current user: public

If you have questions about the server, please let us know.

Query: [S] COG4121 Uncharacterized conserved protein, from VFDB

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MFIMSSISHAQLGWNDAGTPVSDQFDDVYFSNVNGLAETRYVFLEQNHLPQRWHNDDQRRFVIAETGFGTGLNFLAVWQAFVAFREANPDAKLKELHFISFEKYPLSKSDLIQAHQAWPELAQFAQKLHKHYPLAIPECQRIVLNDGLVTLDLWFGDIKDCLPKVATQEQGLVDAWFLDGFAPSKNPEMWNQNLFAGMAKLAKHGCTCATFTSAGFVRRGLIDAGFAMKKVKGFGTKREMIAGSLSEKVPYTNIAPEFRFEATHGLQEVAIIGGGIASATLATTLALast
1 -105.0002qy6_A mol:protein length:257 UPF0209 protein yfcK  ali model follow..  58  3.LKHYSIQPANLEFNAEGTPVSRDFDDVYFSNDNGLEETRYVFLGGNQLEARFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFREAHPQAQLQRLHFISFEKFPLTRADLALAHQHWPELAPWAEQLQAQWPMPLPGCHRLLLDEGRVTLDLWFGDINELISQLDDSLNQKVDAWFLDGFAPAKNPDMWTQNLFNAMARLARPGGTLATFTSAGFVRRGLQEAGFTMQKRKGFGRKREMLCGVMEQTEG.................................... 251
2 -95.6003pvc_A mol:protein length:689 tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein mnmC  ali model follow..  52  1.MNQRPIQTATLSWNEQGTPVSEQFGDIYFSNEDGLEETHHVFLKGNGFPARFASHPQQSCIFAETGFGTGLNFLTLWRDFALFRQQSPNATLRRLHYISFEKYPLHVADLASAHARWPELASFAEQLRAQWPLPLAGCHRILLADGAITLDLWFGDVNTLLPTLDDSLNNQVDAWFLDGFAPAKNPDMWNEQLFNAMARMTRPGGTFSTFTAAGFVRRGLQQAGFNVTKVKGFGQKREMLTGTLPQQIHAPTAPW-YHRPAATRCDDIAIIGGGIVSALTALALQ 284
3 -95.2003ps9_A mol:protein length:676 tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein mnmC  ali model follow..  57  9.MKHYSIQPANLEFNAEGTPVSRDFDDVYFSNDNGLEETRYVFLGGNQLEVRFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFREAHPQAQLQRLHFISFEKFPLTRADLALAHQHWPELAPWAEQLQAQWPMPLPGCHRLLLDAGRVTLDLWFGDINELTSQLDDSLNQKVDAWFLDGFAPAKNPDMWTQNLFNAMARLARPGGTLATFTSAGFVRRGLQDAGFTMQKRKGFGRKREMLCGVMEQTLPLPCSAP-WFNRTGSSKREAAIIGGGIASALLSLALL 292
4 -95.1003awi_A mol:protein length:688 tRNA 5-methylaminomethyl-2-thiouridine biosynthesis bifunctional protein mnmC  ali model follow..  57  15.MKHYSIQPANLEFNAEGTPVSRDFDDVYFSNDNGLEETRYVFLGGNQLEVRFPEHPHPLFVVAESGFGTGLNFLTLWQAFDQFREAHPQAQLQRLHFISFEKFPLTRADLALAHQHWPELAPWAEQLQAQWPMPLPGCHRLLLDEGRVTLDLWFGDINELTSQLDDSLNQKVDAWFLDGFAPAKNPDMWTQNLFNAMARLARPGGTLATFTSAGFVRRGLQDAGFTMQKRKGFGRKREMLCGVMEQTLPLPCSAP-WFNRTGSSKREAAIIGGGIASALLSLALL 298
5 -75.4003vyw_A mol:protein length:308 MNMC2  ali model follow..  19  37FAYNPEESGQEITADGSKTLIHKTYGEPYHSTAGAIRESLYKFVRPSRILEKAK--ERKVIRILDVGFGLGYNLAVALKHLWEVNPK------LRVEIISFEKELLKEFPIL-----PEPYREIHEFLLERVP---------EYEGERLSLKVLLGDARKRIKEVE---NFKADAVFHDAFSPYKNPELWTLDFLSLIKERIDEKGYWVSYSSSLSVRKSLLTLGFKVGSSREIGRKRKGTVASLKAPVPPMEENEVMRDEKLDKEPLEILIDYLLKVYKISR... 308
