current user: public

If you have questions about the server, please let us know.

Query: [H] KOG1370 S-adenosylhomocysteine hydrolase, from VFDB

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MSDKLPYKVAAWGRKALDIAENKMPGLMRIWERYSASKPLNGARIPGCLHRTVETAVLMSLITLGTEVQWSSCNIFSTQDHAAAAIAKAGISASTGIPVLPLPRLACLEGRNRRGVPVTGDLTNLIHSEYSQLLLSFRGISKETTIGVHNLYKMMVNGILKVPAIDVNDSATKSKFDNLYGCGIKQATDVMIAGKVAVVAGYGDKGKSCAQALRGFRASVIITKTDPIKALQAAMEGYEVTTMDEACQEGDVFVTTTGCVDIILGQHFEQTKDDTIVCNTGYFDVEMDVKWLNKNTVEKVNVKLQVDPYRLKNGRGIILLAEGRLVNLACAMGHPSFVRSNSFTSQVMAQIKLWTHPDKYPVGVHFLPKKLDESVAEAHLGKLNMKLTKLTEKQAQYLGMSCYCPFKPDHYRYLast
1 -56.300d1li4a2 c.23.12.3 (A:3-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  50  5.YKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSCNIFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTGVHNLYKMMANGILKVPAINVNDSVTKSKFXHPSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSC............................................................................................................................................................................. 257
2 -46.300d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  84  1................................................................................................................................................................................DNLYGCRIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCAMG................................................................................ 163
3 -16.900d4ypoa1 c.2.1.0 (A:1-180) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  20  7..........................................................................................................................................................................................ADLSIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVRVGLKQGSRSRPVEEQGLDVDTPAEVAKWADVVMVLAPDTEIFAGDIEPNLKPGDALFFGHGLNVHFG............................................................................................................................. 112
4 -14.400d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Pyrobaculum aerophilum [TaxId: 13773]}  ali model 3D-neighbors follow..  16  12...................................................................................................................................................................LLAPYKRIIQYGEKMKRGDYGRDVEIPLIQGEKVAVLGLGEIGTRVGKILAALGAQVRGFSRTP-----KEGPWRFTNSLEEALREARAAVCALHTRGLVKYQHLALMAEDAVFVNVGRAEV-LDRDGVLRILKERPQFIFASDVWWGRN.................................................................................................... 159
5 -13.900d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  12  13...................................................................................................................................................................LLLLLRGVPEANAKAHRGVNKLAAGSFEARGKKLGIIGYGHIGTQLGILAESLGMYVYFYDIEN----LPLGNATQVQHLSDLLNMSDVVSLNPSTKNMMGAKEISLMKPGSLLINASRGTV-VDIPALADALASKHLAGAAIDVFP....................................................................................................... 160
6 -13.900d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]}  ali model 3D-neighbors follow..  10  1....................................................................................................................................................................ISVAEHVVEWARKGGWNIADCVSHAYDLEAMHVGTVAAGRIGLAVLRRLAPFDVHLHYTDRHRLPESVEKELNLTWHATREDMYPVCDVVTHPETEHMINDETLKLFKRGAYIVNTARGKL-CDRDAVARALESGRLAGYAGDVWF....................................................................................................... 164
7 -13.700d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  17  13...................................................................................................................................................................LLAASRQIPAADASLREHTKRSSFSGTEIFGKTVGVVGLGRIGQLVAQRIAAFGAYVVAYDP--VSPARAAQLGIELLSLDDLLARADFISVTPETAGLIDKEALAKTKPGVIIVNAARGGL-VDEAALADAITGGHVRAAGLDVFATEPCTDSPLFELAQVV....................................................................................... 178
8 -13.500d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]}  ali model 3D-neighbors follow..  17  47...............................................................................................................................................................................................IRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLNEHNHHLINDFTVKQMRQGAFLVNTARGGL-VDEKALAQALKEGRIRGAALDVHE....................................................................................................... 168
9 -13.500d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]}  ali model 3D-neighbors follow..  20  36..........................................................................................................................................................................................TIGREVRDQVVGVVGTGHIGQVFMQIMEGFGAKVITYD--IFRNPELEKKGYYVDSLDDLYKQADVISLVPANVHMINDESIAKMKQDVVIVNVSRGPL-VDTDAVIRGLDSGKIFGYAMDVYE....................................................................................................... 160
10 -13.500d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]}  ali model 3D-neighbors follow..  12  41...........................................................................................................................................................................................VGEKLDNKTLGIYGFGSIGQALAKRAQGFDMDIDYFDTHRASSDEASYQATFHDSLDSLLSVSQFFSLNAETRYFFNKATIKSLPQGAIVVNTARGDL-VDNELVVAALEAGRLAYAGFDVFAGEPNINEGYYDLPNTF....................................................................................... 183
