current user: public

If you have questions about the server, please let us know.

Query: [L] COG0164 Ribonuclease HII, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MSETFIYPQANLIAGVDEVGRGPLVGAVVTAAVILDPNRPIVGLADSKKLSEKRRLSLYDEITEKALSWSLGRAEPEEIDQLNILHATMLAMQRAVSGLHIVPDYVLIDGNRCPKLQMPSLAVVKGDSRVAEISAASILAKVTRDREMTELDLLFPEYGFAQHKGYPTAFHLEKLAALGATVHHRRSFGPVKRVLGLVLast
1 -114.000[L] COG0164 Ribonuclease HII  ali  100  1MSETFIYPQANLIAGVDEVGRGPLVGAVVTAAVILDPNRPIVGLADSKKLSEKRRLSLYDEITEKALSWSLGRAEPEEIDQLNILHATMLAMQRAVSGLHIVPDYVLIDGNRCPKLQMPSLAVVKGDSRVAEISAASILAKVTRDREMTELDLLFPEYGFAQHKGYPTAFHLEKLAALGATVHHRRSFGPVKRVLGLV 198
2 -71.400[L] KOG2299 Ribonuclease HI  ali follow..  23  11KTWNNFGNGIPCVLGIDEAGRGPVLGPMVYAAAISPLDQNVEGVDDSKALNEAKREEIFNKMNEQIIAYALRCLSPELISCSMLKRQKYSLNEVSHEAANVNVVEIKVDTVGPKATGISICVTEKADSLFPIVSAASIAAKVTRDSRLRNWQFREKNIKVGYGSGYPGDPNTKKFLQFGFCSLVRSSWKTASTIVE.. 244
3 -55.400[L] COG1039 Ribonuclease HIII  ali follow..  16  67.IAQVVPQKQTNLIGTDEVGNGSYFGGLMVTASFVSEENLNFGVADSKKLTDEKICQIAPKLIDRI-PHVALVVEPAKYNEVNAVSIKVALHNQAIYLLGHKPENIVIDAFTTEAPLTKVTLLTKAEDQFLAVAVSSIISRYLFLENLKKL---SKESGFTLPSGAGNKIAAQIIKSQGVDALNKLHFANTQKAIKI. 289
4 -6.850[R] COG4639 Predicted kinase  ali follow..  10  1MKITIPELSLVVLIGASGAGKSTFARKHFQPFEVISSDFCRGLVSNDENSQSASRDAF--DVLHYITTKRLAAGKLTVIDATNVQPEDRKTLLQMAKQYHCFTVAIVFD----------ELCHERNQQRSDRQFGSHVVRRHTQ--MLRRSLRSLEKEGFRY.................................... 151
5 -6.680[G] COG3839 ABC-type sugar transport systems, ATPase components  ali follow..  16  48.........LNTIAGLEPITSGDIIAMVFQSYALYPNMTVAGNIAFGMEIRKVPKPERDKAIQQVADMLQIGHLLDRKPSQLSGGQRRRVAMGRALVR---NPQVFLFD-EPLSNLDAKLRVDMRTEIKRLHSRMKTTIVYVTHDQI................................................... 197
6 -6.590[R] KOG4417 Predicted endonuclease  ali follow..  11  52.......EILKYVGGVD-MSFCKEDSSVACACLVVLELPSLRVVHHDFSLLRLHVPYVPGFLAFREAPVLLQILQKMRDEKHPFYPQVSVLSISCFISCFALAKVLMVDGN--------------GILHPRGFGLACHLGVLAH----------LPTIGVGKN................................... 182
7 -6.520[C] COG0427 Acetyl-CoA hydrolase  ali follow..  11  294............TFDLIDAGKLRFASGSSITLSPRRNADVFGNLERYKDKLVLRPQEISNHPEVVRRLGIIGINTALEFDIYGNVNSTHVGGTKMMNGIGGSGDFARNAHLAIFVTK----SIAKGGNISSVVPMVSHVDHTEHD-----VDILVTEQGLADLRGLAPRERARVIIENCVHPSYQAPLL......... 461
8 -6.320[NU] COG2874 Predicted ATPases involved in biogenesis of archaeal flagella  ali follow..  12  21............NGEIDKRLGG-IEGENDTGKSVLCQQFVYGGLMSGHNIAYYTTENTIKSFLRQMESLSLDVSDFYAWGYLRVFPVHLEGIDWSTEQMTIRENIAIIDSLTMFTTYSTEDDVLEFLTRLKNLCDNGKTILITLH..................................................... 173
9 -6.210[E] COG3842 ABC-type spermidine/putrescine transport systems, ATPase components  ali follow..  16  47.........LRMLGGFEQPSSGEIVNIVFQDYALFPHLNVGRNIAFGLELKGLSSDAIHKRTMELLALVKLQDFADRMPDQLSGGQRQRVALMRA---LAPDPNVLLLD-EPLSALDAKLRQQMQIELKTIQRTTGKTFIFVTHDQ.................................................... 195
10 -6.110[V] COG1401 GTPase subunit of restriction endonuclease  ali follow..  16  436.QESVSEKRQNYVLIIDEINRGNISGELITL------------IETSKRAGEP--EALSVILPYSSSSFSV--NNLYLIGTMNTADRSLTALRRRFEFEAMLPDITVLKETVVKGIDL---------PRLLQTLNDRIEVLYDREHTL---HAFFIPVVQVKEDEDLAFERLKRIMRNKVLPLLEEYFQKIRMVLG.. 615

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.