| | | | | | . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . 170 . 180 . 190 . 200 |
| # |
Score |
Template |
Links and tools | %id | First |
MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES | Last |
| 1 | -5.510 | d2hhpa1 a.160.1.1 (A:202-351) Poly(A) polymerase, PAP, middle domain {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]} |
ali model 3D-neighbors follow.. |
7 | 111 | .ATHNITESTKKVILQEFVRGVQITNDIFSNKKSWANLFE.................................................................................................................................................................. |
149 |
| 2 | -5.040 | d1fjgm_ a.156.1.1 (M:) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} |
ali model 3D-neighbors follow.. |
22 | 95 | LPVRGQRTRTNARTR---KGPRKTVAGKKKAPRK........................................................................................................................................................................ |
125 |
| 3 | -4.920 | d1v88a1 b.55.1.1 (A:8-124) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
23 | 7 | .....................LKIRGTLKSWTKLWCVLKPGVLLIYK........................................................................................................................................................... |
32 |
| 4 | -4.850 | d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} |
ali model 3D-neighbors follow.. |
22 | 11 | ....................LLKLGGRVKTWKRRWFILTDNCLYYFE........................................................................................................................................................... |
37 |
| 5 | -4.810 | d3l51b1 d.215.1.0 (B:595-752) automated matches {Mouse (Mus musculus) [TaxId: 10090]} |
ali model 3D-neighbors follow.. |
8 | 1 | ..GKVLDAIIQEKKSGRIPGIYGRLGDLGAIDEKYDIAISSCCHALDYIVVDSIDTAQE............................................................................................................................................... |
57 |
| 6 | -4.770 | d1dm9a_ d.66.1.3 (A:) Heat shock protein 15 kD {Escherichia coli [TaxId: 562]} |
ali model 3D-neighbors follow.. |
23 | 2 | ..AVEVRLDTRALAREMIEGGKVHYNGQRSKPSKIVELNA.................................................................................................................................................................. |
49 |
| 7 | -4.760 | d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} |
ali model 3D-neighbors follow.. |
30 | 52 | ......EIDSLKRYKDDVREVAQGYE................................................................................................................................................................................ |
71 |
| 8 | -4.740 | d1qqha_ b.91.1.1 (A:) E2 regulatory, transactivation domain {Human papillomavirus type 18 [TaxId: 333761]} |
ali model 3D-neighbors follow.. |
20 | 1 | ..........KSKAHKAIE-ALQGLAQSAYKTEDW-TLQDTCEELWNTEP........................................................................................................................................................ |
41 |
| 9 | -4.610 | d2nn6c1 d.14.1.4 (C:7-187) Exosome complex exonuclease RRP43 {Human (Homo sapiens) [TaxId: 9606]} |
ali model 3D-neighbors follow.. |
11 | 11 | FLKENCRPD--GRELGEFRTTTVNIGSISTADSALVKLGNTTVICGVKAEFAAPSTDAPDK............................................................................................................................................. |
70 |
| 10 | -4.570 | d2wp8b1 d.14.1.0 (B:3-152) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]} |
ali model 3D-neighbors follow.. |
11 | 5 | YSPEGLRLD--GRRWNELRRFESSINTHPH--SSYMEQGNNKIITLVKGPKEPRLKSQMDTS............................................................................................................................................ |
66 |