKIEEAYKALQTKKADAVVFDAPVLLFYAANEGKGK------VEIVGSILREESYGIILPN-NSPYRKPINQALLNLKENGTYQSLYDKWFDPKN... 225
43 -79.7004io2_A mol:protein length:248 Glutamate receptor 1  ali model follow..  18  1..................GSARLKGITLRIGVIESVPFTIVANNTTKLTGYVLDLIEYLRDKMGFVADVPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCN--------TLVGEDFDKSTFGIVTPKEW-LYAKDLDVNILSLRETGILDNLKKKWFQTKA... 246
44 -78.1004c0r_A mol:protein length:248 PUTATIVE AMINO ACID BINDING PROTEIN  ali model follow..  18  2........................DKTVTLATVGTTNPFSY-EKKGKLTGYDIEVAKEVFKASDYDVKYQKTEWTSIFSGLDSDKYQIGANNISYTKERANKYLYSNPTASNPLVLVVPKDSD-IKSYNDIAGHSTQVVQGNTTVPMLQKFNKNHENNNFTSEDLAHQIRNVSDGKYDFKIFEKISAETIIKEQGLDN------KVIDLPSDQKPYVYFIFAQDQKDLQKFVNKRLKKLYENGTLEKLSKKYLGGSYL.. 233
45 -77.8001xt8_A mol:protein length:292 putative amino-acid transporter periplasmic solute-binding protein  ali model follow..  22  1MKYLLPTAAAGLLLLAAQPAMAKQNGVVRIGVFGDKPPFGYVDEKGNNQGYDIALAKRIAKELENKVQFVLVEAANRVEFLKSNKVDIILANFTQTPQRAEQVDFCSPYMKVALGVAVPKDSN-ITSVEDLKDKTLLLNKGTTADAYFTQNYP--NIKTLKYDQNTETFAALMDKRGDALSHDNTLLFAWVKDHPDFK-------MGIKELGNKDVIAPAVKKGDKELKEFIDNLIIKLGQEQFFHKAYDETLKAHF... 268
46 -77.6001ii5_A mol:protein length:233 Slr1257 protein  ali model follow..  15  1......................GSAMALKVGVVG-NPPFVFYGENAAFTGISLDVWRAVAESQKWNSEYVRNSISAGITAVAEGELDILIGPISVTPERAEGITFTQPYFSSGIGLLIPGTATLFRSVGDLKNKEVAVVRDTTAVDWANF----YQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLN-------EVTEIRVSLEPYGFVLKE-NSPLQKTINVEMLNLLYSRVIAEFTERWLGPGIEE. 231
47 -77.3002yjp_A mol:protein length:291 PUTATIVE ABC TRANSPORTER, PERIPLASMIC BINDING PROTEIN, AMINO ACID  ali model follow..  19  6HIDDDDKHMVGLTAAGGGSGDAKEKGVIRIGVFGDKPPFGYVDANGKNQGFDVEIAKDLAKDLPDKVEFVLTEAANRVEYVRSGKVDLILANFTQTPERAEAVDFADPYMKVALGVVSPKNKP-ITDMAQLKDQTLLVNKGTTADAFFTKSHP--EVKLLKFDQNTETFDALKDGRGVALAHDNALLWAWAKENPNFE-------VAIGNLGPAEFIAPAVQKGNADLLNWVNGEIAAMKKDGRLKAAYEKTLLPVY... 269
48 -77.1005kkw_A mol:protein length:249 Cyclohexadienyl dehydratase  ali model follow..  23  1.........MRGSIAESKLDQILSSGELKVGTTGDWDPMAMKDPTNKYKGFDIDVMQELAKDMGVKITFVPTEWKTIVSGITAGRYD-ISTSVTKTPKRAEVAGFTDSYYKYGTVPLVLKKNKKYSTWKSLNNKTIATTLGTSQEEKAKEFFPL--SKLQSVESPARDFQEVLAGRADGNITSSTEANKLVVKYPQLA-------IVPDGEKNPAFLAMMVSKNDQVWNDYVNEWIKSKKSSGFFNKLLAKYNLKSL... 242
49 -76.2005hpq_A mol:protein length:255 Cyclohexadienyl dehydratase  ali model follow..  16  1.........MRGSIQESRLDRILESGVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSEEAFQTLEQIDGVTAIVNPGGTNEKFARANLK--KARILVHPDNVTIFQQIVDGKADLMMTDAIEARLQSRLHPE------LCAVHPQQPFDFAEKAYLLPR-DEAFKRYVDQWLHIAEQSGLLRQRMEHWLEYRW... 242