6 -14.9003orh_A mol:protein length:236 Guanidinoacetate N-methyltransferase  ali model follow..  13  15.NCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAA------------SSKGGRVLEVGFGMAIAASKVQEAPID-------------EHWIIECNDGVFQRLRD-----------------------------WAPRQTHKVIPLKGLWEDVAPTL---PDGHFDGILYDTYPLSEETTHQFNFIKNHAFRLLKPGGVLTYCNLTSTQVPALLEAGFRRENIR...................................................... 208
7 -14.0001xcj_A mol:protein length:235 Guanidinoacetate N-methyltransferase  ali model follow..  13  14.DCGPAWRAAPAAYDTSDTHLQILGKPVMERWETPYMHSL-------------AAAASRGGRVLEVGFGMAIAASRVQQAPIK-------------EHWIIECNDGVFQRLQN-----------------------------WALKQPHKVVPLKGLWEEVAPTLP---DGHFDGILYDTYPLSEETW--FNFIKTHAFRLLKPGGILTYCNLEETQVPALLEAGFQRENI....................................................... 206
8 -13.1002a14_A mol:protein length:263 indolethylamine N-methyltransferase  ali model follow..  10  1......MKGGFTGGDEYQKHFLPRLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQ-------------DITLSDFTDRNREELEKWLKKEPGAYDWTPKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLG-NPLAPAVLPLADCVLMECACCSLDA----RAALCNLASLLKPGGHLVTTVTLREVEQAVLDAGFDIEQLLHSPQSYSCIVARKKPGP..................................... 263
9 -12.4005yjf_A mol:protein length:284 Nicotinamide N-methyltransferase  ali model follow..  10  35........................LEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFK-------------EIVVTDYSDQNLQELEKWLKAAPAAFDWSPTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQS-QPLGAVPLPPADCVLLDAACPDLPT----CRALRNLGSLLKPGGFLSLPLGREAVEAAVKEAGYTIEWFE...................................................... 250
10 -12.2005xvq_A mol:protein length:284 Nicotinamide N-methyltransferase (NNMT)  ali model follow..  10  9VPRGSHMESGFTSKDTYLRHFNPRLEKYYKFGSRHSAESQILKHLLENLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFK-------------EIIVTDYSDQNLQELEKWLKKEPEAFDWSPTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQS-QPLGAVPLPLADCLCLDAACPDLPT----RRALRNLGSLLKPGGFLVIPLGREAVEAAVKEAGYTIEWFEVISQSYSSLVGRKLSRS..................................... 277
11 -12.1005xvk_A mol:protein length:284 Nicotinamide N-methyltransferase  ali model follow..  11  35........................LEKYYSFGSRHCAENEILRHLLKNLFKIFCLGAVKGELLIDIGSGPTIYQLLSACESFT-------------EIIVSDYTDQNLWELQKWLKKEPGAFDWSPVVLEGNRMKGPEKEEKLRRAIKQVLKCDVTQSQPLGGVSLPPADCLLSTLCLDAACPDLPA----RTALRNLGSLLKPGGFLSLPLGWETVRDAVEEAGYTIEQFEVISQNYSSLVGRKPGRSE.................................... 278
12 -11.2001yz3_A mol:protein length:289 Phenylethanolamine N-methyltransferase  ali model follow..  12  1MSGADRSPNAGAAPDSAPGQAAVALRNNYAPPRGDLCNPNGVG---RCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFE-------------DITMTDFLEVNRQELGRWLQEEPGASMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVLEAVSPDLAS----QRALDHITTLLRPGGHLLLPVSEEEVREALVRSGYKVRDLR...................................................... 254
