current user: public

If you have questions about the server, please let us know.

Query: [R] COG4588 Accessory colonization factor AcfC, contains ABC-type periplasmic domain, from VFDB

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWRELast
1 -98.3003fir_A mol:protein length:251 Major antigenic peptide PEB3  ali model follow..  99  1MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGESNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWR. 249
2 -95.4002hxw_A mol:protein length:237 Major antigenic peptide PEB3  ali model follow..  100  2....................DVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWRE 231
3 -81.2004jb7_A mol:protein length:256 Accessory colonization factor AcfC  ali model follow..  50  2...SSGVDLGTENLYFQSNADVNLYGPGGPHVPLIKVAESFEKSQSKRVNITFGPQATWNDKAKKNADILFGASEHSALAIAEGHSERFSKFNIHPVFMREAIILVKKGNPKNIKGMADLLKPGIGIVVNDGAGVSNTSGTAVWEDSVGRMKNVEKLQAFRSNIHVFAPNSGSARAFVDGEDIDAWITWVDWAIANPTIGDMVRMEDEYRIYRDFNVVLAKNPSSEAIDFFDYLKSKDAEAIFQHYGWFK 250
4 -64.9004kd5_C mol:protein length:233 ABC-type transport system, molybdenum-specific extracellular solute-binding protein  ali model follow..  16  1..............SNADSVELNISAAASLKEAMAKIEEEYKKVSNVKLTVNYGASGSLQQQIEQGAPDLFISAGQKQMKVLDEEK-LLVSDTMKDLVKNDLVLISSADSS--VSGMKDLTTDKVKKI---AVGEAESVPAGKYADEVLT--NLNLKDKLKDKLV-FAKDVKEVLAWVQSGNADVGFVYFSDTVNNDKIKVVEKTDEHSPITYPVSVIKASKNVDAAKKFEEFLLSESGQKIFEEFGYK. 230
5 -64.4003axf_A mol:protein length:237 Molybdate-binding periplasmic protein  ali model follow..  16  2..............SHMDEGKITVFAACSLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPDLFISADQKWMDYAVDKK-AIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTN-SLLNGGRLAVGDPEHVPAGIYAKEALQ--KLGAWDTLSPKLA-PAEDVCGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEHKKVEYPVAVVEGHNNAT-VKAFYDYLKGPQAAEIFKRYGFT. 235
6 -62.4002h5y_A mol:protein length:254 Molybdate-binding periplasmic protein  ali model follow..  14  1...MGSSSSGLVPRGSHQTAPVTVFAAASLKESMDEAATAYEKATGTPVRVSYAASSALARQIEQGAPDVFLSADLEWMDYLQQHG-LVLPAQRHNLLGNTLVLVAPASSKLRVDPRAPGAIAKAL-NGRLAVGQTASVPAGKYAAAALR--KLGQWDSVSNRLA-ESESVRAALMLVSRGEAPLGIVYGSDARADAKVRVVATFPDHDAIVYPVAALKNSNNPA-TAAFVSWLGSKPAKAIFARRGFS. 245
7 -62.3004xxu_A mol:protein length:257 Molybdate-binding periplasmic protein  ali model follow..  16  1MARGAALSFAVAGNALADEGKITVFAAASLTNAMQDIATQFKKEKGVDVVSSFASSSTLARQIEAGAPDLFISADQKWMDYAVDKK-AIDTATRQTLLGNSLVVVAPKASVQKDFTIDSKTN-SLLNGGRLAVGDPEHVPAGIYAKEALQ--KLGAWDTLSPKLA-PAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEHKKVEYPVAVVEGHNNAT-VKAFYDYLKGPQAAEIFKRYGFT. 255
8 -61.8004rxl_A mol:protein length:234 Molybdenum ABC transporter, periplasmic molybdenum-binding protein  ali model follow..  13  1................SMKETLHIYAASSMTNAVNALVADYSQQHDVKLVTVYGGSSSLARQIEAGAPDLFISANEEWANYLVEKG-LVKPNKVVTLAANSLVLIRPTAQPVASFELQDAAAWQTALADRLAVAQVDAVPAGMYAKQALQ--HAGVWPELESRLA-QTNNVRLALALVERGESPLGIVYKTDALLSDKVTIVTAFSAHQPIRYPLAQL---NDKAASAEWVAYLRSDAAQQILQRFGFE. 230
9 -57.0001atg_A mol:protein length:231 PERIPLASMIC MOLYBDATE-BINDING PROTEIN  ali model follow..  12  1....................ELKVVTATNFLGTLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVNGAPNVFFSADEKSPEKLDNQG-FALPGSRFTYAIGKLVLWSAKPGLVD-NQGKVLAGNGWRHI---AISNPQIAPYGLAGTQVLTHLGLLDKLTAQERIV-EANSVGQAHSQTASGAADLGFVALAQIIQAAAKIPFPPANYYEPIVQQAVITKSTAEKANAEQFMSWMKGPKAVAIIKAAGYV. 228
