| | | | | | . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 |
# |
Score |
Template |
Links and tools | %id | First |
MSKVELDKIDRKILEVLQSNGRLTNLEVAERVNLSPSPCLRRIRRLEESGVIRQYAALLDPGKIGLGLSAYINVRLEKQGGAPKGKAPSDIFRAAVATWPEVVTCYAMTGEMDYLLKVFVEDMDHFARFIRDQLLAHPAVIDVKSSFALERIKDTTALPVVV | Last |
1 | -42.500 | d2p5va2 d.58.4.0 (A:66-158) automated matches {Neisseria meningitidis [TaxId: 122586]} |
ali model 3D-neighbors follow.. |
50 | 1 | .................................................................LGLQAFIRVSIRKA------KDAREDFAASVRKWPEVLSCFALTGETDYLLQAFFTDMNAFSHFVLDTLLSHHGVQDAQSSFVLKEIKHTTSLPLN. |
90 |
2 | -39.100 | d2p5va1 a.4.5.0 (A:3-65) automated matches {Neisseria meningitidis [TaxId: 122586]} |
ali model 3D-neighbors follow.. |
63 | 1 | ..QLTLDKTDIKILQVLQENGRLTNVELSERVALSPSPCLRRLKQLEDAGIVRQYAALLSPESVN................................................................................................. |
63 |
3 | -36.800 | d2cg4a2 d.58.4.2 (A:67-152) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} |
ali model 3D-neighbors follow.. |
16 | 1 | ..................................................................DVGCFIGIILKSAKD-------YPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQHVLINKIQTIDEIQSTETLIVLQNPIMRTIKP... |
86 |
4 | -36.600 | d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} |
ali model 3D-neighbors follow.. |
39 | 1 | ...MKLDQIDLNIIEELKKDSRLSMRELGRKIKLSPPSVTERVRQLESFGIIKQYTLEVDQKKLGL................................................................................................ |
63 |
5 | -35.900 | d2pn6a2 d.58.4.0 (A:61-150) automated matches {Sulfolobus tokodaii [TaxId: 273063]} |
ali model 3D-neighbors follow.. |
13 | 1 | ...............................................................LDYIVITSVKAKYG--------KNYHVELGNKLAQIPGVWGVYFVLGDNDFIVMARYKTREEFMEKFLERVMSIPEVERTSTQVVVKIIKESPNIVI.. |
89 |
6 | -35.600 | d2pn6a1 a.4.5.0 (A:1-60) automated matches {Sulfolobus tokodaii [TaxId: 273063]} |
ali model 3D-neighbors follow.. |
33 | 1 | .....MDEIDLRILKILQYNAKYSLDEIAREIRIPKATLSYRIKKLEKDGVIKGYYAYINPASLN................................................................................................. |
60 |
7 | -35.300 | d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} |
ali model 3D-neighbors follow.. |
29 | 2 | ....LIDNLDRGILEALMGNARTAYAELAKQFGVSPETIHVRVEKMKQAGIITGARIDVSPKQLGY................................................................................................ |
63 |
8 | -32.000 | d2cyya2 d.58.4.2 (A:65-151) automated matches {Pyrococcus horikoshii [TaxId: 53953]} |
ali model 3D-neighbors follow.. |
25 | 1 | .................................................................YSMLAFILVKVKAGK--------YSEVASNLAKYPEIVEVYETTGDYDMVVKIRTKNSEELNNFL-DLIGSIPGVEGTHTMIVLKTHKETTELPIK. |
87 |
9 | -28.000 | d2cfxa2 d.58.4.2 (A:64-140) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} |
ali model 3D-neighbors follow.. |
17 | 2 | ...................................................................VSCIVEATVKNAD--------YERFKSYIQTLPNIEFCYRIAGAACYMLKINAESLEAVEDF----INKTSPYAQTVTHVIFSEIDTK....... |
77 |
10 | -27.000 | d1i1ga2 d.58.4.2 (A:62-141) LprA {Pyrococcus furiosus [TaxId: 2261]} |
ali model 3D-neighbors follow.. |
16 | 1 | .................................................................YSLVTITGVDTKPEK--------LFEVAEKLKEYDFVKELYLSSGDHMIMAVIWAKDGEDLAEIISNKIGKIEGVTKVCPAIILEKLK......... |
80 |
11 | -16.400 | d2htja1 a.4.5.73 (A:1-73) P fimbrial regulatory protein PapI {Escherichia coli [TaxId: 562]} |
ali model 3D-neighbors follow.. |
21 | 1 | ........MKNEILEFLNRHNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQR............................................................................................................ |
46 |
12 | -16.000 | d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]} |
ali model 3D-neighbors follow.. |
12 | 3 | VNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKM............................................................................................................ |
56 |
13 | -14.100 | d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} |
ali model 3D-neighbors follow.. |
20 | 34 | LKPYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRLNDKRNTYVQLT............................................................................................. |
102 |
14 | -13.700 | d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} |
ali model 3D-neighbors follow.. |
20 | 19 | .....ITDTDVAVLLKMEIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVR............................................................................................................ |
68 |
15 | -13.500 | d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} |
