current user: public

If you have questions about the server, please let us know.

Query: [F] COG0026 Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360
# Score Template Links and tools%idFirst MTKNVMAKTNNLTIGIIGGGQLGRMLAMAAARLNHRTIVLEPQADCPAAQVCNDQIVAEYDDEKALAELASRCDVVTYEFENVPVAAAEKLSASVPVYPPAQALSASQDRLTEKRFLNGCGIPTADFRAVDSQDELEAALTAFGGKGVLKTRRMGYDGKGQRLFRGGENLTGAFAALGGVPLILESFVAFEREISIIAARFQDGTVTCYDPAENVHLNGILHTSTVPAALSDAAKAVAVQSAEKLLAALEYVGVIGIEFFVLPDGSLVANEMAPRVHNTGHWTEAACAISQFEQHIRAVSDLAPGSTDRHSDCVMTNLIGDDINDVPAWLSKKDCLVHLYGKTEARPGRKMGHVTELLHTGKALast
1 -125.000[F] COG0026 Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase)  ali  100  1MTKNVMAKTNNLTIGIIGGGQLGRMLAMAAARLNHRTIVLEPQADCPAAQVCNDQIVAEYDDEKALAELASRCDVVTYEFENVPVAAAEKLSASVPVYPPAQALSASQDRLTEKRFLNGCGIPTADFRAVDSQDELEAALTAFGGKGVLKTRRMGYDGKGQRLFRGGENLTGAFAALGGVPLILESFVAFEREISIIAARFQDGTVTCYDPAENVHLNGILHTSTVPAALSDAAKAVAVQSAEKLLAALEYVGVIGIEFFVLPDGSLVANEMAPRVHNTGHWTEAACAISQFEQHIRAVSDLAPGSTDRHSDCVMTNLIGDDINDVPAWLSKKDCLVHLYGKTEARPGRKMGHVTELLHTGKA 363
2 -88.000[F] COG0027 Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase)  ali follow..  26  2TTIGTPLTPKATKVMMLGSGELGKEVVIELQRLGVEVIAVDRYANAPAQQVAHRAYTISMLDGEALKALVEKPDYIVPEVEAIATATLVELEQAFTVIPTAKATQLTMNREGIRRLAEELGLPTSNYQFVDNFDDFKRAVEKIGIPCVVKPIM-SSSGHGQSILKSVEQIPSAWEYAGAGRVIVEGFVKFDYEITLLTVRHVHGTSFLAP-IGHIQIDGDYRESWQPQAMSAVALEKAQAIAEKITGALGGRGIFGVEMFVCGDE-VIFNEVSPRPHDTGMVTLISQELSEFALHARAILGLPIPDITLISPSASKAIVVEGFGQLAEVLAEPHTNLRLFGKGEVDGHRRMGVILARDISVEK 377
3 -77.300[F] KOG2835 Phosphoribosylamidoimidazole-succinocarboxamide synthase  ali follow..  33  1........MDSRTVGILGGGQLGRMIVEAANRLNIKTVILDA-ENSPAKQISNDHVNGSFSNPLDIEKLAEKCDVLTIEIEHVDVPTLKNLQVKLKIYPSPETIRLIQDKYIQKEHLIKNGIAVTQSVPVEQASSLLNVGRDLGFPFVLKSRTLAYDGRGNFVVKNKEMIPEALEVLKDRPLYAEKWAPFTKELAVMIVRSVNGLVFSYPIVETIHKDNICDLCYAPARVPDSVQLKAKLLAENAIKSFPGCGIFGVEMFYLETGELLINEIAPRPHNSGHYTIDACVTSQFEAHLRSILDLPMPKNFITTNAIMLNVLGDKHTKCERALATPGSSVYLYGK-ESRPNRKVGHINIIASSMAE 371
4 -43.500[I] COG0439 Biotin carboxylase  ali follow..  16  3...........KKILIANRGEIALRVIRTAREMGIQTVVVYSTADEKSLPVADESVCVSYLNIPNILSAALMTGAYGFMAENPDFAEMCREHGIVFIGPTPESMRALGSKAGGREIAAQSNVPTVPGTGLESVDAALLAAKQIGYPVLLKASAGG-GGRGQKVIRTQEELEEARLYFGDPAIIMEKFLEEFRHIEVQVMGDGQGHVIHIERDCSIQRRNQKLIEEAPSTLPESLRQEILAAGVRLAQFVNYAGAGTLEFIMDRDGNYYFMEMNTRIQVEHCVSEMISSLDLVRLQIEIAAGLGLNIQQDDVKLHGHAIECRINAEDPDKDFRPAAGKIDDAHFAGGAGVRVDTHVYSGYSIPP 378
5 -37.600[I] COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit  ali follow..  19  2...........KKVLIANRGEIAVRIIRACRDYGLQSVAVYADPDQDALFVADEAYALTYLDISKLIAIAKRAGAYGFLSERAEFAQAVIDAGLIWIGPDPDVIEALGDKVMARRIATGVGAPLVAGSDVSSAAEVTAFAEQHGLPVAIKAAHGG-GGRGLKVAWKMEEIREATVAFGRGECFLERFLDRPRHIEAQVIADKHGNVLVLTRDCSLQRRNQKLIEEAPAPLSDEQRQKIHDAAKAICAAAGYSGAGTVEFLLGVDGTISFLEVNTRLQVEHPVTEETTGIDLVIEQFRIAEGHKLRTPEPRGHSMEFRINAED......................................... 341