10 -55.6006DDN Entity 1(prereleased)  ali follow..  14  39............AGPDRAHTSITLVAYAVPEPGWSAVIPAFNASRGVQVITSYGASADQSRGVADGKPDLVNFSVEPDIARLVKAGKV-ADATKGIPFGSVVTFVVRAGNPKNIRDWDDLLRPGIEVI----TPSPLSSGSAKWNLLAPYAAKS-VNTLVNEHVKLRPGSGREATDVFVQGSGDVLISYENEAIATERAVQHVTPPQTFKIENPLAVVATSTHLGAATAFRNFQYTVQAQKLWAQAGFR. 293
11 -54.5003muq_A mol:protein length:237 uncharacterized conserved protein  ali model follow..  15  1...............SNAAEHVRLATTTSTYHSLDYLLPQFEKDTGYKVDVIAAGTGKALKMGENGDVDLVMTHAPKAEGTFVEKGYGV---LPRKLMYNDFVIVGPKADPAKIKDDESVLDVFKEIANKNATFISRGDDSGTHKKEMGFWAQTKIEPNFGGYRS-VGQGMGPTLNMASEMQGYTMSDRGTWLAYQNKLDLEILFQGDEKLFNPYQVIYPTINYQGAKAFSDWLVNPRGQELINGFR... 236
12 -54.2005um2_A mol:protein length:334 ABC transporter sulfate binding protein  ali model follow..  14  1...MGSSSSGLVPRGSHREIGLLNVSYDPTREFYRDYNAAFAAQDTVTVETSHGGSGKQARAVIDGIEDVVTLALAYDVDAIAQKAKLIETDDNSAPYTSTIVFLVRKGNPKNIHDWPDLLRSGVAVV----TPNPKTSGGARWNYLAAWAYADRYMQALFRNVVLDTGARGATTTFVQRGIGDVLLAWENEALLAREELGKDKFEAEPSVALVDKNVDKHGTREVAEAYLRYLYAPEGQKLAAKHFYR. 277
13 -52.8003cg1_A mol:protein length:296 UPF0100 protein PF0080  ali model follow..  14  1...............GHMEVTLIVFHAGSLSVPFQEVEKEFSEYAKVSFQDEASGSVMAVRKVTDLGRDVIGVADYTLIPQLLIPNYT---DFYVLFATNEIVIAFTDKSRNPDKWYEILAREDVRF----GFSDPNQDPCGYRSLMVIKLADLIFKELIEENTIVIRPKETDLLGLVESGSIDYIFIYKSVAKQHNLSYITLPSEKAKPIVYGVTVLKDAPNREVAIEFLRYLLSENGKRIFEKNHQD. 294
14 -52.8003lr1_A mol:protein length:236 Tungstate ABC transporter, periplasmic tungstate-binding protein  ali model follow..  12  1...............SNAEERLKMSTTTSTQDSLKVLLPPFEKKNNVKVDVIAVGTGQALKLGEAGDVDVVFVHARKLEDKFVADGFG---VNRKDVMYNDFVIVGPKNDPAGIAKAKTAAEALKLLATKGATFISRGDKSGTHTKELDLWKSAGVDPKGNWYVEA-GQGMGPVITMATERRAYTLTDRGTYNAFKGAKTDLFQGEKGLFNPYGIMAVNPKKKYDLAMKLIDYVTGPEGLKIISDY.... 236
15 -52.2003cfx_A mol:protein length:296 UPF0100 protein MA_0280  ali model follow..  10  1...............GHMGEVLTVFHAGSLSVPFEELEAEFEAQPGVDVQREAAGSAQSVRKITELGKDVLASADYALIPSLMVPEYA---DWYAAFARNQMILAYTNESKYGDEINTDLRRPDVRY----GFSNPNDDPAGYRSQMVTQLAESMIYDDLMLANIMLRSMEVELSSALETGEIDYLYIYRSVAEQHGFEYVALPPATGSPIVYGVTIPNNAENSELATEFVALLLGETGQQIFIENGQ.. 293
16 -51.2001sbp_A mol:protein length:310 SULFATE-BINDING PROTEIN  ali model follow..  15  1.................KDIQLLNVSYDPTRELYEQYNKAFSAHDNVVIDQSHGGSGKQATSVINGIEDTVTLALAYDVNAIAERGRI-RLPDDSAPYTSTIVFLVRKGNPKQIHDWNDLIKPGVSVI----TPNPKSSGGARWNYLAAWGYALDFVKALFKNVVLDSGARGSTNTFVERGIGDVLIAWENEALLATNELGKDKFEAEPTVSVVDKVVEKKDTKAVAEAYLKYLYSPEGQEIAAKNFYR. 261
17 -50.6002onk_E mol:protein length:314 Molybdate/tungstate binding protein  ali model follow..  11  1...............GHMNVKLKVFHAGSLTEPMKAFKRAFEEKPNVEVQTEAAGSAATIRKVTELGRDVIATADYTLIQKMMYPEFA---NWTIMFAKNQIVLAYRNDSRYADE-YEILKRPDVRF----GFSNPNDDPCGYRSLMAIQLAELSERIEINKSKIMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELPVETGKPIVYGITIPKNAENRELAVEFVKLVISEEGQEILRELGQE. 293
18 -50.4003k6u_A mol:protein length:354 Solute-binding protein MA_0280  ali model follow..  11  1MKPMSDYDIPTTETSAGEGEVLTVFHAGSLSVPFEELEAEFEAQPGVDVQREAAGSAQSVRKITELGKDVLASADYALIPSLMVPEYA---DWYAAFARNQMILAYTNESKYGDEINTDLRRPDVRY----GFSNPNDDPAGYRSQMVTQLAESEEISPNTSKIM-LRSMEVELSSALETGEIDYLYIYRSVAEQHGFEYVALPPATGSPIVYGVTIPNNAENSELATEFVALLLGETGQQIFIENGQP. 326
19 -50.4003cg3_A mol:protein length:320 UPF0100 protein PH0151  ali model follow..  11  1...........GHMSESREARLIIFHAGSLSIPLSQVEEKFTKYVKVTFQDEASGSVKAVRKVTDLKKDIVAVADYTLIPQLMIPNYT---DFYVLFATNEIVIAFTNKSKYADE-YEILSRPDVSF----GFSDPNQDPCGYRSVMVMKLAELYYGRPIFKELVIMRPKETDLVGLVESGSLDYIFIYKSVAKQHHLSYITLPDDKAKPIVYGITVLKNAPNRELAIEFLRFLLGNEGRKIFEDNYQE. 298