11 -12.900d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  14  1..................................................................................................................................................................PCTPLA---IVKILEFLKIYNNLLPEGNRLYGKKCIVINRSEVGRPLAALLANDGATVYSVDVNNIQKFTRGES-YSEDLLKKCSLDSDVVITGVPSENYKFPTEY--IKEGAVCINFACTKNFSD............................................................................................................................. 134
12 -12.600d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  5...........................................................................................................................................................................................TALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVYIVPEIEAIATDMLIQLEEEGLNVVPCAR................................................................................................................................... 105
13 -12.500d1saya1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]}  ali model 3D-neighbors follow..  15  19....................................................................................................................................................................................GRGVLLGGVPGVKPGKVVILGGGVVGTEAAKMAVGLGAQVQIFDINVERLSYLETLF-NSAEIETAVAEADLLIGAVRAPILVPASLVEQMRTGSVIVDVA.................................................................................................................................... 132
14 -12.500d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. PCC 6803 [TaxId: 1148]}  ali model 3D-neighbors follow..  17  2...................................................................................................................................................................................................KIGVVGLGLIGASLAGDLRRRGHYLIGVSRQQSTCEKAVERQLEAGQDLSLLQTAKIIFLCTPIQLILPEKLIPHLSPTAIVTDVASVKTAI.............................................................................................................................. 97
15 -12.300d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}  ali model 3D-neighbors follow..  14  25...............................................................................................................................................................................................LDGLTVLVQGLGAVGGSLASLAAEAGAQLLVADTDTERVAHAVALGHTAVALEDVLSTPCDVFAPCAMGGVITTEVARTLDCSVVAGAANN................................................................................................................................... 115
16 -12.300d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  13  10...............................................................................................................................................................................................LRDRDCLIVGGGDVAERKARLLLEAGARLTVNALTFIPQFTVWANEGMLTLVEGPFDETLLLAIAATDDDTVNQRVSDAAESRRIFCNVVDAPKAASF............................................................................................................................ 111
17 -11.600d3fr7a1 c.2.1.0 (A:86-307) automated matches {Oryza sativa [TaxId: 39947]}  ali model 3D-neighbors follow..  18  37..............................................................................................................................................................................................FKGIKQIGVIGWGSQGPAQAQNLRDSLAEAKSLRKGSKSFDEARAAGFTLGDIWETVSGSDLVLLLIAAQADNYEKIFSHMKPNSILGLSHGFLLGH.............................................................................................................................. 147
18 -11.500d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Methanobacterium thermoautotrophicum [TaxId: 145262]}  ali model 3D-neighbors follow..  14  2...................................................................................................................................................................................................RVGFIGFGEVAQTLASRLRSRGVEVVTSLEGRSPSTIERARTVGVTETEEDVYSCPVVISAVTPGVALGAARRAGRHVRGIYVDINNISPET-VRMASSLIEKGGFVDAAIMGSVRRKGADIRIIASG.......................................................................................... 129
19 -11.100d2x5oa1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 668369]}  ali model 3D-neighbors follow..  10  3...............................................................................................................................................................................................YQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLDKLP-RHTGSLNDEWLMAADLIVASPGIALAHPSLSAAADAGIEIVG...................................................................................................................................... 93
20 -10.900d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  3......................................................................................................................................................FEEGALIEPLSVGIHACRRGGVT-------------------LGHKVLVCGAGPIGMVTLLVAKAMGAQVVVTDLSATRLSKAKEIGADARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVD----GVFRYCNTWPVAISMLASKS......................................................................................... 169
21 -10.400d3vpxa2 c.2.1.0 (A:145-363) automated matches {Sporosarcina psychrophila [TaxId: 1476]}  ali model 3D-neighbors follow..  20  27...............................................................................................................................................................................................LAGKTVAVQGVGNVAYALCEYLHEEGAKLIITDINEEAVQRAVAFGATAVGINEIYSQEADIFAPCALGAIINDETIPQLKAKVIAGSANN................................................................................................................................... 118