50 -75.1003kbr_A mol:protein length:239 Cyclohexadienyl dehydratase  ali model follow..  17  12......................LESGVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSEEAFQTLEQIDGVTAIVNPGGTNEKFARANLK--KARILVHPDNVTIFQQIVDGKADLMMTDAIEARLQSRLHPE------LCAVHPQQPFDFAEKAYLLPR-DEAFKRYVDQWLHIAEQSGLLRQRMEHWLEYR.... 239
51 -74.7005eyf_A mol:protein length:245 Glutamate ABC superfamily ATP binding cassette transporter, binding protein  ali model follow..  26  12......................KSTNEIIWGVKYDTRLFGMMDESRTVQGFDVDIAKAITKKINGKTEFVEVTSKTRIPLLKNGNIDAIIATMTITDERKKQVDFSDVYFDAGQALLVKKGSQ-IKSVDDLNASTVLAVKGSTSAANIRQHAP--DAKILELENYAEAFTALQSGQGDAMTTDNAILLGIADENPE---------ELVGGTFTNEPYGIAINKGQENFLKAVNQALEEMHADGTYDKIYQKWFPNET... 240
52 -74.7002q88_A mol:protein length:257 Putative ABC transporter amino acid-binding protein  ali model follow..  19  8....................ELKEQGFARIAIA-NEPPFTAVGADGKVSGAAPDVAREIFKRLGVAVVASISEYGAMIPGLQAGRHDAITAGLFMKPERCAAVAYSQPILCDAEAFALKKGNPLYKDIADNPDAKIGAPGGGTEEKLALEA-GVPRDRVIVVPDGQSGLKMLQDGRIDVYSLPVLSINDLVSKAND-PNVEVLAPVEGAPV---YCDGAAFRKGDEALRDAFDVELAKLKESGEFAKIIEPYGFSA.... 242
53 -71.9005bwj_A mol:protein length:227 Sensory transduction histidine kinase, putative  ali model follow..  14  3......................FSKDIFKFKLVDQFFPFYYKNNKGEYEGLIFSILDKWAKDNNADIMVEHIDNL----NESEIEDEAIYLGLTYNVKLNDFFYFKSELARSISILFFKNSNKKNTHSTFLSNFNIGVIKNTIYEDILRLKNVN---TIFLADNSQELVLALKNDKVDYIYGDCKTLHYIANNFLSEDLVIFTG-----DVFYSIKNRVAISRNAPEIVKNLNLDLFSYLMKMPE-ELVFSFLDSNA... 226
54 -71.9002v25_A mol:protein length:259 MAJOR CELL-BINDING FACTOR  ali model follow..  19  3FRKSLLKLAVFALGACVAFSNAKSKGQLIVGVKNDVPHYALLDQTGEIKGFEVDVAKLLAKSIDKKIKLVAVNAKTRGPLLDNGSVDAVIATFTITPERKRIYNFSEPYYQDAIGLLVLKEKK-YKSLADMKGANIGVAQAATTKKAIGEAAKKIDVKFSEFPDYPSIKAALDAKRVDAFSVDKSILLGYVDDK----------SEILPDSFEPQSYGIVTKKDDPAFAKYVDDFVKEH--KNEIDALAKKWG....... 258
55 -71.1006h2t_A mol:protein length:288 Probable glutamine-binding lipoprotein GlnH (GLNBP)  ali model follow..  22  49......................RARGRLIVGLDIGSNLFSFRDPTGEITGFDVDIAGEVARDIFGVVEYRILSAAERVTALQKSQVDIVVKTMSITCERRKLVNFSTVYLDANQRILAPRDSP-ITKVSDLSGKRVCVARGTTSLRRIREIAP--PPVIVSVVNWADCLVALQQREIDAVSTDDTILAGLVEEDPY--------LHIVGPDMADQPYGVGINLDNTGLVRFVNGTLERIRNDGTWNTLYRKWLTVL.... 275