20 -49.1003cfz_A mol:protein length:292 UPF0100 protein MJ1186  ali model follow..  10  1...............GHMKIVLKIFHAGSLSVPFEEYEKMFEKEPNVDVEREPAGSVACVRKIIDLGKDILASADYSLIPQMMMPKYA---DWYVMFARNEIVLAYTDKSKNSTNWYKILQRPDVKI----GFSNPNDDPCGYRTQMVLQLAEL---LDVDTNKLFVRSKETDLLAPLEAGAFDYLFIYKSVANQHHLKYIELPKENAKPIVYGMTVPTNAPHKKEAIEFVKFVLG--HPEVLENNGQP. 290
21 -45.4003kn3_A mol:protein length:242 PUTATIVE PERIPLASMIC PROTEIN  ali model follow..  13  1...............SNAAAELRMATTTSTDNTLDVLAPAYKKDTGVDLKWVAVGTGNALKLGENCDDVVFVHAPKVELEYVEKGFGI----DRTPVMYNDFVIIGNPSFKQKFTGFKLIEKEQVKFVSRGDKSGTHSKEREVWKEALGKIPEKE--SWYIEAGQGMLATINIAEEQKGLTLTDRGTFIKYESNHKGKPPMVIVLEGDNTLKNFYSIMCEKADYKGAKQFIDWIVSEKMQAEIANFK... 241
22 -44.7005my5_A mol:protein length:274 ABC transporter periplasmic substrate-binding protein  ali model follow..  10  1MAVDDDDKMLEVLFQGPEAPVLMMATTTSTDNTLDDLAPQFTKDTGIELRWTAVGTGKALKMGENCDVDILLVHAPAAEKAFVDAGFGT---ARTQLMYNDFVIIGPAADPAGVKGLGKIAADNAVFVSRGDNSGTHKMEKSLWKQIEGPSPEKE--AWYVQTGQGMLRTINVAAEKGGYTMTDRGTYIKYEASMDGNPPLKILVEGDKILFNQYSAICPKVKKDLADKFVNWMASPATQKTIGDFKLM. 258
23 -33.3004elo_A mol:protein length:336 Iron ABC transporter, periplasmic iron-binding protein  ali model follow..  17  1MMKLLTLAAFAALGALAQSPTLTIYSGRG-QSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQEEGSDLFWANTAGALGQASAKGLLRPLGETLPVTVRLRVLAY---NPDRIESLLDLPRFAREKGLVGRVGWTPTYSVAGMIALYGEEKTREWLLAMKALAPKAYPSNPAMLDAIRAGEVDLGSTNHYYVVRFRRAGYRLGMAGNLALVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGE. 284
24 -31.0002qry_A mol:protein length:330 Thiamine-binding periplasmic protein  ali model follow..  11  1...MGSSSSGLVPRGSHMKPVLTVYTYDSFAGPGPVVKKAFEADCNCELKVALEDGVSLLNRLRMEGKDVVLGLDNNLLDAASKTGLFAKSGVAAPFDYGYFAFVYDKNKKNPPQSLKELVESDQNVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM. 278
25 -30.3005t1p_A mol:protein length:348 ABC transporter, periplasmic substrate-binding protein  ali model follow..  12  1MSKKFFLSLGLVAKAAQAEGRVNSLAMPDTWANWKDTWADLKNLYDIEHSDTDMSSAQEIAKFKTEGDIGDVGASFGEIAVKQGVAQPFKTSYWDQIYTGTIAFIVNKDVVKDIKTWQDLLKGNYKITVGDVSVAAQAVSA-LGGDEKDLSPALAFFNTLAKQGRLVNND--VSIANLEKGEVEVGLVWDFNGLGYRDKVGLIPADGSVISGYTTIINKYAKHPNAAKLAREFILSDKGQINLAKGYAR. 293
26 -30.0004r6y_A mol:protein length:318 Putative 2-aminoethylphosphonate-binding periplasmic protein  ali model follow..  15  1................SMESVVTVYSIDGLNSWYQVQFDAFTKATGITVRYVEGGGGVVVERLAKEADVLVTAPPFIQRAAAEKLLANFNTDTASAIVKNYLSFIYNSKLLKTAASWQDLLDGKLQYSTPGQAADGTAVMLQAFHSFGSKDAGFAYLGKLQANNVGPSASTGKLTALVNKGEIYVANGDLQMNLAQMERNPNVKIRSALAIPYVIGLVQGAPQSENGKKLINFLLSKEAQTRVSELSWG. 266
27 -29.8004r72_A mol:protein length:321 ABC-type Fe3+ transport system, periplasmic component  ali model follow..  13  1................GSKGRLVIYCSAT-NVMCENAAKTFEQKYDVKTSFIRNGSGSTFAKIEAEKNDVWYGGTLDPQSQAGELGLLEAYRSILGFAVNT--RLKKLGIEKIPQCWNDLTDPKLK---EIQIADPQSSGTATFAQLWGEDKAFDYFKHLHPNISQYTKSGITPARNAARGETTVGIGFLHDYALEKELEMVVPCEGTGYELGGVSILKGARNLDNAKLFVDFALSKEGQETAWKKGQA. 269
28 -29.1002pt1_A mol:protein length:334 Iron transport protein  ali model follow..  16  11...........IADTPGEQQEINLYSSRH-YNTDNELYAKFTAETGIKVNLIEGKADELLERIKSEGADVLLTVDLARLWRAEEDGIFQPVQSEIGFTKRARVIMYNKGKPEELSTYEELADPKWKVIIRSSSNEYNQSLVASLVVADGEESTLAWAKGFVSNFAREQGNDTAQIEAVSSGEADLTLANTYYMGRLLESEDPAQKAIAENVGVGVGVVKTAPNREGAVKFIEFLVSEPAQAFLAQNNYE. 288
