current user: public

If you have questions about the server, please let us know.

Query: [P] COG0226 ABC-type phosphate transport system, periplasmic component, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390
# Score Template Links and tools%idFirst MLSYIKRIKNNRIPVSITVLTLAMSLAACGGQQGSDNTATQDGSSGTAKDATASSPAKLDLGGNVSLTGAGASFPAPLYASWFTDLNKKYPNLQINYQSVGSGAGVEQFIQGTVDFGASDVAMKDEEIQKVQRGVLLLPVTAGGIVLAYNLPGVTELNLPRVVYTDILLGKIKTWDAPEIKAANPNVNLPSQPITVVYRSDGSGTTGVFTKHLAAVSPEWKSKVGEGKSVSWPVGVGGKGNEGVTAQIKQTQGAIGYIEYGYAKQNNISYATLENKAGKFVKYNDESASQTLAAIQLPENLRAFVPDPDGDGSYPIVSFSWIMAYKNYPDPVKAKAMEAAIEYALTEGQKISGELGYIPLPQAVVQKTATVADQISPEYKISVSGSGTSASKLast
1 -114.000[P] COG0226 ABC-type phosphate transport system, periplasmic component  ali  100  1MLSYIKRIKNNRIPVSITVLTLAMSLAACGGQQGSDNTATQDGSSGTAKDATASSPAKLDLGGNVSLTGAGASFPAPLYASWFTDLNKKYPNLQINYQSVGSGAGVEQFIQGTVDFGASDVAMKDEEIQKVQRGVLLLPVTAGGIVLAYNLPGVTELNLPRVVYTDILLGKIKTWDAPEIKAANPNVNLPSQPITVVYRSDGSGTTGVFTKHLAAVSPEWKSKVGEGKSVSWPVGVGGKGNEGVTAQIKQTQGAIGYIEYGYAKQNNISYATLENKAGKFVKYNDESASQTLAAIQLPENLRAFVPDPDGDGSYPIVSFSWIMAYKNYPDPVKAKAMEAAIEYALTEGQKISGELGYIPLPQAVVQKTATVADQISPEYKISVSGSGTSASK 392
2 -16.600[H] COG2998 ABC-type tungstate transport system, permease component  ali follow..  15  1MEFTMKKT-------TFTLAAASLILVSYSASSADDAR---------------------------RLATTTSTYDSGLLDYLLPKFEQDT-GYKVDVIATGTGKALKMGENGDVDLVMTHAPKAEASFVEAGFGVLPRKLMYNDFVVV-DPAKIADEKNIAKVFENIAKSGAV----------------------FISRGDDSGTH----------------------------------ELGIWAQNKIEPNFGGYRSIGQGMGPTLNMASEMQAYTLTDRGTWLAYNNKLALKILFEG------DEQLFNPYQV-----IIVNPERYPTTQYHAAKVFSDWLVNKGQQLINEFKFVANADK............................. 274
3 -15.200[P] COG1613 ABC-type sulfate transport system, periplasmic component  ali follow..  13  1.......MSSNSLAGIVKLALVVGSLQLGSIGLALADT---------------------------TILNVSYDPTRELYKEFNAAFAEKWQTVTIQTSHGGSGKQARSVIDGEADVVTLALEADIDAIAKESG---NSAPYTSTIVFLVRKGNPK---------------AIKDWGD---------LVREDVQVIT--KTSGGARWNFLAAWAWARAANNGDDAKAAQLFKHVPVLDTGARGATTTFVQRGLGDVL---LAWENEAYLSLEELGPDNFDIVTPSISIKAEP------------------------------ALVDGNVDSKGTRKVAEAYLDYLYSVGQKIAAKHYYRPFKPELAD.......................... 298
4 -14.200[P] COG4150 ABC-type sulfate transport system, periplasmic component  ali follow..  11  1....MKQNSVKKNARNGLTHIALFSALILSGVTASAT----------------------------ELLNSSYDVSRELFTALNPGFQAQGDKLTIKQSHAGSSKQALAILQGKADVVTYNQITDVQILHDRG----NSSPFYSTMAFLVRKGNPK---------------NIRNWDD---------LVREDVKLVF--KTSGNGRYTYLATQLADGGDEAKTRDWMKRFLKNVEVFDTGGRGATTTFVERGLGDVLIS---FESEVNNIRKEYGSDQYEVIVPPVDILAE-----------------------FPVA-----WVDKNVEKNGTEKAAKAYLNYLYSPAQQVITRFNYRVYDKAAMEAAKSQFPDTK................ 311
