current user: public

If you have questions about the server, please let us know.

Query: [R] COG3911 Predicted ATPase, from VFDB

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MQNDFDRVFVLTGGPGSGKTTLIAALRRAGFATSVVAGRGIVRDQSSIGGTALPWSDRTLFAELMLSWEMRSYQNAVEQKGPVFFDRGVPETLGYLRLSGLPVADHVSTAAKRFRYNPRVFIAPPWPDIFAQDEERKQTPDEAKCTYHALAEIYTELGYELVPLPLAPVETRLRFVLADAGLNLast
1 -55.200PF13521.6; A4CIV1_ROBBH/14-173; AAA domain  ali follow..  21  1.......KVVLFGPESTGKTTLARELARHGEPWVPEYAREYLQEKWDRVQQTCAPEDLLPIARGQMRLENIG---AREASRLLICDTDLLETKVYSETYYGGGCDPKLQAAALANDYDLYFLTDI-DIPWEADDLR-DKPHERAEMFHYFKTALRENNRRFVILS-GGREAR........... 160
2 -18.700PF07931.12; Q98FG2_RHILO/59-238; Chloramphenicol phosphotransferase-like protein  ali follow..  10  2......RIVLLNGVGSAGKSSIARALQTIFLHVQMDSFLEMLPDALQDHADGFSYETVRPVGERTLRGMRHAIAAMAGQGNDLIVDDVLCN----------GELSDCVDLLSAFDF-HLVGVMAPLEVLEAREARRADRLPGLARWQYERVHAGISYDL-EVDTSQSTPLECARRIQQRFQ.. 180
3 -18.200PF18751.1; S5Y5G5_9CAUD/1-187; P-loop Nucleotide Kinase3  ali follow..  14  4......RLIYLVGQPGSGKSTLMSALTAGFDRHKIAPAPDYPVAHDVLADKTTGEVVGAELGVRRELFSGTDALPSSIIDKAAPWVRSQPYPLLLAEGARLANRRFIDAALEGGYEVTLVLLDHNDAEDWRKVRSKAIGKTQRLSASRNLADALSGPAYEGKAVELRGHPDPIRSILKGI... 185
4 -17.900PF18748.1; A0A0A0YSQ1_9CAUD/11-206; P-loop Nucleotide Kinase1  ali follow..  13.YPARGELFYVKACNGAGKSTIPSYCAERDPEAYTVSQDGRILLTVMPSYGMLAFGKYDK-DYDEMKKAVELSELEEFIGYTAFFE-----------VIPSTILHTWVEYLNRPARPTTVFIDTDLETCLSRVNSRNGGAEFNADLVTEKFNRVMSHKTRFPSVPAVTIRSQGITIDEMVS.. 196
5 -17.500PF13238.6; A0B5Y2_METTP/3-117; AAA domain  ali follow..  40  1........IALTGTPGTGKTTVSGLLPFRVVNL...................................................................................................................................................... 25
6 -16.900PF01712.19; DCK_BACSU/12-212; Deoxynucleoside kinase  ali follow..  13  1........ITVAGTVGVGKSTLTKTLAKRGFKTSLEEVDHYLEKFYHDFER------SFHLQIYFLAERFKEQKTIFEAGGGFVQDRSIYEDTGIFAKTYTSLFEAMVMTPYFPHPDVLIYLEGDLENILNRIEQRGREMELQTSRSEEMHTRYENWACPVLKLRIEDYDNSIENIVDQIA.. 197
7 -16.300PF02223.17; KTHY_BACSU/8-199; Thymidylate kinase  ali follow..  14  1..........FEGPEGAGKTTVLQEIKNIGGIDIAEQIREVILNE--NNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSSLAYQGYARGLGIDEVLSAIGDMMPHVTVYFSIDPEEGLKRNRLDLEKLDFHTKVQEGYQELMKRFPERFHSVDAGQSKDLVVQDV...... 192
8 -14.900PF17213.3; F6ZLU4_XENTR/1991-2193; Hydin Adenylate kinase-like domain  ali follow..  15  2........IIVHGAPLTGKSSAAVTLAQHYNIPCLSID-SVVLDAISDSNSPTGMRARQLCSKAAFDVALRESEETEHIFQ...................................................................................................... 73