56 -70.4002ia4_A mol:protein length:287 Putative periplasmic binding transport protein  ali model follow..  23  14......................AKNGVIVVGHRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGD-IKDFADLKGKAVVVTSGTTSEVLLNKLNEEQNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNWDIVG-----KPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPI... 251
57 -68.2003oek_A mol:protein length:286 Glutamate [NMDA] receptor subunit epsilon-4  ali model follow..  15  3DTQHLTVATLEERPFVIVEPADPISGRSQLNRTHSPPPDAPRPEKRCCKGFCIDILKRLAHTIGFSYDLIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARGTTVSGLSDRKFPLKFGTVPNGSTEKNIRSNYPDSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIG----SGKVFATTGYGIALHKGS-RWKRPIDLALLQFLGDDEIEMLERLWLS...... 281
58 -64.2006H30 Entity 1(prereleased)  ali follow..  27  1......................GMETTVKIASDSSYAPFEFQNGQKKWVGIDVDIMQEVAKINDWKLEMSYPGFDAALQNLKAGQVDGIIAGMTITDERKETFDFSNPYYTSALTIATTKDSK-LSDYSDLKGKAVGAKNGTAAQTWLQENQKKYGYTIKTYSDGVHMFAALSSGNIAGAMDEVPVISYAMKQGQDLA-------MNFPSISLPGGYGFAVMKGNSTLVDGFNKALAEMKSNGDYDKILKKYGITA.... 227
59 -62.4005uh0_A mol:protein length:243 Membrane-bound lytic murein transglycosylase F  ali model follow..  17  9......................KARGELRVSTI--SSPLIYSTEKDTPSGFDYELAKRFADYLGVKLVIIPHNIDDLFDALDNDDTDLLAAGLIYNRERLNRARTGPAYYSVSQQLVYRLGSPRPKSFSDLKGQVVVASGSAHMTTLKRTKYPELNWSSSVDKSGKELLEQVAEGKLDYTLGDSATIALLQRIHPQ--------LAVAFDVTDEEPVTWYFKQSDDSLYAAMLDFYSEMVEDGSLARLEEKYLG...... 235
60 -62.0005sv6_A mol:protein length:291 Extracellular solute-binding protein, family 3  ali model follow..  15  16..RMLPSFLALLLGSGLAFNAQANTSTLKVCAASDEMPYS----NKQQEGFENQLAKILADTMDRELEFVWSDKAAVTEKLLKNQCDVVMG----VDKGDPRVATSDPYYKSGYAFIYPADKGLWQSPALKDMSKFAIVPGSPSEVMLREIDKYEGNNQYVRYAPDLLVSEVVSGKADIAHIWAPEAARYVKSASVPLKMVVSEEIAPEGVRQQFEQSIAVRSDDQELLKEINTALHKAD--PKIKAVLKDEG....... 281
61 -61.8006gpc_A mol:protein length:126 Amino acid ABC transporter, periplasmic amino acid-binding protein,Amino acid ABC transporter, periplasmic amino acid-binding protein  ali model follow..  30  1.................AIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRLGVELKIVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGGGGSGEQEDTDLLEFINSVLREL............................................................................................................................ 126
62 -56.3002rc7_A mol:protein length:294 Glutamate [NMDA] receptor subunit 3A  ali model follow..  15  39...............MTNDSSMLDRLFSSLHSSNDTVPIKFKK---CCYGYCIDLLEQLAEDMNFDFDLKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRGTELSGIHDPKLHRFGTVRESSAEDYVRQSFPEMHEYMRRYNPDGVQYLKNDPEKLDAFIMDKALLDYEVSIDADCK------LLTVGKPFAIEGYGIGLPPNS-PLTSNISELISQYKSHGFMDVLHDKWYKVV.... 290