6 -34.200[IE] KOG0238 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit  ali follow..  14  40.VGIDYNEPKFDKILIANRGEIACRVIKTARAMGIKTVAVHSDVDSNSLHVADEAVCVSYLRADRILQAVEDTGAYGFLSENTKFAAELEKAGAKFIGPNSKAILDMGDKIHSKKIATAARVSMIPGYDIADEDMCVKVSRDIGYPVMIKASAGG-GGKGMRVAWNDKQAQEAASSFGDDRMLVEKFIDNPRHIEMQVLCDKHGNALWNERECSIQRRNQKVIEEAPSSVPPEMRRKMGEQAVQLAKAVGYDSAGTVEFLVDSQRNFYFLEMNTRLQVEHPITECITGIDIVQQMLRVSYGHPLPITQEQVPLNGWAFESRVYAEDPYGLPSVG-RLSRYVEPKHVDGVRCDSGIREGSEISI 429
7 -32.600[R] COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase  ali follow..  14  1.......MSKMEEILVIGVN--TRPVVESAFRLGYRVYSAGYYCTADFKHYTERRCILRERSGESCGRFHENFSASDFIERADGIIPLTGAPPLPGE--GNSRVDHVEDKYRLYRRIRN-SYPTPETHLISDPAEAMEIVAAGEKKYIAKPV-SGAGGFGVTEFREGDG-----------EFLLQEYIE--VPVSASVLST-GEDAITVLTSRQIIDRGVPGFEVYAGNMTPGPSGEIEDLASDLILDLSLRGSNGVDLIMRDSELYVI-EVNPRIQGTFECAEASLGINMVDAHIRACMGELIEKPDPVSYAVKRILYAPARCRVGEIKTMGVHDLPVPGT-IIEEGEPLLTVLASHNSMEA 348
8 -31.900[C] COG1038 Pyruvate carboxylase  ali follow..  18  15.LACGETVLKISKILVANRSEIAIRVFRAANELGIKTVAIWAEEDKLSLHRADESYQVSYLSIEEVIRVAKLSGAYGLLSESPEFVEACNKAGITFIGPTPDTMRQLGNKVAARNLAISVDVPVVPATNPDDIAEVERMAEEIGYPVMLKASWGG-GGRGMRAIRKKEDLREAKAAFGKDEVYLEKLVERARHVESQILGDTHGNVVHFERDCSIQRRNQKVVERAPAPLSEAQRQELAAYSLKIAAATNYIGAGTVEYLMDADGKFYFIEVNPRIQVEHTVTEVVTGIDIVKAQIHILEGAAIGTAE....................................................... 355
9 -31.000[EF] COG0458 Carbamoylphosphate synthase large subunit (split gene in MJ)  ali follow..  13  8...........QKIMVIGSGPIGTQACLSLKEEGYEVVLVNSNPATIMTEIADKVYIEPIT-LEFVTRILEGPDALLPTLMELSKNGILDELGVELLGTKLSAIDQAEDRDLFKQLMEELEQPIPESEIVNTVEEAVAFAATIGYPVIVRPA--TLGGTGGGMCANEKELENGLKLSPVTQCLIERSIAGFKEIEYEVMRDSADNALVVCNMENFDPVGI-SIVFAPAQMSDYENQMLRDASLSIIRALKIEGGCNVQLALDNSFKYYVIEVNPRVSRSSALASKATGYPIAKLAAKIAVGLTLDEVINPVTGSTYAMFEPALDYVV--AKIPRFPFDKFEKGERRLGTQMGEVMAIGRNIEE 391
10 -25.800[R] COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily)  ali follow..  13  1...........MKLFLFEFATCGERIEDSTAVEGFKSAFDGFKNYYEITGFVRPEFSCLFTLPDSMEKYLEKSDIIAPEDDFLLYTLTKKAEKYCENGSSSRAIAVTSDKWELYKKLRG-EVQVPQ-----------TSLRPLDCKFIIKP-RTACAGEGIGFSDEVPD-----------GHIAQEFIE--INLSVSLAVGEDVKCLS--VNEQIINNFRYAGAVVPARISDEVKREVVEEAVRAVECVEGLGYVGVDIVY--SDQPYVIEINARLTTPVVAFSRAYGASVADLLAGGEVKHVRRQMVRKSKSAEKPYV............................................ 291