9 -14.600PF01443.18; RDRP_TMV/829-1085; Viral (Superfamily 1) RNA helicase  ali follow..  18  1........VLVDGVPGCGKTKEILSRVNFDEDLILVPGKQAAEMIRRRANSSGIIVATKDNVKTVDSFMMNFGKSTRCQFKRLFIDEGLM............................................................................................. 82
10 -14.200PF08433.10; O46079_DROME/1-293; Chromatin associated protein KTI12  ali follow..  19  4........VVITGLPASGKSTRARQLRDRGRKVHLISENEAVPKAGFGKNSHTGDSQKEKVVRSDLKSEAS---RHLNQEDLVILDAG---------NYIKGYRYELYCMSKVSRTTQTVFTCIPQEEAWTFNSQRTAPDELP........................................ 131
11 -14.200PF07088.11; GVPD1_HALSA/23-536; GvpD gas vesicle protein  ali follow..  12  11......ETLLINGAPGTGKTLFTIRGDSDVLYVSTRVDQETVHEMYFADHSSLDTTAILDLFQDPFELPLDVDVPFEKLDLDSLLEW-------------------IQEINAATTQLTIAF--DSWELIYEYLAVRHDDPPDIKTVTNQLAVLAREENIRLMLVTETAAPSSLEYIVDGV... 169
12 -14.200PF08303.11; Q6CK12_KLULA/389-554; tRNA ligase kinase domain  ali follow..  16  2........LVTIATIGCGKSTVSLTLNELFPESWGLVVNDNITSNKT-------------------DYIKSALQLFKDGKQFVLADKN............................................................................................... 62
13 -14.100PF03266.15; NTPTH_METAC/3-167; NTPase  ali follow..  14  1.......RIAVTGSPGVGKSTVVAKTEKPGFKIGGIRTAEIRKEGHREGFSIRDLATGKTVNLDDLERIGANAVRNALACDLVVIDE-----IGPMELISQSFVSAVEEVLESDKPVLAVL---------------------HHSSRHPLAQRFRK-GFEVLTVDKGNRDELPEKIT...... 165
14 -14.000PF00693.18; KITH_VZVD/19-298; Thymidine kinase from herpesvirus  ali follow..  15  1............GAYGIGKTTAAEEFLHHRILLIGEAICGIYGTQTRRLNGDVSPEDAQRISALMDTSTSDLVQVNKEPYKIMLSDRHPIASTICFPMSPAALPGLLFTLPAEPPGTNLVVCTVSLPSHLSRVSKRARPGETNLPFVMVLRNVYIMLINTIIFLKTNNWHAGWNTL....... 210
15 -13.700PF01591.18; F262_BOVIN/27-250; 6-phosphofructo-2-kinase  ali follow..  12  16........IVMIGLPARGKTYVSKKLTRY----LGVYRRQAVKSYKSYDFFRHDNEEAMKIRKQCALVALKDVKAYLTEEQIAVFDAT-NSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMDDFLKRIECYK---VTYQPLDPDSHDKDLSFIKV-QDYIQSKIVYYLMNIHVH 223
16 -13.300PF13401.6; B2UJB3_RALPJ/42-210; AAA domain  ali follow..  14  7........LLVCGPTGAGKTTLAKFMVENAHSQSHAEMEL----YVQAPASGETKFSWRLFYQRILNQLGDDLDSPKVAYGVDSLSGRLVRPRGTSGNSLAALRTAVERGLRARQVQFMVI-----------DEAATQRNSKLEVQLDTLKSLVNECGTQIVLVGSYDLYHLV.......... 169
17 -13.100PF04665.12; Q6TUP8_YMTV5/6-246; Poxvirus A32 protein  ali follow..  11  15.......RIALVGGSGSGKTAYLLSLFNT-FLFTPVYNSEYDSYIWPDHVNRVTTYEELDYSLITTKQKIEKYVKKQGNDKLLILD-----------GDKQIRSSCLLDFLNHGRHLNTSIILLCQTYKHVPVNGRTSDSDIENMLRSMSITGSKKDLLKSVSLMRSVSVNKRRVII...... 197
18 -13.100PF13671.6; B2JHT3_PARP8/20-178; AAA domain  ali follow..  13  2........VFICGHAGTGKTTLAKRLIGPACCLLDDTLYGVYSAAAIGALTGDPNDRDSPLFLQHFRDPEYRGLFDTAAENLRLGIGVIAVGPLSREVRERRLFDHVWLGVPKDAKISVVWVSTSEETARERIAARGNPNDAYK....................................... 145