ali model 3D-neighbors follow.. |
25 | 11 | ...........KEAAEASNRAYLTSSKLADMLGISQQSASRIIIDLEKNGYITR............................................................................................................ |
53 |
16 | -13.500 | d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} |
ali model 3D-neighbors follow.. |
12 | 23 | LNQHGLTEQQWRVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKDQRRVYVNLT--DMEKNYQRIQERFGEEKLAQLLELLNELKKI............................................................ |
134 |
17 | -13.400 | d3bjaa1 a.4.5.0 (A:1-138) automated matches {Bacillus cereus [TaxId: 222523]} |
ali model 3D-neighbors follow.. |
15 | 25 | IEQYDISYVQFGVIQVLAKSGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPNDQRETLVYLT............................................................................................. |
93 |
18 | -13.300 | d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} |
ali model 3D-neighbors follow.. |
28 | 28 | MEKQGVTPAQLFVLASLKKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLT............................................................................................. |
96 |
19 | -13.300 | d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} |
ali model 3D-neighbors follow.. |
15 | 27 | KPEVDMTIKEFILLTYLQQENTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISIS............................................................................................. |
97 |
20 | -13.200 | d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Pyrococcus horikoshii [TaxId: 53953]} |
ali model 3D-neighbors follow.. |
14 | 15 | ......NPVRLGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEIT----------------DFGMEEAKRFLSSLKAVID.......................................................... |
96 |
21 | -13.200 | d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} |
ali model 3D-neighbors follow.. |
16 | 1 | ...MKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGV............................................................................................................... |
48 |
22 | -13.100 | d2bv6a1 a.4.5.28 (A:6-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} |
ali model 3D-neighbors follow.. |
15 | 26 | FKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLT............................................................................................. |
94 |
23 | -13.000 | d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} |
ali model 3D-neighbors follow.. |
15 | 26 | KKHLTLSFVEFTILAIIQNKNIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMD............................................................................................. |
96 |
24 | -13.000 | d4hbla1 a.4.5.0 (A:1-145) automated matches {Staphylococcus epidermidis [TaxId: 176279]} |
ali model 3D-neighbors follow.. |
15 | 31 | LKQFGITYSQYLVMLTLWEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLT............................................................................................. |
99 |
25 | -13.000 | d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} |
ali model 3D-neighbors follow.. |
15 | 23 | LRDFGITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVIT............................................................................................. |
91 |
26 | -13.000 | d4gxoa1 a.4.5.0 (A:7-141) automated matches {Staphylococcus aureus [TaxId: 426430]} |
ali model 3D-neighbors follow.. |
15 | 25 | LKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDERNLQISLT............................................................................................. |
93 |
27 | -13.000 | d2b0la1 a.4.5.66 (A:167-257) GTP-sensing transcriptional pleiotropic repressor CodY, C-terminal domain {Bacillus subtilis [TaxId: 1423]} |
ali model 3D-neighbors follow.. |
32 | 13 | LSYSELEAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIE............................................................................................................. |
65 |
28 | -13.000 | d1sfxa1 a.4.5.50 (A:1-106) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} |
ali model 3D-neighbors follow.. |
24 | 12 | LEKLSFKPSDVRIYSLLLERGGMRVSEIARELDLSARFVRDRLKVLLKRGFVR............................................................................................................. |
64 |
29 | -12.900 | d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} |
ali model 3D-neighbors follow.. |
14 | 25 | KKKFNLNYEEIYILNHILESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDERTVIVYVT............................................................................................. |
95 |
30 | -12.900 | d3e6ma_ a.4.5.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]} |
ali model 3D-neighbors follow.. |
