current user: public

If you have questions about the server, please let us know.

Query: [F] COG0005 Purine nucleoside phosphorylase, from VFDB

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MKDRIERAAAFIKQNLPESPKIGLILGSGLGILADEIENPVKLKYEDIPEFPVSTVEGHAGQLVLGTLEGVSVIAMQGRFHFYEGYSMEKVTFPVRVMKALGVEALIVTNAAGGVNTEFRAGDLMIITDHINFMGTNPLIGPNEADFGARFPDMSSAYDKDLSSLAEKIAKDLNIPIQKGVYTAVTGPSYETPAEVRFLRTMGSDAVGMSTVPEVIVANHAGMRVLGISCISNAAAGILDQPLSHDEVMEVTEKVKAGFLKLVKAIVAQYELast
1 -106.000d4uc0a_ c.56.2.0 (A:) automated matches {Agrobacterium vitis [TaxId: 373]}  ali model 3D-neighbors follow..  41  1......PAVDLLIDRLNGLPRIAIVLGSGLGGLVDEVENAVRIPFADIPGFPQGGVSGHAKELVAGLFAGQPIIMLAGRVHYYEEGDAAAMRLPIETLASLGVTTLILTNAAGSLRADMPPGSVMQLIDHINFSGHNPLIGETG---DGRFVGMTQAYDGELAEAMRRAADAEDISLSSGVYMWFSGPSFETPAEIRMARTLGADAVGMSTVPEVILARFFGLKVAAASVITNYGAGMTGAELSHEETKDMAPIGGRRLVAILKRMIVDGG 263
2 -102.000d1b8oa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  47  5.YEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQLQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDSQGKANHEEVLEAGKQAAQKLEQFVSLLMASI. 280
3 -98.200d1g2oa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  36  2PDELARRAAQVIADRTGGEHDVAVVLGSGWLPAVAALSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVG-------GEFVDLTDAYSPRLRELARQSDPQ----LAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF. 262
4 -77.300d3t94a_ c.56.2.1 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  25  2.............IEQNEKASIGIIGGSGLYDFSESKEIKVYTPYGQPSDFITIGKIGNKSVA---------FLPRHGRGHRIPPHKI-NYRANIWALKELGVRWVISVSAVGSLRMDYKLGDFVIPDQFIDMTKNREYSFFDGP--VVAHVSMADPFCNSLRKLAIETAKELNIKTHEGTYICIEGPRFSTRAESRTWREVKADIIGMTLVPEVNLACEAQMCYATIAMVTDYDVF-AEIPVTAEEVTRVMAENTEKAKKLLYALIQKLP 251
5 -22.400d1je0a_ c.56.2.1 (A:) 5`-deoxy-5`-methylthioadenosine phosphorylase {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  16  3..........HILAKKGEVAERVLVVGD-ARLLSTLLQNPKLTNENR--------------LVYTGKYNGETVSIAT------HGIGGPSIAIVLEELAMLGANVFIRYGTTGALVPYINLGEYIIVTGASYNQGGLFYQYLRDNACVASTPD------FELTNKLVTSFSKRNLKYYVGNVFSSDAFYAEDEEFVKKWSSRGNIAVEMECATLFTLSKVKGWKSATVLVVSD--------NLAKGGIWITKEELEKSVMDGAKAVLDTL. 232
6 -22.000d1odka_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  16  1.......SPIHVRAHPGDVAERVLLPGD---------PGRAEWIAKTFLQNPRRYNDHRGLWGYTGLYKGVPVSVQT------TGMGTPSAAIVVEELVRLGARVLVRVGTAGAASSDLAPGELIVAQGAVPLDGTTRQYLEGRPYAPVP--------DPEVFRALWRRAEALGYPHRVGLVASEDAFYATTPEEARAWARYGVLAFEMEASALFLLGRMRGVRTGAILAVSNRIG--DPELAPPEVLQEGVRRMVEVALEAVLEV..... 234
7 -20.900d4mcha1 c.56.2.0 (A:1-242) automated matches {Vibrio fischeri [TaxId: 312309]}  ali model 3D-neighbors follow..  12  2......SKQPHICVDENQVSPYVIVCGE-VNRIVELMDNVELLAENR--------------RVFNGVYKGTTITICS------TGIGAPSMIIAVEELKLCGATHVIRVGSAGAMQDHIQLGELIVAEGAVRDEGGSKAYISSAYPAYA---------SFALLKEISHFLENQSVKYYFGVVRSHDSFYTDEEDQLQYWNKKGILGADMETSALFTVGRLRGLQVASILNNVVLYQ--QDVKEGVNQYVNDNKAMMNGERLAAITALETL. 239