19 -13.000PF07475.12; HPRK1_OCEIH/130-300; HPr Serine kinase C-terminal domain  ali follow..  21  21........VLIIGQSGVGKSETALELVKRGHRLVAD................................................................................................................................................... 48
20 -12.800PF10662.9; A6TJW6_ALKMQ/1-140; Ethanolamine utilisation - propanediol utilisation  ali follow..  14  1.....MKKVILVGRTGSGKTSLSQRLNQQELIYKKTQAMEFSDRVLDTPG---------------------EYIENRRFYYAIISASADCDVIGILQAIDEPNCIFPPGFGNFFNKPVIGII----------------TKIDLEHDSGNVESDLYAAGAQQIFRISAVTGEGLEELRVYME.. 139
21 -12.600PF06414.12; Q8P580_XANCP/35-230; Zeta toxin  ali follow..  15  10.SFEHPKAIILAGQPGSGKGSLARAADVELGRDVVLIDPDELRNAHPEVSALRNAHPYTWSGYTHSDASQELLQVTIEGKKNLIFDTTLSNGQWSAE---------LIKDLQSRGYDVEVAMAAHKLESEHGVDSRFSQQLDREGYGRYVPESHREVVYTRLPISLDTVHAQTTAPVRIFN.. 184
22 -12.500PF04310.12; MUKB_ECOLI/2-227; MukB N-terminal  ali follow..  37  1IERGKFRSLTLSGGNGAGKSTTMAAFV............................................................................................................................................................ 47
23 -12.300PF09818.9; Q10V01_TRIEI/4-493; Predicted ATPase of the ABC class  ali follow..  10  275........TLIVGGGYHGKSTLLKAIEGGVYNHVPDDGREFVVTD--PAAIKIRAEDGRSVAGVDISPFINQLPQNRSTTQFTTENASGSTSQAANIMEALEAGLGNSNLEETTTTATTPVFLVDEDTAATNFMIRDREQEPITPFIDKVRQLYTDYQVSTILV-MGGSGDYFEIADKIIAME 454
24 -12.100PF03215.15; RAD24_YEAST/58-237; Rad17 P-loop domain  ali follow..  10  41.PNAKHRILLLSGPSGCSKSTVIKELSKILVPKYRQNSNGTSFRSTPNEHKVTEFRGDCIVNDLPQMESFSEFLKGARNLSLILIED------VFHIDTRRRFQQLILQWLYSSEPLLLVICITECEIPENDNNYRK.............................................. 180
25 -12.000PF13479.6; F5YIK8_TREPZ/11-202; AAA domain  ali follow..  13  4.......RCALFGPSGSGKTMTALRMAK---GIADTMGVPFAVIDTEARSASKYADDVDDLDGKTVDHYIAAMNECVKAGKVLVIDS................................................................................................ 85
26 -12.000PF05496.12; RUVB_BACAN/21-179; Holliday junction DNA helicase RuvB P-loop domain  ali follow..  15  28MREETLDHVLLYGPPGLGKTTLANIIANEMGVNVRTTSGPAIERPGDLAAVLTSLQPGDVLFIDEIHRLHRSIEEV........................................................................................................... 103
27 -11.800PF13173.6; F9Z5R0_ODOSD/18-152; AAA domain  ali follow..  10  2......KPLILNGARQVGKTWLLHEFAKL------EYKKEAYVVCRKNNLARQLFSQDFNVDRILRGLRAMTSVDITPGDTLIILDE................................................................................................ 76