63 -51.8003mpk_A mol:protein length:267 Virulence sensor protein bvgS  ali model follow..  15  23......................ADHPVVKVAVLNLFAPFTLFRTDEQFGGISAAVLQLLQLRTGLDFEIIGDTVEELIAKLRSGEAD-MAGALFVNSARESFLSFSRPYVRNGMVIVTRQDPDAPVDADHLDGRTVALVRNSAAIPLLQRRYPQ--AKVVTADNPSEAMLMVANGQADAVVQTQISASYYVNRY---GKLRIASAL----DLPPAEIALATTRGQTELMSILNKALYSISND-ELASIISRWRGSDG... 249
64 -48.4005h8f_A mol:protein length:285 Glutamate receptor ionotropic, NMDA 2A  ali model follow..  16  5.DNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSKKCCKGFCIDILKKLSRTVKFTYDLVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRGTQVTGLSDKKFQRRFGTVPNGSTERNIRNNYPYMHQYMTKFKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYI----FATTGYGIALQKGS-PWKRQIDLALLQFVGDGEMEELETLWLT...... 280
65 -47.8004z9n_A mol:protein length:328 Amino acid ABC transporter, periplasmic amino acid-binding protein  ali model follow..  17  1.............MAADTLSDVKAKGFLQCGVNTGLLGFASPNDKGEWSGFDVDYCRAVASAIPTKVKFTPLNAKERFTALQSGEVDVLIRNTTWTISRDTSLDFAGINYYDGQGFMINSKKLAINSALQLSGASICVQAGTTTELNMADYFRANKYNPVVFEKIEEANAAYDSGRCDAYTTDQSSLYGVRLALANPDDHVILP-----EIISKEPFGLTVRQGDARVVRWTHNALLNAEEYGITQANVEEMKKSD.... 249
66 -45.7002a5s_A mol:protein length:284 N-methyl-D-aspartate receptor NMDAR2A subunit  ali model follow..  16  4.DNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVEGMNVKKCCKGFCIDILKKLSRTVKFTYDLVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRGTQVTGLSDKKFQRRFGTVPNGSTERNIRNNYPYMHQYMTRFRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYI----FATTGYGIALQKGSP-WKRQIDLALLQFVGDGEMEELETLWLT...... 279
67 -44.7005gzs_A mol:protein length:446 GGDEF family protein  ali model follow..  15  221......................NVQRVLRVKLENNP-QYALYQPDGSVRGISADVVFQACEMLLLKCELVSNTWESMFDDLQDKSID-ILAPITVSQQRKNLAYFSESYYHPQAILVKREHDDVYSNVSELVAERIGVIKDDFFEELLQQMLPN--KILFSYASQEEKVQALLNKEVDYIVLNRANFNLLLRESTEMLPI-VEDTMIGSFYQYDIAIGFAKNPLGATLAPLFSRAIKMLNTE----QIIHTY........ 446
68 -41.4004q0c_A mol:protein length:584 Virulence sensor protein BvgS  ali model follow..  16  337......................ADHPVVKVAVLNLFAPFTLFRTDEQFGGISAAVLQLLQLRTGLDFEIIGVTVEELIAKLRSGEAD-MAGALFVNSARESFLSFSRPYVRNGMVIVTRQDPDAPVDADHLDGRTVALVRNSAAIPLLQRRYPQ--AKVVTADNPSEAMLMVANGQADAVVQTQISASYYVNRYFAGK------RIASALDLPPAEIALATTRGQTELMSILNKALYSISND-ELASIISRWRGSDG... 563