29 -28.9006g7n_A mol:protein length:318 Extracellular solute-binding protein, family 1  ali model follow..  20  1...................GAINLYSSRH-YDTDQALYDSFTKKTGLKVNLIEGKGDKLIERIKSEGADVFMTVDAGRLWRAQEAGILQPISSSTGFSKRARVIMYNKNQPSELSTYEDLAQNKWKIVIRSSSNIYNQSLIASLIEIHGMSDAEGWAKGFVRNFARPEGNDTAQIKAVAAGIGDIGLANSYYLARLKRSSKPEDQAVADKVGMGGGVVKNAPNKEGAIKFLEYLVSPEAQKIFSEGNNE. 270
30 -28.4001y4t_A mol:protein length:322 putative iron-uptake ABC transport system periplasmic iron-binding protein  ali model follow..  16  1..................ASELNIYSARH-YNADFEIIKKFEEKTGIKVNHTQAKASELIKRLSLEGSDIFITADISNLTEAKNLGLLSPVSSKYAITKRARIIAYNKNTNIDIKNYEDLAKAEFKIVMRSATAPYSKTLLASIIANDGNKEAKAWAKGVLENLATNPGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYE. 272
31 -28.4001d9v_A mol:protein length:309 PROTEIN (iron-utilization periplasmic protein)  ali model follow..  18  1....................DITVYNGQH-KEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDDVFYTEQTATFADLSEAGLLAPISEQTILSGRSRVVVY---DHTKLKSVLDYATPKWKIGYVSTSGAFLEQ-VVALSKMKGDKVALNWLKGLKENGKLYAKN-SVALQAVENGEVPAALINNYYWYNLAKEFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAE. 264
32 -28.3001y9u_A mol:protein length:323 putative iron binding protein  ali model follow..  15  2...............SHMSDEVSLYTTRE-PKLIQPLLDAFAKDSGIKVNTVFVKDGLLERVRAEGDKDVLMTVDIGNLIDLVNGGVTQKIQSQTALSLRDRVLYVEKDLKLDSFRYGDLADPKWKVCIRSGQHPYNTALVAAMIAHDGAEATEKWLRGVKANLARKAAG-RDVARDILGGICDIGLAYVGHMKNAEPGTDARKWGDAIKVVRPAAVAAHAPNKANAVKLLEYLVSEPAQTLYAQANYE. 276
33 -27.5001d9y_A mol:protein length:309 PROTEIN (PERIPLASMIC IRON-BINDING PROTEIN)  ali model follow..  15  1....................DITVYNGQH-KEAAQAVADAFTRATGIKVKLNCAKGDQLAGQIKEEGSDVFYSEQIPALATLSAANLLEPLPASTILSGRSRVVVY---DTRKLKSVLNYATPKWK-IGYVPTSGAFLEQIVAIVKLKGEAAALKWLKGLKEYGKPYAKN-SVALQAVENGEIDAALINNYYWHAFAREKGVQNVHTRLNTYSGAAVLKSSQNKDEAKKFVAFLAGKEGQRALTAVRAE. 264
34 -27.1001xvx_A mol:protein length:312 YfuA  ali model follow..  15  1...............ESNDSGIVVYNAQH-ENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSDVFLTENSPAMVLVDNAKLFAPLDAVTQIAARSTVFVY---NPEKIKSIMDLAKPEWK-WAASPSGADFQAIVSAMLELKGEKATLEWLKAMKTNFTAYKGN-STVMKAVNAGQIDGGVIYHYYRFVDQAKTGENSGKTQLHSISGGGVLASSKHPKEAQEFVKWITGKSGQDILRTNNAFE 268
35 -27.0001xvy_A mol:protein length:309 sfuA  ali model follow..  15  1..................DQGIVIYNAQH-ENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQEGSDVFLTENSPAMVLVDNAKLFAPLDAATLIAARSTVFVY---NPAKLKSLLDLAKPEWK-WAASPSGADFQAIVSALLELKGEKATLAWLKAMKTNFTAYKGN-STVMKAVNAGQVDSGVIYHYYPFVDGAKTGENSNNIKLYSISGGGVLASSKHQQQAQAFIKWITGKQGQEILRTNNAFE 265
36 -26.8001q35_A mol:protein length:320 iron binding protein FbpA  ali model follow..  15  1..................ANEVNVYSYRQ-PYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGELDVLLTVDISRVMEIVNADLAQKIDSKV-LTTRARVIYTSKDRVGK-FDYLDLAKPEYKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKANLARKPGGDRDQVKAIKEGICDYSIGNSYYYGKMLDDEKQKSWAEAAIINFGVVIAKHSPNKANAVKLIEYLSGEKAQGLYAELNHE. 268
37 -26.8003c9h_A mol:protein length:355 ABC transporter, substrate binding protein  ali model follow..  12  1MRICLFLCLCLCMAGKTDAQTLVVYSSLD-EPLATPMIEGFQKAPDIAVHYEDMLTGEIYDRIVKETDDFAFSSAMDLQVKLSNDGYAQRSDLAMSFVYHK--SFTTEKPPATRAEFVDYLERH-EVHGRIATYDIERSGVGMSRDQEQFGDIWSVIKAMGAAGVKVYSTSSAILERVSDGRFVLGYNILGSYAADPDVGIVLPKDYTVVMSRIGLVPEAAANPELGRRYLEFFMSKEGQTIMARQLQ.. 298
38 -26.4002voz_A mol:protein length:346 PERIPLASMIC IRON-BINDING PROTEIN  ali model follow..  16  5ISRRTFFVGGTALRASAQSRTINLYSSRH-YNTDDALYDAFGEVNLIE-----ASAEELIERIQSEGADILFTVDAGMLWRAEQAGLFQPVRSGKGFTQRARVLYYSRDNPADLSTYEALADPQWRILVRPSSNVYNLSLTASRIAIHGEPETRRWLQGLVGNFARQEGNDTAQIRAIAAGIGDVAIANSYYYIRLQKSTDPADQEVVEKVSLGAGVLKNAPNRDAAIAFLEYLASDDAQRYFAEGNNE. 300
