current user: public

If you have questions about the server, please let us know.

Query: [L] COG1039 Ribonuclease HIII, from VFDB

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst MNIVLKLETKERQQLAEKYKSYEQVSKNPYITFFAKVGKTSISVYTSGKVVFQGNEAEKLASDFGHIAQVVPQKQTNLIGTDEVGNGSYFGGLMVTASFVSEENLNFLKEIGVADSKKLTDEKICQIAPKLIDRIPHVALVVEPAKYNEVIASGYNAVSIKVALHNQAIYLLEKQLGHKPENIVIDAFTTEANYKKYVNKEQNHPLTKVTLLTKAEDQFLAVAVSSIISRYLFLENLKKLSKESGFTLPSGAGNLSDKIAAQIIKSQGVDALNQLAKLHFANTQKAIKIAQLLast
1 -99.6002d0a_A mol:protein length:310 ribonuclease HIII  ali model follow..  36  3.NYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFQGKAAEQEAAKWPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAK. 307
2 -82.7003vn5_A mol:protein length:257 Ribonuclease HIII  ali model follow..  22  2..PSLKISPSEAEKIQNYLVSSFRKINAPYTLWALEGNGVKVYYYKTGSLLIQGKNSEKVLKEV-----LNLLEKKKLPGCDESGKGDIFGSLVLCCVCIPEENYLKVSSLNPRDTKRLSDKRVERLYLALKPLVKAYCYEIKPEEYNKLYRKFRNLNKMMTHFYKLLIERVKEEC--GVSEVVVDKYQPSNPFGEDV------------IFETEAERNLAVAVASIFARYKFLQSLKEVERELGIKIPKGTSKEVKELAKSLKN------PERFIKLNFNV.......... 257
3 -75.9004py5_A mol:protein length:271 Ribonuclease  ali model follow..  28  1...SMKLSSSEKEKLLKKLKALKEEKPPEHAQYRLRLNDAILTVYKSGSVVYGGKGREKLKELV--AETVLSDTELPRIGCNEAGKGEFVGPLVVACIVADEKCLKRLIELGVKDSKKLSNEKVEELASEITETCHGKVKLLIPEKYNRAYSKFKNINRLLEAVYREIVSDLCEKF--SPKVVVVDKFSNRAEEV----LKDVVKGARLEVRPKAED-DLAVAAASIVAKAVRLKTMKELEKRFKVKLPEGNT-----GLAELLKKTPKELHEKLFKLHFSVGGK....... 270
4 -72.3001eke_A mol:protein length:230 RIBONUCLEASE HII  ali model follow..  23  3.............................................................................IIGIDEAGRGPVLGPMVVCAFAIEKEREEELKKLGVKDSKELTKNKRAYLKKLLENLGYVEKRILEAEEINQLMNS-INLNDIEINAFSKVAKNLIEKLNDDEIEIYIDACSTNTKKFEDSFKDKRNLNIKIIAEHKADAKYPVVSAASIIAKAERDEIIDYYKKIYG---DIGSGYPSDPKTIKFLEDYKHKKLPDIARTHWKTCKRILDKSK. 223
5 -70.0002dfe_A mol:protein length:209 Ribonuclease HII  ali model follow..  24  3.............................................................................IAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDYVILELPPDVIGS---REGTLNEFEVENFAKALNSL----KVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYG---EIGSGYPSDPRTRAFLENY-HGEFPPIVRKGWKTTQDMINKST. 209
6 -69.6001x1p_A mol:protein length:212 Ribonuclease HII  ali model follow..  22  3.............................................................................IAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDYVILELPPDVIGS---REGTLNEFEVENFAKALNSL----KVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYG---EIGSGYPSDPRTRAFLENYEHGEFPPIVRKGAGAIIGLAVGGVV 210
7 -69.2001uax_A mol:protein length:220 Ribonuclease HII  ali model follow..  23  3.............................................................................VAGVDEAGRGPVIGPLVIGVAVIDEKNIERLRDIGVKDSKQLTPGQREKLFSKLIDILDYYVLLVTPKEIDERHH---SMNELEAEKFVVALNSL----RIKPQKIYVDSADVDPKRFASLIKAGLKYEATVIAEHKADAKYEIVSAASIIAKVTRDREIEKLKQKYG---EFGSGYPSDPRTKEWLEEYQYGDFPPIVRRTWETARKIEERFR. 209