8 -20.600d1ybfa_ c.56.2.1 (A:) AMP nucleosidase {Bacteroides thetaiotaomicron [TaxId: 818]}  ali model 3D-neighbors follow..  14  8.....NWLPRYTQRQLIDFEPYILLTNFSLHVFAEHYGVPIV-----------------GEHTSMPNASAEGVTLIN------FGMGSANAATIMDLLWAIHPKAVIFLGKCGGLKLENALGDYLLPIAAIRGEGTSNDYLPEEVPSLP---------SFSVLRAISSAIQNKGKDYWTGTVYTTNRRVWEYDEKFKYLRSTHASGVDMETATLMTVGFANKIPMGALLLISDRPMFPEGVK-TEESDQLVTDNFAEEHLMLGIDALEIIR 243
9 -20.300d4oy3a1 c.56.2.0 (A:2-230) automated matches {Helicobacter pylori [TaxId: 85963]}  ali model 3D-neighbors follow..  18  33.............................................................VFHKGVYHNKEIIVAYSKI------KVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVD--LSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIA--SGDQFVHSKERKLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISNNA-----DEKAGMSFDEFLEKSAHTSAKFLKSMVDEL. 229
10 -20.100d2b94a1 c.56.2.1 (A:-2-241) automated matches {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}  ali model 3D-neighbors follow..  14  2.....EEMQRHIKLTPSQTTPVVLVVGD-VDKVKMLCDSYVDLAYN------------REYKSVECTYKGQKFLCVS------HGVGSAGCAICFEELMNNGAKVIIRAGSCGSLQPTMKRGDICICNAAVREDRVSHLMIYSDFPAVA---------DFEVYDTLNKVAQELEVPVFNGISLSSDLPHKIIPTRLEDYSKANVAVVEMEVATLMVMGTLRKVKTGGIFIVDGCPLKWDEGDFDNNLVPEKLENMIKISLETCARLAKK.. 243
11 -20.100d4k6oa_ c.56.2.1 (A:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]}  ali model 3D-neighbors follow..  14  17...................ATLAIIPGD-VQKIAELMDNPVFLASHR--------------TVYRAELDGQSVVVCS------TGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGSVRLDGASLHFAPMEFPAVP---------DFDVATAMKAAAQESGATVHMGVTASSDT---RFQGSMKEWQDMGVLNFEMESATLLTMCASSGLKAGCVAGVIINRT--QKEIPDHATLKETEARSIKVVVEAARKMLK... 252
12 -19.700d4rj2a_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  1.......ATPHINAEMGDFADVVLMPGD-AKYIAETFLEDAREVNNV-----------RGMLGFTGTYKGRKISVMG------HGMGIPSCSIYTKLITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIRFKDH--------DFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPDGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIR--THEQTTAAERQTTFNDMIKIALESVLLGDK... 237
13 -19.300d3qpbc_ c.56.2.0 (C:) automated matches {Streptococcus pyogenes [TaxId: 301450]}  ali model 3D-neighbors follow..  17  5.....VGLQYHLQIRPGDVGRYVIMPGD-CAKIAEHFDNAVLVADS------------REYVTYTGTLNGEKVSVTS------TGIGGPSASIAMEELKLCGADTFIRVGTCGGIELDVKGGDIVIATGAIRMEGTSKEYAPIEFPAVA---------DLEVTNALVNAAKKLGYTSHAGVVQCKDA-SYELLNKWEAWKRLGTKASEMESAALFVAASHLGVRCGSDFLVVG----ERNALGMDNPMAHDTEAAIQVAVEALRTLIEN.. 252
14 -18.800d4f1wa_ c.56.2.1 (A:) automated matches {Salmonella enterica [TaxId: 904139]}  ali model 3D-neighbors follow..  17  2....................KIGIIGAEEVTLLRDKIDNRQTITLGGC-------------EIYTGQLNGTEVALLKSGI------KVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDAD--VTAFGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIV--SGDAFNGSVGLAKIRH-DAVAVEMEATAIAHVCHNFNVPFVVVRAISDVA-----DQQSHLSFDEFLAVAAKQSTLMVETLVQKLA 230