18 | 36 | LASEKLPTPKLRLLSSLSAYGELTVGQLATLGVMEQSTTSRTVDQLVDEGLAARSISDADQRKRGKKKLAEISPLINDFHAELVGNVDPDKLQTCIEVLGEILK.......................................................... |
146 |
31 | -12.800 | d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} |
ali model 3D-neighbors follow.. |
18 | 26 | LDKLNITYPQYLALLLLWEHETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLT............................................................................................. |
94 |
32 | -12.700 | d2heoa_ a.4.5.19 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} |
ali model 3D-neighbors follow.. |
18 | 1 | ......DNLEQKILQVLSDDGGVAIFQLVKKCQVPKKTLNQVLYRLKKEDRVSS............................................................................................................ |
49 |
33 | -12.700 | d2frha2 a.4.5.28 (A:102-224) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} |
ali model 3D-neighbors follow.. |
5 | 26 | KKEFSISFEEFAVLTYINKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVN............................................................................................. |
96 |
34 | -12.600 | d1xmka1 a.4.5.19 (A:294-366) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
18 | 1 | ...LDMAEIKEKICDYLFNVSDSSALNLAKNIGLKARDINAVLIDMERQGDVY............................................................................................................. |
51 |
35 | -12.400 | d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} |
ali model 3D-neighbors follow.. |
15 | 27 | LSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLT............................................................................................. |
95 |
36 | -12.300 | d3bpva_ a.4.5.0 (A:) automated matches {Methanobacterium thermoautotrophicum [TaxId: 145262]} |
ali model 3D-neighbors follow.. |
16 | 22 | LGHLNLTDAQVACLLRIHREPGIKQDELATFFHVDKGTIARTLRRLEESGFIEREQDPENRRRYILEVT-------------RRGEEIIPLILKVEERWEDLLFRDFTEDERKLFRKMCRRLAEEAVRM................................. |
137 |
37 | -12.200 | d2fa5a_ a.4.5.0 (A:) automated matches {Xanthomonas campestris [TaxId: 339]} |
ali model 3D-neighbors follow.. |
22 | 32 | .DRYGMAIPEWRVITILALYPGSSASEVSDRTAMDKVAVSRAVARLLERGFIRRETHGDDRRRSMLALS............................................................................................. |
99 |
38 | -12.200 | d4awxb1 a.4.5.62 (B:1-79) automated matches {Klebsiella pneumoniae [TaxId: 573]} |
ali model 3D-neighbors follow.. |
15 | 5 | ..........MEVRDMLALQGRMEAKQLSARLQTPQPLIDAMLERMEAMGKVVR............................................................................................................ |
48 |
39 | -12.200 | d1qbja_ a.4.5.19 (A:) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
18 | 11 | ..........LKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQK............................................................................................................ |
54 |
40 | -12.200 | d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} |
ali model 3D-neighbors follow.. |
14 | 25 | EEISDMKTTELYAFLYVALFGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLT............................................................................................. |
93 |
41 | -12.200 | d2obpa1 a.4.5.71 (A:12-92) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]} |
ali model 3D-neighbors follow.. |
22 | 2 | .....IDPAIVEVLLVLREAGIWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHASLT............................................................................................... |
69 |
42 | -12.100 | d3cjna_ a.4.5.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 246200]} |
ali model 3D-neighbors follow.. |
17 | 31 | MTALGLSTAKMRALAILSAKDGLPIGTLGIFAVVEQSTLSRALDGLQADGLVRREVDSDDQRSSRVYLT............................................................................................. |
99 |
43 | -12.100 | d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} |
ali model 3D-neighbors follow.. |
21 | 30 | ......DENRAKITYALCQDEELCVCDIANILGVTIANASHHLRTLYKQGVVN............................................................................................................. |
76 |
44 | -12.000 | d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} |
ali model 3D-neighbors follow.. |
18 | 22 | FKELSLTRGQYLYLVRVCENPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYAT............................................................................................. |
90 |
45 | -12.000 | d5eria1 a.4.5.0 (A:22-168) automated matches {Peptoclostridium difficile [TaxId: 1496]} |
ali model 3D-neighbors follow.. |
14 | 27 | YKELKLQKGQFTFLTRICENPGINLVELSNMLKVDKATTTKAIQKLIKAGYVDKKQDKFDKRGYNLTPT............................................................................................. |
95 |