22 -10.400d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}  ali model 3D-neighbors follow..  15  27...............................................................................................................................................................................................VPPARVLVFGVGVAGLQAIATAKRLGAVVMATDVRAATKEQVESLG-QAEAVLKELVKTDIAITTAPAPVLITEEMVTKMKPGSVIIDLA.................................................................................................................................... 151
23 -10.300d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  16  1...................................................................................................................................................................................................VLNFVGTGTLTRFFLECLKDRYEIGYILSRSIDRARNAEVYGGKAATLEKHPELNGVVFVIVPDRYIKTVANHLNLGDAVLVHCSGFLSSEI.............................................................................................................................. 93
24 -10.300d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  15  11..................................................................................................................................................................................................KIVIVGGYGKLGGLFARYLRASGYPISILDREDWAVAE------------SILANADVVIVSVPINLTTIERLKPYLTENMLLADLTSVKREP.............................................................................................................................. 93
25 -10.200d4dlla1 c.2.1.0 (A:29-190) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  11  2................................................................................................................................................................................................YARKITFLGTGSMGLPMARRLCEAGYALQVWNRTPARAASLAALGATIHEQRAAARDADIVVSMLENGAVVQD--AAAMKPGSLFLDMASITPREARDHAARLGALGIAHTPVSGGTVGAEQGTLVIMAGGKPADF..................................................................................... 145
26 -9.970d4cjxa2 c.2.1.0 (A:125-297) automated matches {Trypanosoma brucei [TaxId: 999953]}  ali model 3D-neighbors follow..  24  29.......................................................................................................................................................................................LLRCSGVEICGKRVVVLGRGDAGLPVATLLANEDATVTVVHSAT-----------PLCDIADIVRASDIVVSAAGQPGLVRGE---WIKLGAAVIDVGTTPVA............................................................................................................................... 118
27 -9.840d4e12a1 c.2.1.0 (A:1-189) automated matches {Acinetobacter baylyi [TaxId: 202950]}  ali model 3D-neighbors follow..  12  5..................................................................................................................................................................................................TNVTVLGTGVLGSQIAFQTAFHGFAVTAYDINTDALDAAKKR---SDDLAQAVKDADLVIEAVPESLDLKRDIYTKLPAKTIFATNSST.................................................................................................................................. 123
28 -9.830d2uyya1 c.2.1.0 (A:262-429) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  1............................................................................................................................................................................................SITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTAEVVSTCDITFACVSDPKAAKD--LQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFAPVSGNQQLSNDGMLVILAAGDRGLY..................................................................................... 149
29 -9.750d2gqwa2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}  ali model 3D-neighbors follow..  13  3................................................................................................................................................................TLQGATMPVHTLRTLED------ARRIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSRAAPATLADFVARYHAAQGVDLRFERSVTGSVLLDDGTRIAADMVVVGIG.................................................................................................................................... 121
30 -9.510d3g0oa1 c.2.1.0 (A:6-169) automated matches {Salmonella typhimurium [TaxId: 602]}  ali model 3D-neighbors follow..  12  1.................................................................................................................................................................................................DFHVGIVGLGSMGMGAARSCLRAGLSTWGADLNPQACANLLAEG-AAASAREFAGVVDALVILVVNAAQVRQ--AHLMKPGSAVMVSST----ISSADAQEIAAALTALNLNMLDAPVSGGAEMTVMASGSEAAF..................................................................................... 145
31 -9.500d2gf2a1 c.2.1.0 (A:41-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  1...................................................................................................................................................................................................PVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSADVAEKADRIITMLPTSINAIE--LKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFAPVSGGVGAARSGNLTFMVGGVEDEF..................................................................................... 142
32 -9.490d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  13  22.......................................................................................................................................................................................ADRIKESIENSGEAIIIGGGFIGLELAGNLAEAGYHVKLIHRGA-----------MFLGLDEELSNMIKDMLEETGVKFFLNSELLEANEEGVLTNSGFIEGKVKICAI......................................................................................................................... 119
