current user: public
If you have questions about the server, please let us know.

Query: [J] KOG1762 60s acidic ribosomal protein P1, from VFDB

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MASLSELAYIYSALILHNDKINALIKAAGVNVEPFWPGVFAKALANVSIGNPICNVRAGGLAAAGDPTPSTAAASVEKKVEAKKEESEESDEDMGFGLFDLast
1 -6.690d1pkha_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Methanococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  11  1.............MILSDKDIIDYVTSKRIIIKPFNKDFVGPCSYDVTLGDEFIIYDDEVYDLSKELNYKRIKIKNSILVCPLNYNLTEE.......... 77
2 -6.270d4xjca_ b.85.4.0 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}  ali model 3D-neighbors follow..  15  1.............MILSGKTISEKLTEKELEITPLTEEQIQPASVDLRLGPHF............................................... 40
3 -5.930d2qxxa_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  15  1.............MLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLF............................................... 40
4 -5.480d2hgsa4 d.142.1.6 (A:3-201,A:304-474) Eukaryotic glutathione synthetase ATP-binding domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  9  304....................................ENCLLRPGSPARVVQCISELGI--GVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLD 366
5 -5.120d3bl2a_ f.1.4.1 (A:) Bcl-2 homolog V-bcl-2 {Murid herpesvirus 4 [TaxId: 33708]}  ali model 3D-neighbors follow..  17  17VSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADYGPALKNRDLSKLFTSL............................................ 74
6 -5.000d3hjea2 b.71.1.0 (A:642-704) automated matches {Sulfolobus tokodaii [TaxId: 273063]}  ali model 3D-neighbors follow..  10  14..............FMRGDKVLVIVKTLNRDYDIEIDGEYTDVITDETVRGRV............................................... 52
7 -4.890d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  12  54AEVLAPLGVNVTGIHRVADPLAAIEKAEIIIVGGGNTFQLLKESRERGLLAPMADRVKRGALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDL.... 149
8 -4.530d3f0pa1 a.4.5.79 (A:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  27...................................................LLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDIGYGL.. 76
9 -4.410d2a6aa2 c.55.1.9 (A:104-193) Hypothetical protein TM0874 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  23  15.........HYCAVYLKDKGLNPLKEPSVVSDEELEEIT............................................................. 44
10 -4.360d2lxxa_ d.109.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  18  2..........................ASGVKVDPSCKNAYDLLHNKHQHSYIIFKIDKNDTAIVVEKVGEKNAPYAEFVEEMKKLVEDGKE----YAAVD 73
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 7 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.