8 -69.1002dff_A mol:protein length:213 Ribonuclease HII  ali model follow..  23  3.............................................................................IAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDYVILELPPDVIGS---REGTLNEFEVENFAKALNSL----KVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYG---EIGSGYPSDPRTRAFLENYEHGEFPPIVRKGWKTLKKITQDMI. 209
9 -67.3002dfh_A mol:protein length:221 Ribonuclease HII  ali model follow..  23  3.............................................................................IAGIDEAGRGPVIGPMVIAAVVVDENSLPKLEELKVRDSKKLTPKRREKLFNEILGVLDYVILELPPDVIGS---REGTLNEFEVENFAKALNSL----KVKPDVIYADAADVDEERFARELGERLNFEAEVVAKHKADDIFPVVSAASILAKVTRDRAVEKLKEEYG---EIGSGYPSDPRTRAFLENY-HGEFPPIVRKGWKTLKKIAEKVE. 209
10 -66.8001i39_A mol:protein length:225 RIBONUCLEASE HII  ali model follow..  22  1..............................................................MGSSSSGLVPRGSHMKAGIDEAGKGCVIGPLVVAGVACSDE--DRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAA-KTINEILKECYAEIILRL------KPEIAYVDSPDVIPERLSRELEEI--TGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFG---DFGSGYASDPRTREVLKEWASGRIPSCVRMRWKTVSNLRQKT.. 215
11 -64.3003p83_D mol:protein length:217 Ribonuclease HII  ali model follow..  22  9........................................................................PGRLMKAGIDEAGKGCVIGPLVVAGVACSDE--DRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAA-KTINEILKECYAEIILRL------KPEIAYVDSPDVIPERLSRELEE--ITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFG---DFGSGYASDPRTREVLKEWASGRIPSCVRMRWKTVSNLRQKT.. 213
12 -61.4003puf_A mol:protein length:302 Ribonuclease H2 subunit A  ali model follow..  18  6..................................................LSELERDNTGRCRLSSPVPAVCRKEPCVLGVDEAGRGPVLGPMVYAICYCPLPRLADLEALKVADSKTLLESERERLFAKMEDTVGWALDVLSPNLISTLGRVKYNLNSLSHDTATGLIQYALDQ-GVNVTQVFVDTVGMPETYQARLQQS--FPGIEVTVKAKADALYPVVSAASICAKVARDQAVKKWQFVEDLDTDYGSGYPNDPKTKAWLKEHPVFGFPQFVRFSWRTAQTILEKEAE 253
13 -61.2003kio_A mol:protein length:301 Ribonuclease H2 subunit A  ali model follow..  17  3..................................................LSELERDNTGRCRLSSPVPAVCLKEPCVLGVDEAGRGPVLGPMVYAICYCPLSRLADLEALKVADSKTLTENERERLFAKMEEDVGWALDVLSPNLISTLGRVKYNLNSLSHDTAAGLIQYALD-QNVNVTQVFVDTVGMPETYQARLQQH--FPGIEVTVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVEDLDSDYGSGYPNDPKTKAWLRKHPVFGFPQFVRFSWSTAQAILEKEAE 251
14 -52.9005y9p_A mol:protein length:266 Ribonuclease HII  ali model follow..  17  1....MGSMTLTIKEVTQLINAVNTIEELENHECFLDERKGVQNAIARKALEKEQALKEKYVEMTYFENEILKEPNAIICGIDEVGRGPLAGPVVACATILNSN----HNYLGLDDSKKVPVTKRLELNEALKNEVAFAYGIATAEEIDEF-----NIYKATQIAMQRAIDGL----SVQPTHLLIDAMTLD-------------NALPQVSLIKGDARSVSIAAASIMAKVFRDDYMTQLYPEYGFEKNAGYGT---KQHLLAIDDIGIMKEH---RKSFEPIKSLLLE... 260
15 -51.7002etj_A mol:protein length:250 Ribonuclease HII  ali model follow..  18  3............................................................SDKIMGIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKE--------GINDSKQLSPAKRERLLDEIMEKAAVGIGIASPEEIDLY-----NIFNATKLAMNRALENL----SVKPSFVLVDGKGIE-------------LSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFYPQFSFHKHKGYAT---KEHLNEIRKNGVLPIH---RLSFEPVLELLTDDLL 203

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.