current user: public

If you have questions about the server, please let us know.

Query: [E] COG0019 Diaminopimelate decarboxylase, from VFDB

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .
# Score Template Links and tools%idFirst MTFERLGTMNVNAEGHLEIGGVDTLKLTEKYGTPLYVYDVALIRDRARGFKKTFEELGVKAQVAYASKAFSAVAIYQLMAEEGLSLDVVSGGELYTAIKANFPPERIHFHGNNKSAEEIHMALDYGIGCFVIDNYYEISLLEDILIERNEKAAVLIRVTPGIEAHTHDYILTGQDDSKFGFGLTNGQAEKAIKQVLHASASFDLIGLHCHIGSQIFETTGFKLAARRIMDKLVEWHGTLGFDSKVLNLGGGFGVRYTAEDEPLEPSEYVRQIMDEVRDVANSNDIAIPEIWIEPGRSLVGEAGTTLYKVGSRKEVPGIRNYIAVDGGMSDNIRPALYDAHYDAVLAANPEKVAEETVAIAGKCCESGDMLIWDLPLPKSDAGEILAVFCTGAYGYAMASNYNRIPRPPVVFVENGMDKLIVARETYENLVQNDLSLLast
1 -75.000d1hkva2 c.1.6.1 (A:46-310) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  39  1......................................DEDDFRSRCRETAAAFGS---GANVHYAAKAFLCSEVARWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHEDQKFGLSVASGAAMAAV-RRVFATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVGEKTAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVVEPGRAIAGPG...................................................................................................................................... 264
2 -72.300d1twia2 c.1.6.1 (A:50-313) Diaminopimelate decarboxylase LysA {Methanococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  32  1......................................SEEQIKINYNRYIEAFKRWEKEFIVAYAYKANANLAITRLLAKLGCGADVVSGGELYIAKLSNVPSKKIVFNGNCKTKEEIIMGIEANIRAFNVDSISELILINETAKELGETANVAFRINPNVNPKTHPKISTGLKKNKFGLDVESG-IAMKAIKMALEMEYVNVVGVHCHIGSQLTDISPFIEETRKVMDFVVEL-KEEGIEIEDVNLGGGLGIPYYKDKQIPTQKDLADAIINTMLKYKDKV--EMPNLILEPGRSLVATA...................................................................................................................................... 264
3 -68.100d1hkva1 b.49.2.3 (A:2-45,A:311-447) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  34  1.................................................................................................................................................................................................................................................................NELLHLAPNVWPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIXITLYEKDVDVSAT-AHRRYVSVDGGMSDNIRTALYGAQYDVRLVSRVSDAPPVPARLVGKHCESGDIIVRDTWVPDIRPGDLVAVAATGAYCYSLSSRYNMVGRPAVVAVHAGNARLVLRRETVDDLLSLEVR. 182
4 -64.800d1twia1 b.49.2.3 (A:15-49,A:314-448) Diaminopimelate decarboxylase LysA {Methanococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  34  2...........................................................................................................................................................................................................................................................................LGNDTVEIKDGRFFIDGYDAIELAEKFGTPLYVMXGYLLGKVHHIKETPV-TKWVMIDAGMNDMMRPAMYEAYHHIINCKV--KNEKEVVSIAGGLCESSDVFGRDRELDKVEVGDVLAIFDVGAYGISMANNYNARGRPRMVLTSKKGVFLIRERETYADLIAKDI.. 165
5 -59.800d1knwa2 c.1.6.1 (A:32-278) Diaminopimelate decarboxylase LysA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  25  1......................................DAQIIRRQIAALKQFD-------VVRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALAAGYNPDDIVFTADVIDQATLERVSELQI-PVNAGSVDMLDQLGQVSPG----HRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQR----HHLQLVGIHMHIGSGVDYAHLEQVCGAMV-----RQVIEFGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIARHLG-HPVKLEIEPGRFLVAQSG..................................................................................................................................... 247
6 -59.600d1knwa1 b.49.2.3 (A:2-31,A:279-420) Diaminopimelate decarboxylase LysA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  33  2........................................................................................................................................................................................................................................................................................HSLFSTDTDLTAENLLRLPAEFGVLITQVRSVKQMGS-RHFVLVDAGFNDLMRPAMYGSYHHISALAADGHAPTVETVVAGPLCESGDVFTQTRALPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLALEL.. 172