28 -11.800PF01637.18; A8M939_CALMQ/15-228; ATPase domain predominantly from Archaea  ali follow..  15AEKGTWNPVVIYGPEGCGKSAFLKQAVEV----LGEYDYSVVKVSPLEDESNEKLRYSEELRGLFRDIMYDVVRRRIRRKIALLADDVFQAIGLDKAELLVKRLLNMIEYSSVDYERIVVIVA-------TSEGVTWGRIGRHRWAEIMAMWNMPREGFGKLYNALPGPKPPFEEVWRWTG.. 205
29 -11.500PF01926.23; DER_CHLCV/3-119; 50S ribosome-binding GTPase  ali follow..  11  1.......RIAILGRPNVGKSSLFNRMCKRSLAIVNSQERDRLYGEIRGWSVPVQVIDTGGVDKDKHIYKQALAGANEADILLLVVD................................................................................................. 88
30 -11.400PF01121.20; COAE_HAEIN/3-181; Dephospho-CoA kinase  ali follow..  20  3........VGLTGGIGSGKTTIANLFTDLGVPLVDVVAREVVAKDSPLLSKIVE-----HFGAQILTEQGELNRAALRE--RVFNHDEDKLWL---NLLHPAIRERMKQKLAEQTAPYTLFVVP------------------------LLIENKLTALCDRILVVDVSPQTQLARSAQRDNNN 146
31 -11.300PF02283.16; Q89Q74_BRADU/14-176; Cobinamide kinase / cobinamide phosphate guanyltransferase  ali follow..  14  1........ILITGGARSGKSRRAETRTQAFPGRPVYIATEALDAEMEDRIAKHRARRGADWIEREVPLDLVQALVETEGGGARLVDTLWLSNLLHSERDWSREVTHLAEVLPRLRSPVIMVTNEVGLGIVPDNALARTYRDAAGIMNQTFAGVADEVEFVVAGLP.................. 160
32 -11.000PF04670.12; Q9VHJ4_DROME/4-230; Gtr1/RagA G protein conserved region  ali follow..  11  1.......KVLLMGKSGSGKTSMRSIIFANYIAATIDVEHSHVRFLGNLVLNLWDCGGQEGFMKQYFAQQRDNIFRNVEV--IYVFDVESQEIERDIHYY-----QSCLEALLQNSPEAKIFCLVHKMDLVPEGLRESVFTERMEDLIKLSKPG--NVTCFRTSIWDETLYKAWSSIVTML... 172
33 -10.900PF10236.9; Q755C9_ASHGO/113-434; Mitochondrial ribosomal death-associated protein 3  ali follow..  11  14LSGTEHQRVILTGQPGVGKSTLLAQAFEKGSVIIPMYLKKLLTKILKSNKKSVALTQEYKFPVADTRESASKRVTRLVPGKNTLYD---LLSMKTTPAARGMLFQAVIDELVAQSAVPVYLTVDNFSRILSEPLSAYKDTSCR........................................ 189
34 -10.800PF07999.11; Q8T9M2_9TRYP/206-649; Retrotransposon hot spot protein  ali follow..  15  122.LNIDRASNVLIGTPGIGKSFLLYKLLHYEIIYVVRGKAYVFHKPIGGRAGYVTFYSNYENAFTVVEQIVRDSCKVENIKGYVIFDVGGPPVGCAGIVLSSPDIKQFYEWSKQNRALHIYINCDTLKDLEAYGWNPSDAKEKIESEWQEIQDRIPIVGLLRHIVDSASFTRQCDLIEEAIN.. 332
35 -10.800PF12631.7; D5XDU4_THEPJ/127-455; MnmE helical domain  ali follow..  24  96.......KTVIIGKPNVGKSSLLNALVKEKRAIVTDIPRDVIEEFVSIRGIPLKILDTAGIRETEDVVEKIGVQRSKEALELFVVDVA............................................................................................... 184
36 -10.700PF00625.21; KGUA_ECOLI/4-186; Guanylate kinase  ali follow..  12  4........YIVSAPSGAGKSSLIQALLKTSVSHTTRQPRPVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGA----------------QQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHY-YLIVNDDFDTALTDLKTIIRAE 183