39 -25.6004edp_A mol:protein length:351 ABC transporter, substrate-binding protein  ali model follow..  18  4MKKKILATLLTGLEGAEAGKKLVVSTWGLNEDVLKEVFEPFAKEHGVEIVLDIGNNSERLTKMKNNPDITYLAESFAEQGVEAGIFDKLDYSKIPAYTLNSIGIVVDPSAGIEINSWEDLWKPELKIAIPDITTTNGPAMVGVDVKTDNGEAAFKELEALKPNVVKTYSKSSDLANMFSNGEIVAAVASDFAFKAKPEVINVIPESGTYLNFNTININKNSKNKDLAYEFINYALSKEVQEKTAK..... 297
40 -25.5003cvg_A mol:protein length:294 Putative metal binding protein  ali model follow..  12  1MSLDPEDVYDGGYGSKHSPVQLRIGNGGAGQSGLKELADAFIKSKPFKVAWYKSDTTVTINYLKDGIVDVGITYSPVAERISIKHG--ISESPSYYAFRDHFMLIGPPSNPAKLSGDSDIADMFSKMHDAAEAGNTKPPKSATNIKEAELWLSIGQVPWATAYSTWYHQYITFPIQALTAAILLREYTITDYGTYLSIPRGLNDADDPLLNPAHLLVGARAKNAEMAKEFAKWLVSKEGQKVIEGFKK.. 273
41 -22.3001twy_A mol:protein length:290 ABC transporter, periplasmic substrate-binding protein  ali model follow..  16  1MSLIRMALAAVCATPFVQASEITISGSTSVARIMDVLAEKYNQQPETYVAVQGVGSTAGISLLKKGVADIAMTSRYLTESEAQNT-------HTFTLAFDGLAIVVNQANPVQITNWKQVGGNDQKIAVVTREASSGTRYSFESLMGLTKTVKDREVSDVAPTALVVNSN-SMMKTLVNHNTQAVGFISIGSV---DKSVKAIQFEKADPTSDNIALHYSDNADEQTKEFIAFLKSESAKKLIVEYGY.. 273
42 -22.1004n13_A mol:protein length:265 Phosphate ABC transporter, periplasmic phosphate-binding protein  ali model follow..  12  1........GAMGSKNQDNEKIVSIGGSTTVSPILDEMILRYDKINNTKVTYDAQGSSVGINGLFNKIYKIAISSRDLTKEEIEQG-------KETVFAYDALIFITSPEIKIEIQNWKQVGGPDAKINFINR--DSSSGSYSSIKDLLLNKIFKTHEEAQFRQDGIVVKSNGEVIEKTSLTPHSIGYIGLGYAKNSIEKLNILSVNSTYPTKETINVTNNKYEDKSVTQFIDFMTSSTGQDIVEEQGF.. 260
43 -20.8004ecf_A mol:protein length:264 ABC-type phosphate transport system, periplasmic component  ali model follow..  13  1................GAGESITAVGSTALQPLVEAAGEQYTGELGTFINVQGGGTGTGLSQIQEGAVQIGNSDLFAGEQKGINARQLVD----HRVAVVGITPIVNKKVGVQITNWKEVGGADQSIVLINRAQGSGTRATFEQFGLANHRSKTAQEQDSSGMVRSIVATTPGAISYVAFSYVNKTVQALSLNHVAPTEVNVT--TNDWRIWSYEHLYTKGHPTGLTKAFITYVQSPAIQNLVRQLGY.. 242
44 -20.6005l9g_A mol:protein length:351 periplasmic binding protein  ali model follow..  12  1.....MGSSSSGLVPRGSHMDVVIASGGGWQEAQDKLWAPAAKALNITYTQTFQNWAEARAQVESGSDIIQIGIADEPQAKAAGVLEKLDPDIVNKIAWNKKTY--GDNGPKSMADFFDVKKIGMIEAAALALGTPRDKVYEFLSTEEGRKAAIAKLTELAPSVSVWWESGAQAAQLIKDGEVDMIITWGGRVQGAINDGANFAYTFNDAQLGGYAIVKGAPHRDAAMRFLKEMSKAEYQKDLPNS.... 279
45 -19.9004exl_A mol:protein length:265 Phosphate-binding protein pstS 1  ali model follow..  10  3..................GESITAVGSTALQPLVEVAADEFGTIVGKTVNVQGGGSGTGLSQVQSGAVDIGNSDVFAEEKDGIDASALVD----HKVAVAGLALIVNKEVD-----VDNLTTEQLRQIFIGEVTNWKEVG-----SVINRAAGSGSRATFDTVIMQEQDSNGAVKSIVSKSPGAISYLSLTYIDDSVKSMKLNGYDLNWPLWSYEHMYTLGQPNELAAEFLNFVLSDETQEIVKGLKY.. 242
46 -19.9004gd5_A mol:protein length:279 Phosphate ABC transporter, phosphate-binding protein  ali model follow..  14  4MFKKRLIAIIGTISEAKSTNSVSISGSTSVGPVMEAEAEAFTKKPDVSIEINQIGSSAGIKNAMEGVSEIGMASRDLKGEEKQAG-------KEVEIAYDGIALITHKNNP-----VKDLTLVQIKDIYTGKITNWKELG-----VVVSREDGSGTRDAFQEIVSQISDGSGNIKSLVQGNENAIGYISFSYV---DDSVSAVKVDGVEATPENVLVYKEENLTESGKSFIDFILSEEGQDIVAKEHL.. 275
47 -19.9004omb_A mol:protein length:347 Phosphate binding protein  ali model follow..  15  12MKLKRLMAALTFVAASGVSGNLSSVGSDTLANLMTMWAEEYKRYPNVNIQIQAAGSSTAPPALTEGTANLGPMSRKMKDVELQAFEQKYGYKPTAPVAVDALAIFVHKDNP-----IKGLTMQQVDAIFSATRLCGSKQDVKTWGDLFGRNSVSGTYGYFKEEALNEQPGSASVVQSVSQSLNGIGYSGIGYKTASVKTVALAKKEGAAFVEDNEQNALNGTYPPLEAQFLKLVLSKTGQQVVVKDGY.. 317