7 -49.900d7odca2 c.1.6.1 (A:44-283) Eukaryotic ornithine decarboxylase {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  23  1......................................DLGDILKKHLRWLKAL----PRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAH----------PKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLLLERAKEL----NIDVIGVSFHVGSGCTDPDTFVQAVSDARCVFDMA-TEVGFSMHLLDIGGGFPGSE---DTKLKFEEITSVINPALDKYFPSD--SGVRIIAEPGRYYVASA...................................................................................................................................... 240
8 -45.300d7odca1 b.49.2.3 (A:2-43,A:284-418) Eukaryotic ornithine decarboxylase (ODC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  13  1.........................................................................................................................................................................................................................................................SS----FTKDEFDCHILDEGFTAKDILDQK-----INEVSSSDDKDAFYVAXFTLAVNKTVWKEQPGSDDEDESNEQTFMYYVNDGVYGSFNCILQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRPMWQLMK.............. 178
9 -17.500d3llxa2 c.1.6.1 (A:19-256) D-serine dehydratase {Idiomarina loihiensis [TaxId: 283942]}  ali model 3D-neighbors follow..  12  1......................................DEAKLKSNINYLKQRVESLGSHLRPH--LKTLRTLEAAGYLLDSKSPATVSTLAEAEAYAKAGYTDLLYAVGIAPAKLKRVAALRQQGINHILLDNITQAQAVVDYAAEFGQDFSVFIEIDSDD--------------HRGGIKPSD-----SKLLTIAKTLGEHFTGLMTHAGNTEQGLKNFAKQECDAVRIARNNLETAGIHCAITSVGSTPTAHFGEDFSDIS---------------------------VRAGVYTTFDLVMKNIGVCDFSHIA........................................................................................................................ 238
10 -16.900d3anua2 c.1.6.1 (A:19-262) D-serine dehydratase {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  14  1.......................................RTTARRNAERMRERCRALGVRLRPH--VKTHKTLEGGLLATGGTRGIAVSTLAEARFFADGGFDDILLAYPVPTARLEECAGLARRLDAHVLLDRPEALASLRQRPLGHGKRWLVWLKLDCGN--------------GRAGVRPTDPAAELAQAIANDAPEEVTLVGVYAHCGSGADTIQAIARTTTNAVLSFVAALRQAGVPCPQASIGS-----------TPSCSHPIPEMSQLTE--------------LHPGNYIFYDLQQTQLGSCQPQDVA........................................................................................................................ 244
11 -14.200d1vfha2 c.1.6.1 (A:13-249) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]}  ali model 3D-neighbors follow..  11  1......................................DLDAVRANVRALRARAP----RSALMAVVKSNAAVPCARAAQEAGAALGTATPEEALELRAAGIQGRIMCWLWT--PGGPWREAIETDI-DVSVSGMWALDEVRAAARAAGRTARIQLKADTGL--------------GRNGCQPADWAELVGAAVAAQAEGTVQVTGVWSHFACADEPGHPSIRLQLDAFRDMLAYAEKEGVDPEVRHIANSPAT...................................................................................................................................................................................... 200
12 -11.200d1bd0a2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  13  1.....................................VDLDAIYDNVENLRRLLPD---DTHIMAVVKANADVQVARTALEAGASLAVAFLDEALALREKGIEAPILVLGAS--RPADAALAAQQRI-ALTVFRSDWLEEASA-LYSGPFPIHFHLKMDTGM--------------GRLGVKDEE--ETKRIVALIERHPHFVLEGLYTHFATADEVNTDY---FSYQYTRFLHMLEWLPSRPPLVHCANSAAS...................................................................................................................................................................................... 196
13 -10.500d1rcqa2 c.1.6.1 (A:8-233) Alanine racemase {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  17  1.....................................IDLQALRHNYRLAREA-----TGARALAVIKADAAVRCAEALAAEADGFAVACIEEGLELREAGIRQPILLLEGF--EASELELIVAHDF-WCVVHCAWQLEAIERAS--LARPLNVWLKMDSGM--------------HRVGFFPED---FRAAHERLRASGKVAKIVMMSHFSRA----ELDCPRTEEQLAAFSAASQGLEGEISLRNSPAVLGWPKVPSD------------------------------WVRPGILLYG........................................................................................................................................ 208

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]