69 -38.3002rca_A mol:protein length:292 Glutamate [NMDA] receptor subunit 3B  ali model follow..  16  61..........................................TLRRCCYGYCIDLLERLAEDLAFDFELYIVGWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRGTELSGIHDPKHPSQGFRFGTVWESSAEAYIKASFPEMHAHTPHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCK------LLTVGKPFAIEGYGIGLPQNSP-LTSNLSEFISRYKSSGFIDLLHDKWYK...... 286
70 -36.1004yki_A mol:protein length:256 ML032222a iGluR  ali model follow..  17  1..................GSKNLIGRHLRLGSVEE-QPFMFFATEGCWSGMVNDMVVKLSEDLGFTYEYTTNEWNGMIRDLLDDKTDMIAIDLSTNSARKSAIDYSFPFMDAGIKAVVKGEGTTLNQVLELLDQKWGVIGSRHPETLLKTHRDSRYSRLVDEGKDLNHAIETLRGGLFVFIDEGPVLAHNLISDCD--------VFSVGEEFQSFEYAFGLPKDSP-YKSLIDSHLLKFREEGFIDILWEKWS....... 249
71 -34.2004zdm_A mol:protein length:261 Glutamate receptor kainate-like protein  ali model follow..  16  1..................GSNNLNGMHLRLGIIPE-MPFISEPSLGCYTGVNVEIVSMMSQDLNFTYNFITPEWNGLIRDLLDNKTDMIVVALSNNAVRKADIDFSLSMMDGGLGALVKSDGTDLSHPLELLNQQWGVVDSRNPELLLASNQNADYNRIAEDGSYGEGLERMRAGGF-VFIDEIPGINYATKGE---------DIVQIGETFQPFELAFGLRKNSP-FKNLVDTFMLGIREQGVISELYAKYENQK.... 255
72 -34.0001pb8_A mol:protein length:292 N-methyl-D-aspartate Receptor Subunit 1  ali model follow..  16  3........................STRLKIVT----EPFVYVKPPQCCYGFCIDLLIKLARTMNFTYEVNKKEWNGMMGELLSGQADMIVAPLTINTERAQYIEFSKPFKYQGLTILVKKGTRITGINDPLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRSAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCD--------LVTTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTWVRYQ.... 288
73 -33.3005jkq_A mol:protein length:284 PfVFT1  ali model follow..  13  73......................IKKKEVKIGALKNKNWGIIGNEQNPPVGFWPDVMYIIWETISKHINIAYNYYDNVFVALNDKDIHMTDNYFLSSGNNLPKLTSGLPIIKHSNKIMILKEYN-INNLEDLKGLKIACLTEANCNALKNIFLDKVTYDYKSFSSYIDLSKSVLSKSHIIGVISGIPFNF....................................................................... 260
74 -32.2004wxj_A mol:protein length:269 Glutamate receptor IIB,Glutamate receptor IIB  ali model follow..  15  1.................GSDFSQKPIRYTVATRVG-KPYFSWRENERFEGYAVDLIYMLAQECKFDFNFEPVRWDGIIRQLIDNNAQIGICDLTITQARRSVVDFTVPFMQLGISILSYKGTDIGSLHDLVDQNKV-IRGGATSVYFSESNDTSFKPDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQRN---------ELTQIGESFGEKHYGIAVPLN-ADFRSNLSVGILRLSERGELFKLRNKWFNSN.... 264
75 -32.0005h8f_B mol:protein length:293 Glutamate receptor ionotropic, NMDA 1  ali model follow..  16  1.....................GSMSTRLKIVT----EPFVYVKPPQCCYGFCIDLLIKLARTMNFTYEVNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRSAAEAIQAVRDNKLHAFIWDSAVLEFEASQK--------CDLVTTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTWVRYQ.... 289

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.