48 -19.6003pu5_A mol:protein length:333 extracellular solute-binding protein  ali model follow..  14  2...............SLADDHIYVTSGGSFLENVRKMAEPFEKQSGVKVTLVPGTNPAHALKILSSRDVAAFGGNDMYRLIRAKKLAQVDEKSVSLYDYSSVGIAYRPDKQGGVKSWKEFVERTVEFGKQVFFNNLSSNVRGAEVLSMFGKASIATLERMKPHIFKFFTAFNDPVVLLTSGEGAIGPGWDGRTFIAEDSVKWVDPTEGAVSSGPVMAVVKGGKEDLAKAFMNYALGEEAQKAFCE..... 273
49 -19.6004q8r_A mol:protein length:252 Phosphate ABC transporter, phosphate-binding protein  ali model follow..  14  2.................STNSVSISGSTSVGPVMEAEAEAFTKKPDVSIEINQIGSSAGIKNAMEGVSEIGMASRDLKGEEKQAG-------KEVEIAYDGIALITHKNNPVKITNWKELGGNDAPIVV--------SREDGSGTRDAFQEIVGFKAEELTVNSQISDGS-GNIKSLVQGNENAIGYISFSYVDDSVSAVKVDGVEATPENVLNLAVYKEENLTESGKSFIDFILSEEGQDIVAKEHL.. 242
50 -18.8004i1d_A mol:protein length:324 ABC transporter substrate-binding protein  ali model follow..  12  1.................SNAQITFVSQGGAYQAAVAILDPSAKKLGITINQD-DAWPAIKTQVGSGKQGLIEKLDFSKIPNAAAMPEAYRSPYSVSYEFYSSVLAFPKDAPNSWVDFWDVKKFPGRRALRNHPIATLEAALGVAPDKLYPLRAFKKLEEIKPHITVWWTSGAQSAQLLNDGEVDMEMAWNGRVSAVAKEGAKVSFTYNQGILQSLCILKGAPNLETAVKFLNEAVDPVHQANLPLH.... 264
51 -18.4003rpw_A mol:protein length:365 ABC transporter  ali model follow..  14  17...SAAFIALGAGTAAAQSNVVIMQDGGGYGDALRKMYDPFEKETGIKVVTVARSGPRIKAQAEAGKADLTFIFDQETKLLGDCCLADIDYSKLVALQVIGVGLVYNKDKPQTWADFWDVKKFPGRRCMPAWPRFTFEAALGVTKDKLYPIRALKKLKEIKPHVVKWWTTAAQPPQLILDGEADMCLAYTGSMSKLALEGAPIDLNQGFVYYDFFSIPKGAPNYDNALKLLSWRLDPKRAAQLTST.... 299
52 -18.4004jwo_A mol:protein length:341 Phosphate binding protein  ali model follow..  11  54............AATPSISGTIAVDGSSTVFPISQAVAEEFGKFPEVKLTVAMSGTGGGFKKFIAEEIDVTGASRPITEKEAAECKAKGIDYVEFQVAIDGLTVVINPANTSKVSKWSEVREGWPDEPIQLFGADTASGTFDYFTEVINGK------AKSSRSDYTANSNDNILVQGVVDSKGALGYFGYAYFAENASKLKAVKISEYTPLSRPLFIYTTKAKRPEVAEFIKFLLSEKGDQLVEEVKY.. 321
53 -17.6005l9s_A mol:protein length:332 ABC transporter, substrate binding protein (Mannopine)  ali model follow..  14  2..................EQRVVIATGGTYEKALREWFEPFTKATGIKVVTVSGTDAKVTAMVQTGNDLYLDGEIQAGSDAHFAITEDLSDFCMQFLAYKLNEN---GSNPQTWADMWDLAKFPGARSFPNFDDPWRVLAAALLADGVPREKAFRKLDELRDSVQVWWRTGDQSVQAFRNDEYRVGQIWLTRAKALKAEGYKIGWSYDGAFLVRIALVRGAPNRENALKLIEFLRNPAAQAKACET.... 270
54 -17.5004eq7_A mol:protein length:320 ABC transporter, substrate binding protein (Polyamine)  ali model follow..  16  1...................NDLVFSSWGGTTQDAAAWAEKFMVETGINVLQGPTDYGKLKAMVEANGDVVDVEGDYAAQAGPKGLLEKLDFSVIDKIGCNVDSV---SACPKSWADLFDTAKPGKRTFYKWSAPGVIEAALGVTADKLYPLRAFKKLDTIKSDIIWWSGG-AQSQQLIASAEAPFGSVWNGRMTALEQSGVKVETSWAQNITASLVVPKGTKNKDAAMKFIALATSAQAQADMATA.... 259
55 -17.4005sv6_A mol:protein length:291 Extracellular solute-binding protein, family 3  ali model follow..  12  22...LALLLGSGLAFNAQANTSTLKVCAASDEMPYSQLAKILADTMDRELEFDKAAIFLVTEKLLKNQCDVVMGVDKGDPRVA-----------SDPYYKSGYAFIYPADKGLDIKNWQSPALKDMSKFAIVPGSPSEVMLREIDKYEGNFNYTMSLIGFKSRRNQYVRYAPDLLVSEVVSGKADIAHIWAPEAKSASVPLKMVVSEEGVRQQFEQSIAVRSDDQELLKEINTALHKADPKAVLKDEGI.. 282
56 -16.9004gl0_A mol:protein length:333 Lmo0810 protein  ali model follow..  14  1.........SNASEGYAGSNTLTIYNWGDYIDP--SLITKFEKETGIKVIYQFDSNEAMMTKIEQGGTTFIAVPSDYAISKMKEENLLIPLDHSKPYFWGTLGIIYNKEPDKNFDTWNALFDPELKNQILLIDGAREVMGLGLSLGYSLNDTNKAHLQAARDKLETMTPNVKEIKLLMADNEAGVAVTFSGEAAENEDLEYVIPKDGSNLWFDNMVIPKTAKNVDGAHKFINFMLKPENAAINAEY.... 273
