current user: public

If you have questions about the server, please let us know.

Query: [DL] KOG3999 Checkpoint 9-1-1 complex, HUS1 component, from VFDB

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MRFKTRISNLYTLTRLVQALDKIGRFCWLRLMPETVNFVIVPDFRMTQVWSVLEVETIFEDYVVQSNADNVINLEVPIDNFYKALRSAANASDSTVRLSKKNNQPLLSLSTTWSGRAFGSNIVTHNIPVRVLSQSYVSVIKEPTAPEPDCHIFLPQLNFLRHVVDKYKSLSDRIIMSANMSGELQLSVNIPSARVSTKWKGLENPELDPSQVEDISRHPSQTRAPEEFVHMRLDSKDLVNMLKISSVAKRVIACFCEGHALVLYVYITDPEDEHTAVLTYYISTYVDLast
1 -87.400PF04005.12; Q6C1V4_YARLI/1-312; Hus1-like protein  ali follow..  24  1MKLRVKLDRISLLRDVLNAAMAVRKEAYIIFAPTDVRIVSPASNTTISLFAYFTVDYLCDPNVCVSAFDDMCVFLVSLDDFARALKSSSSYHMDEVRLSLRQYQGLLQLQVRITQHRRGPTVVTHNLPVDPRKLEEESYLLVQPEIQPQVYIMLPKTLNIAKLSERYKRLGKLVTLSANNSGCLKLSLDAVDVNVETDWKGLMNPQLDAGEQEEETGESRAKPNSSEFATVSIPCKDWCLLTNMALICDSVVLAISHERVLTAYCYTDH-PGDTSGSITYYMSHI.. 311
2 -35.500PF02144.16; G3QNL8_GORGO/16-257; Repair protein Rad1/Rec1/Rad17  ali follow..  11  1.SLVASLDNVRNLSTILKAI-HFREHATCFATKNGIKVTVEN-AKCVQANAFIQAG-IFQEFKVQ---EESVTFRINLTVLLDCLSIFGSSPLTALRMCYQGYGYPLMLFLEEGGVVTV---------CKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITMSPDKYFRLSTFGNAGSSHLDYPK--------------DSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCKVSIRTDNRGFLSLQYMI.................... 242
3 -30.500PF04139.13; RAD9B_BOVIN/32-289; Rad9  ali follow..  1............FGKAIQALSRVSDELWLDPSEKGLALRSVNSCRSAYGCVLFSPV-FFQHYQWSADIILNLNCRLGMKSILPIFRCLNSLEKNVEKCKIFTRSDKCKVVIQFFCRHGIKKIHN-------VCFQGSRPLQVIFQKNMCANTLVIQPRVLAEAIVLFTSSQEEVTLAVTP----------LKVCIKSSNEESMDLTDSVYSEMFVGPDEFDFFQIGIDTEITFCFKELKGVLTSEAIHAPIAIHFDFGKPMALSI------DDMLLEANFILATL.. 258
4 -29.000PF00705.18; PCNA_HUMAN/1-125; Proliferating cell nuclear antigen, N-terminal domain  ali follow..  16  2..FEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY-----RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVE............................................................................................................................................................. 124
5 -23.000PF02747.15; PCNA_MOUSE/127-254; Proliferating cell nuclear antigen, C-terminal domain  ali follow..  14  3................................................................................................................................................PEQEYSCVIKMPSGEFARICRDLSHIGDAVVISCAKN-GVKFSASGELGNGNIKLS---------QTSNVDKEEEAVTIEMNEPVHLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYKIAD-----MGHLKYYLAPK.. 128
6 -7.720PF00712.19; DPO3B_CAUVC/1-121; DNA polymerase III beta subunit, N-terminal domain  ali follow..  11  1MKLTIERAALKALGHVQSVVERILSNILLSAEGDRLSFSATDLDMEIID-------------EGFAQIDVPGQITAPAHTLYEIVRKLPDGADVSLSFSGDDPRLVIQ................................................................................................................................................................................... 101
7 -5.710PF17991.1; W6WF24_9RHIZ/446-591; Thioredoxin like C-terminal domain  ali follow..  12  52..................TLSQPDGSIAYRFSARDLHLVLGPGAAGKPVRFQVTIDGKAPGIDHGADIDADGNGTVTATKLYQLVRQAGDVEARNFEIRFLDP........................................................................................................................................................................................ 136
8 -5.680PF18315.1; A9GUG2_SORC5/11-107; Integron cassette protein VCH_CASS1 chain  ali follow..  18..............GVNEIALALAGAIIWKKDDEPIKVMVQDGDTKNVLWARLGGKRYAFSYNHKAGT-----IEMREGSTRGAVLHSFTNATPLPMLR............................................................................................................................................................................................ 97
9 -5.440PF04990.12; Q6CBQ3_YARLI/1145-1279; RNA polymerase Rpb1, domain 7  ali follow..  1.................TSLKNVTAATEIYYDPDPRTTVIEEDIDTVDAYFSIPDETVEATLRLELDRAKMLDKQLTMSQVAQKISSSYGEDLFVMWSEDNADKLIIRCRVVRDPKTLEEDVDAEE................................................................................................................................................................. 117
10 -5.340PF07669.11; Q8A0K8_BACTN/985-1091; Eco57I restriction-modification methylase  ali follow..  1MKINAIVGNPPYQEKETANGQKVSVSIFQYFQTISDRLGRYTSLIYPGARWIHRSGKGLEQFGLTQINDPHLCFLKFFPDSMDVFKEVGIADGLSIVMKDTQK........................................................................................................................................................................................ 107

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 4 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.