33 -9.460d4b4ua2 c.2.1.0 (A:122-282) automated matches {Acinetobacter baumannii [TaxId: 575584]}  ali model 3D-neighbors follow..  22  27.......................................................................................................................................................................................ILKENNIEIAGKHAVVVGRSALGKPMAMMLLQANATVTICHS-------------RTQNLPELVKQADIIVGAVGKAELIQKD---WIKQGAVVVDAGFHPRDIQLQGIEEIASAYTPVPGGVGPMTI...................................................................................................... 145
34 -9.360d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  16  2..................................................................................................................................................................................................QNVLIVGVGFMGGSFAKSLRRSGFKIYGYDINPESISKAVDLGITTSIAKVEDFSPDFVMLSSRTFREIAKKLSYILSEDATVTDQGSVKGKL.............................................................................................................................. 102
35 -9.360d5je8a1 c.2.1.0 (A:1-163) automated matches {Bacillus cereus [TaxId: 226900]}  ali model 3D-neighbors follow..  13  2..................................................................................................................................................................................................KKIGFIGLGNMGLPMSKNLVKSGYTVYGVDLNKEAEASFEKEGGIIGSISKLAETCDVVFTSLPSPRAVEA--FENGHSNVVFIDTSTVSPQLNKQLEEAAKEKKVDFAPVSGGVIGAENRTLTFMVGGSKDVY..................................................................................... 144
36 -9.300d3ws7a1 c.2.1.0 (A:1-161) automated matches {Pyrobaculum calidifontis [TaxId: 410359]}  ali model 3D-neighbors follow..  12  2...................................................................................................................................................................................................RVGFIGLGIMGGPMATHLLKAGFLAAVYNRTREKTKPFAEAGVYVAESADLAKRVDVVIVMVSDAPDVEQ--VEGARPGLIVVDMSTNSPDWARKFAERLAQYGIEFAPVTGGQKGAIEGTLTIMVGGKEELF..................................................................................... 143
37 -9.300d2v6ba1 c.2.1.0 (A:22-164) automated matches {Deinococcus radiodurans [TaxId: 1299]}  ali model 3D-neighbors follow..  14  2...................................................................................................................................................................................................KVGVVGTGFVGSTAAFALRGSCSELVLVDRDEDRAQAEAED---WHGGHSELADAQVVILTAGANQKPGESRLDLLEKNAIFRELVPQITRAAPDAVLLVTSNPVDLLTDLATQLAPGQP---VIGSG.......................................................................................... 139
38 -9.290d4m1qa1 c.2.1.0 (A:3-144) automated matches {Bacillus selenitireducens [TaxId: 439292]}  ali model 3D-neighbors follow..  17  2................................................................................................................................................................................................KTSRVVIIGTGAVGSSYAFSMQNVTDEMVLIDLDKRKTEGDAMD---WAGDYGDCKSADIVVITAGAAQKPGETRLDLVEKNANIFK...................................................................................................................................... 100
39 -9.290d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]}  ali model 3D-neighbors follow..  17  2..................................................................................................................................................................................................KTYAVLGLGNGGHAFAAYLALKGQSVLAWDIDAQRIKEIQDRG--TSDIGLAVKDADVILIVAIHHASIAANIASYISEGQLIILNPG................................................................................................................................... 107
40 -9.080d2hmta_ c.2.1.9 (A:) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  13  2..................................................................................................................................................................................................KQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATIRNFEYVIVAIGAASTLTTLLLKELDIPNIWVKAQNYYHH............................................................................................................................... 105
41 -9.030d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]}  ali model 3D-neighbors follow..  13  2................................................................................................................................................................................................ANDNVVIVGTGLAGVEVAFGLRASGWEGNIRLVGDAAYLAGKATAESLYLRTPDAYAAQNIQLLGGDRQQVILSDGRALDYDRLVLATGGRPXLIPNCELASAAGLQVDNGIVINEHMQTSDPLIMAVGD........................................................................................... 151
42 -9.030d2g1ua_ c.2.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  20  5..................................................................................................................................................................................................KYIVIFGCGRLGSLIANLASSSGHSVVVVDKNEYAFHRLNSDAAEFETLKECGMEKADMVFAFTNDDSTN..................................................................................................................................................... 83
43 -9.000d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Fungus (Magnaporthe grisea) [TaxId: 148305]}  ali model 3D-neighbors follow..  13  1................................................................................................................................................................................................ATKSVLMLGSGFVTRPTLDVLTDSGIKVTVACRTLESASTPISLDVNDDAALDAEVAKHDLVISLIPYTFHATVIKSAIRQKKHVVTTSYVSPAM.............................................................................................................................. 104

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.