57 -16.8002v84_A mol:protein length:343 SPERMIDINE/PUTRESCINE ABC TRANSPORTER, PERIPLASMIC BINDING PROTEIN  ali model follow..  13  3...GSSSGIEGRGRLQTRQDVLYLYNWTYYTPT--SLIKKFEQQYNVQVVYDYASNEDMFAKLSIGASGYLVVPSGDFVSIMKRKHLLEKIDLSKPYYLGAAGIAVNKKAPSYARTWSIFSRKDLAYRMSMMDDMREVMGAALANEQELAQAAILVTDHWKPNLVKFDSD--GYAKSFASGDFVVAHGFAEAFFAHEHIDFFIPQDVASPVYVDFCIPKGARNRDLAHAFINFFLEPAHYAEFLDT.... 285
58 -16.7001a99_A mol:protein length:344 PUTRESCINE-BINDING PROTEIN  ali model follow..  11  1................AEQKTLHIYNWSDYIAP--DTVANFEKETGIKVVYDFDSNEVLEGKLMAGSTGFLVVPSASFLERQLTAGVFQPLDKSK-IGYNVDKVKAVLGENAPVDSWDLILKPENLVSFLDAPEEVFATVLNYLGKDPNSTKADDYTGPATDLLLKLRPNIRQYINDLANGDICVAIGWAGDVWQASNRAKEAKNGVNVSFSIPFAMPADAKNKDEAYQFLNYLLRPDVVAHISDH.... 285
59 -16.5004jdf_A mol:protein length:353 Putrescine-binding periplasmic protein  ali model follow..  10  2................AEQKTLHIYNWTEYIAP--DTVANFEKETGIKVVYDFDSNEVLEGKLMAGSTGFLVVPSAYFLERQLTAGVFQPLDKSK-IGYNVDKVKAVLGENAPVDSWDLILKPENLVSFLDDPEEVFATVLNYLGKDPNSTKADDYTGPATDLLLKLRPNIRQYINDLANGDICVAIGWAGSVWQASNRAKEAKNGVNVSFSIPFAMPADAKNKDEAYQFLNYLLRPDVVAHISDH.... 286
60 -16.5004eqb_A mol:protein length:330 Spermidine/putrescine ABC superfamily ATP binding cassette transporter, binding protein  ali model follow..  15  1...........SNANSRDSQKLVIYNWGDYIDP--ELLTQFTEETGIQVQYEFDSNEAMYTKIKQGGDIAIPSEYMINKMKDEDLLVPLDYSKIEGIENIGPEFLNQSFDPGNPEHWDDLWKLEYKNSIMLFDGAREVLGLGLSLGYSLNSKDPQQLEETVDKLYKLTPNIKEMKGYMIQNNVAIGVTFSGEASKNENLRYVVPTEASNLWFDNMVIPKTVKNQDSAYAFINFMLKPENALQNAEY.... 270
61 -16.0003ttm_A mol:protein length:346 Polyamine transport protein  ali model follow..  10  1............GPLGSDNKVLHVYNWSDYIAP--DTLEKFTKETGIKVVYDYDSNEVLEAKLLAGKSGYVVVPSNSFLAKQIKAGVYQKLDKSK-IGYNPDKVKAAFGDNAPVDSWDLVFKPENIVSFLDSPTEILPAAL-HYLGYKPDTDNPKELKAAEELFLKIRPYVTKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPVAIPKDAENTEGALAFVNFLMKPEIMAEITDV.... 288
62 -15.7001pot_A mol:protein length:325 SPERMIDINE/PUTRESCINE-BINDING PROTEIN  ali model follow..  13  2.................DNNTLYFYNWTEYVPP--GLLEQFTKETGIKVIYSYESNETMYAKLKTYKDGAYVVPSTYYVDKMRKEGMIQKIDKSKPYIWGATAIGVNGDDPKSVTSWADLWKPEYKGSLLLTDDAREVFQMALKLGYSGNTTDPKEIEAAYNELKKLMPNVANPANPYMEGEVNLGMIWNGSAFAGTPIDVVWPKEGGIFWMDSLAIPANAKNKEGALKLINFLLRPDVAKQVAET.... 267
63 -15.2005vvh_A mol:protein length:210 Octopine catabolism/uptake operon regulatory protein OccR  ali model follow..  12  1.................SNATLRIAAMPALANGLPRFLAQFRDRPNLQVSLMGLPSSMVMEAVASGRADIGYADGPQERQGFL-----------IETRSLPAVVAVPMGHRLDRVTPQDLAGERI---------------IKQETGTLFAMRVEVAIGGIQRRPSIEVSLSHTALSLVREG-AGIAIIDPAAAIEFTDRIVLRPFSIFIDAEFLEVRSAIGAPSTIVDRFTTEFWR-FHDDLMKQNGLME 210
64 -15.1005kkw_A mol:protein length:249 Cyclohexadienyl dehydratase  ali model follow..  14  46...................................DVMQELAKDMGVKITFVPTEWKTIVSGITAGRYDISTS-----VTKTPKRAEVAGFTD--SYYKYGTVPLVLKKNLKKYSTWKSLNNKDVTIATTLGTSQEEKAK-----------------EFFPLSKLQSVESPARDFQEVLAGRADGNITSSTEANKVVKYPQLAIVPDGEKNPAFLAMMVSKNDQVWNDYVNEWIKSKKSSGFFNK..... 232
65 -15.0004dz1_A mol:protein length:259 DalS D-Alanine transporter  ali model follow..  2LSKKFGLSMIVAFADSIVEGRTLNVAVSPASPPMLELFSSYCQSRHCKLNITEYAWDGMLGAVASGQADVAFSG----ISITDKRKKVIDFSE--PYYINSFYLVSMANHKITLNNLNELNKYSI------------GYPRGMAYSDLIKNDLEPKGYYSLSKVKLY-PTYNETMADLKNGNLDLAFI-YFTFKNKKKMPIESRYVFKNVDQLGIAFKKGSPVRDDFNLWLKEQGPQKISGIVDSW-MK. 253
66 -14.8005ted_B mol:protein length:226 Lmo0488 protein  ali model follow..  12  1.................SHGNIDLGFIYTMGA-VPELVQNFESHKDITFSFFQGATKSIIPDLKNEKFDLAICSYVENEPDI----------EFLPLTKQELVVVVAENHPYDSIDLQDTADYSY-------IFFSDTSGLRPLIDSLFAEIN------IQPKIGCYVEEDTAMVGLVSVD-YGISIMPKISSLAHYNVKVLSINEPKHDRFIYLASLKNHYISPASKAFKDFALRYGKKHFLRE..... 211