15 -17.700d5b7ga_ c.56.2.0 (A:) automated matches {Aeromonas hydrophila [TaxId: 380703]}  ali model 3D-neighbors follow..  13  1.................ASAPILIQGAVEVETLVAALKDKQELTVGSW-------------TYWQGTLSGYPVVVSRTEV------LANAAAATTLAMERFQPRLVINQGTAGGHDPALHRGDIVIGTKSFNMGAYREVTMRLRDNGKLVEHSSFAGDPELVGRALGMADRYRHGRVVPGIIG--TADEWNRQVARILHQTYQTAAEEMETSSAALVAEAYKVPFVGIRVLSNTDLHGE------EFDPQTAIHCQQFVIDYAKALINGF. 249
16 -16.800d2h8ga_ c.56.2.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  11  2...............LRPISSVVFVIAAEALPLVNKFGLSETTDSPLGKGLPWVLYHGVKDLRINVVCPGRDAALGIDSV------TVPASLITFASIQALKPDIIINAGTCGGFKVKANIGDVFLVSDVVFHDRRIPIPMF-------------DLYGVGLRQAFSTPNLLKELNLKIGRLS--TGDSLMSTQDETLIIANDATLKDMEGAAVAYVADLLKIPVVFLKAVTDLV---DGDKPTAEEFLQNLTVVTAALEGTATKVINFIN 239
17 -16.700d1t8sa_ c.56.2.1 (A:) AMP nucleosidase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  255.............................................................AWHLITADGQGITLVN------IGVGPSNAKTICDHLAVLRPDVWLMIGHCGGLRESQAIGDYVLAHAYLRDDHVLDAVLPPDIPI-PSIAEVQRALYDATKLVSGRPGEEVKQRLRTGTVVTTDDRNWELRYSASAFNLSRAVAIDMESATIAAQGYRFRVPYGTLLCVSDKPL--HGEIKLPGQANRFYEGAISEHLQIGIRAIDLLR 457
18 -15.500d4l0ma1 c.56.2.0 (A:2-237) automated matches {Borrelia burgdorferi [TaxId: 224326]}  ali model 3D-neighbors follow..  13  1.....................ILIISAMQSEEINKILDNKEEIVLNDYLE---------NKKIYKGKILGKDVISLTTGI------KVNAATWSSQIISKYKITHIINSGSSGGINSNLKILDIIVSSETAYYDFD--LTKFGHKIGQVPNLPQKFKADEELLKKVANIVDNKLLNIDIHIGLILTGDQFVDNEKNL-----DALAVDMEGAAIAQVAHIFKIPFIIIRSISDLP----NNKDNHIDFNKFLKTSSINSSKMTKELIRLI. 236
19 -14.700d5cyfa_ c.56.2.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}  ali model 3D-neighbors follow..  10  14FHHFGFTTKSFDFKEKFGDVKFVCVCGS-IHNFAISMAKLAGL--------ALPVENIAGSHARFVLYKVDHILFAD------HGIGIPSTLILMHEVTKLGCKDVLFIRLGTSDGLGVKPGTIVLSDRCVNTKLEPYNELCILGK-----VRRQTKVDSNAVNELKKLSENLSLKCSVVVGGTITANDFEKLAFLQSVYDHGIRNMEMEGAAITSHCNLTGHRAILVCVTVVNRLETDEVTTSTDEFKLFEQLPGQLVGEYLKRNNGII. 288
20 -11.200d3eufa_ c.56.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19LYHFNLTTSRHNFPALFGDVKFVCVGGS-MKAFIRCVGAELGLDCPG------PNICAGTD--RYAMYKVGPVLSVS------HGMGIPSISIMLHELIKLSNVTIIRIGTSGGI--GLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKL---VQELLLCSAELSEFTTVVGNTMCTLD--YEGQGRLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLS... 293
21 -10.200d4prsa_ c.94.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}  ali model 3D-neighbors follow..  12  7..........................................................SRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKE---IARRLGVELKIVDMTFDGLIPSLLTKKIDVIISGMTITEERK-----------KVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTVAVQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAVVLVAKNPDLVISSGVLSSEQYGIAVRKEDTDLLEFINSVLRELK 213

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]