37 -10.600PF13245.6; B1YJE6_EXIS2/332-475; AAA domain  ali follow..  20  14........MVLTGGPGTGKTTVIKGIEVYPYVLVAPTGRAAKRLSEATDVPAMTIHRLLKYDGTNFQLD---EDQPIAGKVLIIDESSMIDIYLLSSL..................................................................................... 120
38 -10.600PF09439.10; SRPB_YEAST/36-221; Signal recognition particle receptor beta subunit  ali follow..  17  1...SYQPSIIIAGPQNSGKTSLLTLLTT---SVRPTVVSQEPLSAADYDGSGVTLVDFPGHVKLRYKLSDYLKTRAKFVKGLIFVDST............................................................................................... 84
39 -10.400PF03029.17; O01426_CAEEL/6-251; Conserved hypothetical ATP binding protein  ali follow..  10  1..........VIGAPGAGKSTFCAGLTD----IFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVMDRLGLGPNGALKYCIETLGANC-----------NWLLQKIEANHKKYLIIDCPGQLELYKSEGE------------WKVIRFLEKSGVRLCALPSKFISVALSTLATMVTME 157
40 -10.400PF03668.15; RAPZ_ECOLI/1-282; P-loop ATPase protein family  ali follow..  13  1.....MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDADREISAAVSIDVRNMPESPEIFEQAMSNLPDAFSPQLLFLDAD---------------RNTLIRRYSDTRRLHPL-------------SSKNLSLESAIDKESDLLEPLRSRADLIVDTSEMSVHELAEMLRTRLL.. 153
41 -10.400PF13555.6; Q0A6A1_ALKEH/19-80; P-loop containing region of AAA domain  ali follow..  55  27.........LLTGDIGSGKSTLVDAIT............................................................................................................................................................ 44
42 -10.400PF01745.16; IPT_RHIRD/1-235; Isopentenyl transferase  ali follow..  19  1.....MDLRLIFGPTCTGKTSTAIALAQQTGLPVLSLDRVQCCPQLSTGSGRPTVEELKGTTRLYLD.................................................................................................................... 62
43 -10.300PF00350.23; Q582R3_TRYB2/29-205; Dynamin family  ali follow..  1........IAVVGSQSAGKSSVLEAIVGRGSGIVTRCPLVLQLVQ-LPRSNKDEWGEFLHRPNKKFFDFSEINEEIQNRTTEVAGHSAITDKPINLKIYSSHVLN---------------LTLVDLP--LVMNAVGDQPKDIDRQIKSMVTRYISPSNTIILAISPANADLATSSSLQIAK.. 161
44 -10.200PF01695.17; Y4IQ_SINFN/60-238; IstB-like ATP binding protein  ali follow..  16  46...AKGANILLFGPPGGGKSHLAAAIGENGWRVLFTRTTDLVQK----------------LQVARRELQLESAIAKLDKFDLLILDD-----LAYVTKDQAETSVLFELISARYERRSIMITA............................................................ 148
45 -10.200PF05049.13; Q9DCE9_MOUSE/50-412; Interferon-inducible GTPase (IIGP)  ali follow..  13  37.......KIAVTGDSGNGMSSFINALR----------------------FIGHEEEDSAPTGVVRTTKKPACYSSDSHFPYVELWDLPGLGATAQSV-------ESYLEEMQISTFDLIIIVAS----------------EQFSSNHVKLAITMQRMRKRFYVV------TKLDRDLST.... 158
46 -10.200PF06068.13; RUVB2_CAEEL/17-361; TIP49 P-loop domain  ali follow..  16  51......RALLVTGEPGAGKTAIAIAISKELGEDTPFVSTEALTQAFRRALGIQIKEETEVLEGEVISLEVDRSANGMGPKVGKL................................................................................................... 141