13 -9.6204rwz_A mol:protein length:223 Putative rRNA methyltransferase  ali model follow..  10  27.............................................................VLIDVGTGDGRFVYRS------------AGAHPDTYCIGVD---PAGERMREVSWR---------------------ASRKPARGGRPNALFVVASVQA----LPEELAGLAHTLTLNFPWASLLSAL-EAPVLEALRRLVRPGGELIALLLDDALRPAYRAAGFEIRTSEIVDGEVPHQTSWGQHLTLASGRRTRLLTAEAIGGSASAAPG............. 223
14 -9.6206aw4_A mol:protein length:228 Catechol O-methyltransferase  ali model follow..  12  61.............................................................LVLELGAYCGYSAVRMARLLSPGA-----------RLLTMEKNPDYAAITQQM---------------------------LNFAGLQDKVTILIGASQDLIPQLKKYDVDTLDLVFLDHWKDRYLPDT-----LLEECGLLRKGTVLLAVPGTPDFLAYVRGSGLEKAVYKGPSSPKQPL............................................. 221
15 -9.4504tlx_A mol:protein length:443 KtzI  ali model follow..  13  18.....................................................HAGESPTHDVVGVGFGANLSLAVALE-----------ESPAALTSAFFERRASISWHQGMLLPAAKMQVSFLKDLATF-PASRFSFVSFLHERGRLVRFANNHDFFPTRREFHD---------YLEWAESKLAHEVSYDSEVTAIRPGPGRPVDSVLVDVSTPEATRTVEA--NIVISTGLVPRMPAGVQSDEFVWHSSRFLDHFRDRDPRSLRRVAVAGGGQSAAEIVRFLH 231
16 -9.3102r6z_A mol:protein length:258 UPF0341 protein in rsp 3` region  ali model follow..  14  82.........................................................TAHPTVWDATAGLGRDSFVLASLGLT--------------VTAFEQHPAVACLLSDGIRRALLNPETQDTAAR--------------------INLHFGNAAEQMPALV-KTQGKPDIVYLDPMYPERRKSAAVKKEMAYFHRLVGEAQD-----EVVLLHTARQTA------------KKRVVVKRPRLGEHLAGQAPAYQYTGKSTRFDVYLPYGADKGL....... 251
17 -9.2802oyr_A mol:protein length:258 UPF0341 protein yhiQ  ali model follow..  11  74............................................RGEAVAKAVGIKGDYLPDVVDATAGLGRDAFVLASVGCR--------------VRMLERNPVVAALLDDGLARGYADAEIGGWLQER-------------------LQLIHASSLTALTDI----TPRPQVVYLDPMFPHKQKSALVKKEMRVFQSLVGPDLD-----ADGLLEPARLLATKRV.......................................................... 215
18 -9.0602vdu_E mol:protein length:254 TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE  ali model follow..  14  55........................................................MTKKVTIADIGCGFG-GLMIDL-----------SPAFPEDLILGMEIRVQVTNYVEDRIIALRNNTASKHGFQN--------------------INVLRGNAMKFLPNFFEKGQSKMFFCFPDPHFKQRKHKIITNTLLSEYAYVLKEGGVVYTITDVKDLHEWMVKH.............................................................. 193
19 -9.0102gpy_A mol:protein length:233 O-methyltransferase  ali model follow..  16  57.............................................................RILEIGTAIGYSAIRMAQALPE-------------TIVSIERDERRYEEAHKHVKALGLES---------------------------RIELLFGDALQLGEKL--ELYPLFDVLFIDAAKGQ-------RRFFDMYSPMVRPGGLI--------LSDNVLFRGLVAETDIEHKRHKQLATKIDTYNQWLLEHPQY--------DTRIFPVGDGIA......... 209

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.