46 | -11.800 | d3mexa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} |
ali model 3D-neighbors follow.. |
18 | 30 | CQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLT............................................................................................. |
98 |
47 | -11.600 | d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Methanococcus jannaschii [TaxId: 2190]} |
ali model 3D-neighbors follow.. |
15 | 19 | AKIHGLNKSVGAVYAIL-SDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIKGERKN-------YYEAVDGFSSIKDIAKRKHDLIAKTYEDLKKLEE--KCNEEEKEFIKQKIKGIERMKKISEKILEAL......................... |
147 |
48 | -11.200 | d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} |
ali model 3D-neighbors follow.. |
28 | 18 | ......EDTRRKILKLLR-NKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVE............................................................................................................. |
63 |
49 | -11.100 | d1on2a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} |
ali model 3D-neighbors follow.. |
13 | 1 | .TTPSMEMYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLI............................................................................................................. |
52 |
50 | -11.000 | d5dd8a_ a.4.5.28 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]} |
ali model 3D-neighbors follow.. |
21 | 55 | YAASGLNAAGWDLLLTLYRSAGLRPTELSALAAISGPSTSNRIVRLLEKGLIERREDERDRRSASIRLT............................................................................................. |
126 |
51 | -10.700 | d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} |
ali model 3D-neighbors follow.. |
14 | 11 | ............VYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIH............................................................................................................. |
51 |
52 | -10.700 | d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} |
ali model 3D-neighbors follow.. |
15 | 22 | AKKYDLTGTQMTIIDYLNKNKEVLQRDLESEFSIKSSTATVLLQRMEIKKLLYRKVSGKDSRQKCLKLT............................................................................................. |
92 |
53 | -10.700 | d2dtra1 a.4.5.24 (A:4-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} |
ali model 3D-neighbors follow.. |
20 | 4 | ....TTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVV............................................................................................................. |
52 |
54 | -10.600 | d1y0ua1 a.4.5.5 (A:1-87) Putative arsenical resistance operon repressor AF0168 {Archaeoglobus fulgidus [TaxId: 2234]} |
ali model 3D-neighbors follow.. |
23 | 28 | ......NPVRRKILRMLDKG--RSEEEIMQTLSLSKKQLDYHLKVLEAGFCIER............................................................................................................ |
73 |
55 | -10.600 | d1xnpa_ a.4.5.64 (A:) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} |
ali model 3D-neighbors follow.. |
26 | 14 | ......NETRRRILFLL-TKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIE............................................................................................................. |
59 |
56 | -10.500 | d1oyia_ a.4.5.19 (A:) dsRNA-binding protein E3 (E3L) {Vaccinia virus [TaxId: 10245]} |
ali model 3D-neighbors follow.. |
12 | 1 | ......RSNAEIVCEAIKTIGIATAAQLTRQLNMEKREVNKALYDLQRSAMVYS............................................................................................................ |
50 |
57 | -10.500 | d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} |
ali model 3D-neighbors follow.. |
23 | 31 | ....PVQFSQLVVLGAIDRGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLS............................................................................................. |
96 |
58 | -10.500 | d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} |
ali model 3D-neighbors follow.. |
17 | 1 | MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGY............................................................................................................... |
51 |
59 | -10.400 | d2jsca_ a.4.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} |
ali model 3D-neighbors follow.. |
21 | 10 | ......DPTRCRILVALL-DGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVV............................................................................................................. |
55 |
60 | -10.300 | d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} |
ali model 3D-neighbors follow.. |
11 | 3 | RTTRVAGILRDAIIDTFRPGARLSEPDICAALDVSRNTVREAFQILIEDRLVA............................................................................................................. |
56 |
61 | -10.200 | d3jw4a_ a.4.5.0 (A:) automated matches {Clostridium acetobutylicum [TaxId: 1488]} |