47 -10.100PF09848.9; A1A222_BIFAA/236-699; Uncharacterized conserved protein (DUF2075 topsan)  ali follow..  10  1.....SRLIFVQGVAGTGKTVLLSHLMDINGRINDEDDEDILETDSSLKISKEDRRKAYILVNHNQQMHVYNQIASKLGLQKHFGEVALKPSQFINRFSEKTTSNRAIADKPRGKADVVLV----------DEAHLLLTQGDQGYSGNMLHDLLRRAKVVIAVFDPNQ............... 161
48 -10.000PF06745.13; O29463_ARCFU/20-274; KaiC  ali follow..  35........MNITGVPDTGKSLLAEQFAITQYVTVESPANFLYTAMKERSEAM----DFTKVESNVVVIDASESDELRENPKALM--------------------ETMAYAIKEKKVTNTII-----------DSITGHKEMMARQIVRQFFNFMKKYRQTGIFVSQKRSAQ............ 175
49 -10.000PF05621.11; B7J739_ACIF2/21-211; Bacterial TniB protein  ali follow..  13  31.VRPRMPNLLIVGDSNNGKTTVIRRFQKLHGEGVNEDAEPV---------EAPPSADEKGLYIAILERFWTPYRATDSASKLR---------------------YQVVHLMRDCHVRILVI-----------DEFHTGTVTKQREVMNAIKLLCNELAIPIVGVGIREADPQHASRFDVVTLP 185
50 -9.880PF00910.22; A7M6L1_9SECO/473-576; RNA helicase  ali follow..  23  1........VYAYGESRTGKTLVVDKLITD.......................................................................................................................................................... 21
51 -9.700PF05673.13; Q0K6N5_CUPNH/29-287; Protein of unknown function (DUF815 topsan)  ali follow..  14  53VSKLPANNVLLTGARGTGKSSLIKACLNA----LVEVDKDDLGD---------------------LGDIVELVAQRPERFVIFCDDLSFEEG----ESGYKSLKSALDGSVAAQSDNVLIYATS----------------NRRHLLPEYMKDNETYRHTDDGEIHPGEVVEEKISLSERFGLW 197
52 -9.690PF01057.17; Q7TG44_9VIRU/193-485; Parvovirus non-structural protein NS1  ali follow..  10  131.KWGKRNTLWLFGHATTGKTNIAEAIAHAPFNDCVEKMIIWWEEGKMTAKVVETAKAILGGSRVRVDQKCKASVPIEPTPVIITSNTNM.............................................................................................. 232
53 -9.680PF00735.18; SEPT2_MOUSE/34-313; Septin  ali follow..  16  6.......TLMVVGESGLGKSTLINSL-EASTVEIEERGVKLVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRHIIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIV-----PVIAKADTL---TLKERERLKKRILDEIEEHSIKIYHLPDAESDE............ 187
54 -9.560PF02492.19; Q92P35_RHIME/12-211; CobW/HypB/UreG, nucleotide-binding domain  ali follow..  13  4.........VITGFLGAGKTTMIRNLGKRIALIINEFGDLGVDGDVLKGCGAEACSEEDTVADDFIPTMTKLLERENRPDHIVIETSGLALPQPLVAAFNWP------DIRSEVTVDGVVTVVDSAAVAAGRFADDHDNLDHESPLEELFEDQLTAADLIVLNKTDLIDAAGLKSVREEVA.. 195
55 -9.540PF00485.18; KPPR_SYNY3/10-192; Phosphoribulokinase / Uridine kinase family  ali follow..  28  2........IGVAGDSGCGKSTFLRRLTDL.......................................................................................................................................................... 22