67 -14.7005jos_A mol:protein length:247 Cyclohexadienyl dehydratase  ali model follow..  15  45...................................DVAKSLAKSLGVKVEFVPTTWPTLMSDLQADKFDIAMGGVTVTPERQKKAD-------SDPYMTFGKTPLVRKEDADKFKSLEDINRPDVRVAVNPGGTNEKFA------------------EHLKKAKITVYENNVEIFQEVASGRADVMIT-EALYYAKKHPGLAAVLVDKPFTHSEKGYMMPKGDQEFLNYVNQWLDQMKQQGTYEK..... 233
68 -14.5003ttl_A mol:protein length:340 Polyamine transport protein  ali model follow..  12  1...............GPLGSSLHIYNWTDYIAP--TTLKDFTKESGIDVSYDFDSNETLEGKLVSGHSGYIVVPSNNFLGKQIQAGAFQKLDKSKPYLWGTNGIGYNVAGDQPIDSWAILFEPENMVAFMDSGDEMLPAAL-NYLGLDPNTHDPKDYKKAEEVLTKVRPYVSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPMAIPADAKAADNAYAFIDYLLRPEVIAKVSDY.... 284
69 -14.4005t0w_A mol:protein length:247 AncCDT-1  ali model follow..  17  45...................................DLAKALAKELGVKVEFVPTTWDGIIPALQTGKFDIVMSG----MTITPERKKKVDFSD--PYMTAGQTILVKKDNADKIKSFEDLNKPDVKVAVQLGTTSEQAAK-----------------EFLPKAKIRTFENNAEAFQEVVSGRADAMVTDSPVAAAKKNPGLAVVVVDEPFTHEPLGFAIRKGDPELLNWVNNWLKQMKKDGTYDK..... 233
70 -14.2004i62_A mol:protein length:269 Amino acid ABC transporter, periplasmic amino acid-binding protein, putative  ali model follow..  12  5MKKVLMTMFGLVMLEAIKSKGKLVVALNPDFAPFEELAKAIATELGVELELSPMSFDNVLASVQSGKADLAISG----VSKTDERSKVFDFST--PYYTAKNKLIVKKSDLATYQSVNDLAQKKV------------GAQKGSIQETMAK-------DLLQNSSLVSLPKNGNLITDLKSGQVDAVIF-AKGFVENNPDLAIADLNFEKEQDDSYAVAMKKDSKELKEAVDKTIQKLKESGELDK..... 257
71 -14.0005hpq_A mol:protein length:255 Cyclohexadienyl dehydratase  ali model follow..  11  45...................................DMAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAY-------SIPYLRDGKTPITLCSEEARFQTLEQIDQPGVTAIVNPGGTNEKFA------------------ANLKKARILVHPDNVTIFQQIVDGKADLMMT-RLQSRLHPELCAVHPQQPFDFAEKAYLLPRDEAFKRYVDQWLHIAEQSGLLRQRMEHWLEY 240
72 -14.0003k4u_A mol:protein length:245 BINDING COMPONENT OF ABC TRANSPORTER  ali model follow..  14  33...................................DLAREMAKAMGVKLKLVPTSWDGLIPGLVTEKFDIIISG----MTISQERNLRVNFVE--PYIVVGQSLLVKKGLEKGVKSYKDLDKPELTLVTKFGVSAEYAAK-----------------RLFKNAKLKTYDTEAEAVQEVLNGKADMFIF-FNVAFMAQKGQGYLVHLDTSLTYEPLGWAIKKGDPDFLNWLNHFLAQIKHDGSYDE..... 221
73 -14.0004prs_A mol:protein length:227 ABC-type transporter, periplasmic subunit family 3  ali model follow..  12  37...................................DLAKEIARRLGVELKIVDMTFDGLIPSLLTKKIDVIISG----MTITEERKKVVAFSD--PYFDAGQVIVVRKDSDFRPKTYEDLVGKTVAVQIG--------------------TTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPDLVISSGVLSSEQYGIAVRKEDTDLLEFILRELKKSPYDVLIEKW.... 224
74 -13.9003kbr_A mol:protein length:239 Cyclohexadienyl dehydratase  ali model follow..  11  43...................................DMAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAY-------SIPYLRDGKTPITLCSEEARFQTLEQIDQPGVTAIVNPGGTNEKFA------------------ANLKKARILVHPDNVTIFQQIVDGKADLMMT-RLQSRLHPELCAVHPQQPFDFAEKAYLLPRDEAFKRYVDQWLHIAEQSGLLRQRMEHWLE. 237
75 -13.6004lq2_A mol:protein length:245 HTH-type transcriptional regulator CysB  ali model follow..  10  3..............TWPDKGSLYIATTHTQAR-LPGVIKGFIERPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLY------------VMLPCYHWNRSIVVTPDHPTSSVTIEALAQYPL-------VTYTFGFTGRSELDTAFNRAG------LTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAH-DIFSHSTTKIGFRRSTRSYMYDFIQRFAPHLTRDVVDT..... 217

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.