11 -23.000[R] COG1759 ATP-utilizing enzymes of ATP-grasp superfamily (probably carboligases)  ali follow..  13  17...........DKITIGVIGS-ALDIADGAKEEGLPTLVVRKTRDGLVKGFIDEVIVLDKFAIEIQEELRKRNVIFVPNRSFVVYTGIDRVENEFLVTRSLLRTEERSEEKSYYWLLEKAKLPYPEPVSPEEIDD------VGLVIVKLPH-AKKRLERGFFTAASYKEFKEKSEKLIRAKARIERYII-RFETSLDGHVRLPAAQQLTLPEWQFEPEYT-VCGHASSTLRESLLEKVFDMAEKYVEATGIIGPFTLQTAVDKDLNFYIYDVAPRTGGGTNIHMAM............................................................................. 343
12 -22.800[M] COG1181 D-alanine-D-alanine ligase and related ATP-grasp enzymes  ali follow..  16  2............KIAVLYGGT-GKGIMEALKANGHEVIGIDFHPDDLDVDLVFIGLHGRLGEDGKVQALLDLLNI--------------------YVGTGVQGSALAMDKAKAKLFFEKAGIRVAEEVVLHSFTDANAFNFTGTYPVVVKPNQEGST--GLTVAETEEELLQGIEEA-DDTILIEEFIA--TEVTVAVLGN-KGEERSLPVVEIVPKNKLYDYEIVPARISEEHTAYVQQAAVRAHQALGCDVYSRVDFIVPNDGDPVILKVN---------TLPGMTPTSLYPDAAKGVGMSYEE......................................................... 293
13 -21.100[R] COG3919 Predicted ATP-grasp enzyme  ali follow..  14  1........MTIPGVVIIGGAHGTLALARSLGVLNVPVYYLTHDSPLPGSRFVRETIRWAGPHDDGAMAFLREMAELLVPSGDGEVQLVSQHREELSILPEWTNLQWLCEKPLLYKRAAELGVSIPRTYALTSAADIDGL--DVMFPVILKPHMGSIARAKVIRADDREELKAAFVDASGDNVVVQELIP-GESQFSYAALWLNGEPIAEFTARRARQYPV-DFGYTSTRVEVVDNRQAIEAARKILKSAGHSGLVEVEFKLDRDGALKLLDVNPRPWSWFGLCS-AAGINLGGLLWRVANDMPTGQAVIARQGTSWSYLVRDAVAAFTLARRGEARLGDYLAS.................... 354
14 -15.700[F] COG0151 Phosphoribosylamine-glycine ligase  ali follow..  17  1...........MNILIIGNGGREHALAWKAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFAQDIGLTIVGPEAPLVIGVVDAAGLKIFGPAKAAAQLEGSKAFTKDFLARHKIPTAEYQNFTEVEPALTYLREKGTPIVVKA-DGLAAGKGVIVAMTLQEAEDAVRDMAGSRVVIEEFLD--EEASFIVMVDGK-NVEPMASSQDHKRGGMGAYSPAPVITPEIHSRIMKEVIYPTVNGMVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIMLRLKSDLVELCLKACDGKLDEVISQRASLGIVLAAEGYPKDYRKSAVKNEKVFLAGVAEVTNGGRVLCVTALGESVFE 395
15 -14.000[F] KOG0237 Glycinamide ribonucleotide synthetase (GARS)/Aminoimidazole ribonucleotide synthetase (AIRS)  ali follow..  17  1........MEPIIALLIGNGTIAWKLCESPLISKVYVAPGNGGTASNGAESKMENVNIGVCDFEQLVKFALDVNLVIPGPELPLVEGIEGHVGIPCFGPSALAARMEGSKVFSKDFMHRNNIPTAVYKSFSNYDHAKSFLDTCTFDVVIKA-DGLAAGKGVIIPKTKKEAFEALESIAGKNVVIEELLE--EELSILTFSDGY-TCRSLPPAQDHKRGGMGCYAPTPVASPKLLETVQSTIIQPTIDGMPLVGILFTGLMLTPSGPRVL-EYNVRFGDPETQAVLPLLESDLAEIILACVNHRLDAIDIV..................................................... 330
16 -12.800[HJ] COG0189 Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase)  ali follow..  15  17....RHYRRGFMRIAFFGPTFATGLLAMAALNRGHDVVYLTPGD-RSDDTLAVHATVIRKGKYKKPEAFHAALQDKALERITMDVEEIDALQRGVVVLNDPEGLALAQNKLY---FQSFPEIVRPTTLISRNVEEIRAFADTHPKGVIVKPLQ-GSGGKNVFKIGSSKETNLNQIFELEGYLIAQAYLP-EGDVRFFMMNGR-MRDGQYAALRRVPAKGDLRSNIHANGTAEKVTDEIVELAEMMRPKLVEDGMFLVGLDIVGDKILEVNVFSPNILELTNVDFSDTIIEAVETKVSM................................................................. 355

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.