56 -9.320PF11398.8; Q6LIW4_PHOPR/1-374; Protein of unknown function (DUF2813 topsan)  ali follow..  33  17LSLSFNQLSVLIGENAWGKSSLLDALS............................................................................................................................................................ 43
57 -9.310PF13500.6; B1XHZ8_SYNP2/6-216; AAA domain  ali follow..  10  1......QHIVVASTEPSGKSALVQSLKQKGISV------AYSKPIGTVWHDEQNGRFTRIEDDLRFLGEAFGLKETEVRSPVLFLDEATVAQRLTGQDQT-DYPQKLKDDLGAIASDITFI-----------EAPKSLWEGSLFNLSAG--EIAATLGAKILLVIPYHHKLLVDSLLTIYR.. 160
58 -9.260PF07652.14; Q32ZD8_9FLAV/1675-1822; Flavivirus DEAD domain  ali follow..  14  5......QLIVLDPHPGAGKTRIRQAVERRLWTLALAPTRVVAAEMAEA-IQQHTGKEIVDLMCHATFTMRLLSGGRVPNYNMFIMDE................................................................................................ 103
59 -9.220PF00006.25; F4A1L9_MAHA5/145-353; ATP synthase alpha/beta family, nucleotide-binding domain  ali follow..  19  15......QRMGVFAGSGVGKSTLMGMMARYAIALIGERGREVKEFIEKDLGEGLARSVLVVATSDQPPLIRTKAAFVATAIAEYFRDQGMMDSLTRFAMAQREVGLAIGEPPVSRGYTPSVF.............................................................. 140
60 -9.160PF04275.14; F8W4R0_DANRE/22-132; Phosphomevalonate kinase  ali follow..  21  1..........FSGKRKSGKDYVTDLIQKR.......................................................................................................................................................... 19
61 -9.100PF00308.18; DNAA_STRCO/317-535; Bacterial dnaA protein  ali follow..  13  37........LFIYGESGLGKTHLLHAIGHYARSLYPGTRVRYVSSEEFTNE----------FINSIRDGKGDSFRKRYREMDILLVD------IQFLADKESTQEEFFHTFNTLHNANKQIVLSSD------------RPPKQLVTLEDRLRNRFE-----ITDVQPPELETRIAILRKKAVQE 182
62 -9.060PF07755.11; Q3J5L7_RHOS4/129-327; Domain of unknown function (DUF1611_C) P-loop domain  ali follow..  10  5GRKRTGKRMLAVGTDCSGKMYVDREMRERGLKS------SFRATGQTGILITGDGVPLDAVIADFMAGSIEYLTPDNEADHWDLIE-------GQGSLFHVSYSGVTLALIHGGQPDALVICHEPTRSHMRGPDYKLPSIEQVRDAALAMARVAVAVGCSIQALSDEEALAYCAEIEARTGL. 181
63 -9.030PF13476.6; Q6C910_YARLI/6-233; AAA domain  ali follow..  55  26.........LIVGQNGSGKTTIIECLR............................................................................................................................................................ 43
64 -9.020PF01078.21; Q8EJV7_SHEON/193-396; Magnesium chelatase, subunit ChlI  ali follow..  13  23......HNLLMLGPPGTGKTMLASRMMA----LLPALNYEEALEVAAIHSVAGINIKPQDFLKRPFRAPHHTCSSISAHRGVLFLDRKVLDCLREPMETGEVVISRAAAKLTFLSRFQLIAAMNPSPSGDIDGPNRATPDQIQRYLARL----------------SGPFIDRFDLTIEVPKLP 200

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.