ali model 3D-neighbors follow.. |
10 | 23 | LAELGLNSQQGRMIGYIYENQEIIQKDLAQFFGRRGASITSMLQGLEKKGYIERRIPENNARQKNIYVL............................................................................................. |
93 |
62 | -10.200 | d5ffxa_ a.4.5.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} |
ali model 3D-neighbors follow.. |
15 | 23 | LEQFDITNEQKHTLGYLHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLT--IFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ.......................................................... |
138 |
63 | -9.860 | d4aiha_ a.4.5.28 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]} |
ali model 3D-neighbors follow.. |
17 | 23 | LKPLELTQTHWVTLYNINRLPPQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTSANDRRAKRIKLT............................................................................................. |
92 |
64 | -9.780 | d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} |
ali model 3D-neighbors follow.. |
16 | 21 | LSHLGLSQARWLVLLHLARHRDPTQRELAQSVGVEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLT--IAASVRNDVLTGIDESEQALCQQVLLRILANLE.......................................................... |
135 |
65 | -9.560 | d1tbxa1 a.4.5.48 (A:3-93) Hypothetical protein F93 {Sulfolobus virus-like particle SSV1 [TaxId: 244589]} |
ali model 3D-neighbors follow.. |
19 | 11 | ............VLAYLYDNEGIATYDLYKKVNMSTATFYDAKKFLIQEGFVKE............................................................................................................ |
56 |
66 | -9.440 | d3k2za1 a.4.5.0 (A:3-71) automated matches {Thermotoga maritima [TaxId: 2336]} |
ali model 3D-neighbors follow.. |
26 | 1 | ....DLTERQRKVLLFIEEFIE-SVREIARRFRITPRGALLHLIALEKKGYIER............................................................................................................ |
55 |
67 | -9.370 | d3cuqa2 a.4.5.0 (A:176-252) automated matches {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
17 | 1 | .....LNMDHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLA.............................................................................................................. |
47 |
68 | -9.300 | d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} |
ali model 3D-neighbors follow.. |
19 | 22 | ......DPNRLRLLSLLA-RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVS............................................................................................................. |
67 |
69 | -9.250 | d1jmrb3 a.4.5.33 (B:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} |
ali model 3D-neighbors follow.. |
30 | 9 | ...........EILDFIKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLR............................................................................................................ |
52 |
70 | -9.230 | d1u5ta2 a.4.5.54 (A:165-232) Vacuolar sorting protein SNF8 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]} |
ali model 3D-neighbors follow.. |
14 | 1 | .....LTSDQTKILEICSILGYSSISLLKANLGWEAVRSKSALDEMVANGLL.............................................................................................................. |
47 |
71 | -9.190 | d3gw2a_ a.4.5.0 (A:) automated matches {Mycobacterium bovis [TaxId: 233413]} |
ali model 3D-neighbors follow.. |
15 | 18 | ......NGRRLQILDLL-AQGERAVEAIATATGMNLTTASANLQALKSGGLVE............................................................................................................. |
63 |
72 | -9.130 | d2dk5a1 a.4.5.85 (A:8-85) DNA-directed RNA polymerase III subunit RPC6, RPO3F {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
15 | 10 | ....GSDNQEKLVYQIIEDAGNIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKK................................................................................................... |
70 |
73 | -9.040 | d2p8ta1 a.4.5.72 (A:14-82) Hypothetical protein PH0730 {Pyrococcus horikoshii [TaxId: 53953]} |
ali model 3D-neighbors follow.. |
19 | 8 | ............LAVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIR............................................................................................................. |
48 |
74 | -9.020 | d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} |
ali model 3D-neighbors follow.. |
15 | 4 | .......DLKSKIIRFFEKTFKVKMDDLARCLDDTRLNISKTLNELQDNGLIRKEILIPDAQKL.................................................................................................. |
72 |
75 | -9.010 | d2lkpa_ a.4.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} |
ali model 3D-neighbors follow.. |
26 | 31 | ......TPSRLMILTQLR-NGPLPVTDLAEAIGMEQSAVSHQLRVLRNLGLVV............................................................................................................. |
76 |