5 -10.900[P] COG1840 ABC-type Fe3+ transport system, periplasmic component  ali follow..  11  7VRRLIQTQTMEEIMRLTIISSLLLAGTTLLGVPAHAAGD--------------------------------CAADVVICEQMKGDFEKTH-DIKVNMVRMSSGEAYAKIRAEKTDLWWAGLEYKSKMLDQLQDWAKNVGVYAGALGWGYNTDIFKKKGYKEP----------KCWADLLAPELKGEIQIAN--------PNSSGTAYTALASLVQIMGEDQA-----KKLNGNISQYTKSGSAPVKAAARGETAVGIVFMHDATAEGFPVKSVAPCEGTGYEIGSMSIVK---------------------------------------GARNLENAKTWYDWALQDVQSRMKDAKSFQLPSNKTAEIPKEAPRFEDIKLINYDFKTYGDPE 342
6 -10.100[P] COG0715 ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components  ali follow..  11  1MTEFFNQFSRRKFIFTAGASASAVFLKGCLGNPPETTGGTQSAPTAQPAANVSAEQAPEVTTV--KLGYIPIVESAPLIIAKEKGFFAKYGLTNVELSKQASWGSADNVEIGSAGGGIDGGQWQMPMPHLITEGLITKGNQKIPMYVLCQLITHGNGIAIANKHQG--SGIGLRLASAKSLFSKLKASPTPFTAAQTFP--AVNQDFWIRYWLAA----------GGIDPDADVKLLTVPSAQTVANMKT-----GTMD-AFSTGDPWPFRIVKDKVGFMAALTAE--------------------------IWKNHPEEYLAMRSDWVD-QHPKATKALLKGLMEELAEIVAARAYFNVPVDVLIDPYM...................... 334
7 -9.790[N] COG5567 Predicted small periplasmic lipoprotein  ali follow..  10  1.........MKNVFKTLAVLLTLFSLTGCGLKGPLYFPPADKNAPPPTKKVDSQTQSTMPDKNDRATGDGPSQ............................................................................................................................................................................................................................................................................................................................... 64
8 -9.610[R] COG4588 Accessory colonization factor AcfC, contains ABC-type periplasmic domain  ali follow..  10  5.................................................ITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEK-TGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVKPLYFREAIILTQKGNPL---------------KIKGLKD-----------LANKKVRIVVP-EGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVY-------------------------------RTFNVI---------AKEGASKETQDFIAYLSSEAKEIFKKYGW................................... 248
9 -9.560[S] COG4808 Uncharacterized protein conserved in bacteria  ali follow..  14  1MEFYMKAFN--KLFSLVVASVLVFSLAGCGDKEESKSANLNGTEIAITYVYKGDKVLKQSSETKIQFASIGATTKEDAAKTLEPLSAKYKNIAGVEEKLTYTDTYAQENV--TIDMEKVD................................................................................................................................................................................................................................................................................ 118
10 -9.260[G] COG1653 ABC-type sugar transport system, periplasmic component  ali follow..  10  1.........MFNNSIHKVSICIALTLTFSANAMAVTE----------------------------PFWHSMEGELGKEVDSIADRFNQSQPDYKIVPVYKGNYEQSLAAGIAAFRSGKAPKPVYQ-YTDSKTGRLLSQPFNSSTPVLYYNKEAFKKAGLDPEQ---------KTWQE-----------LAADTAKLRAAGSSCGYASGWQGWIQIENFSAWHGQSRNNGFDGTDAVLEFNKPLQVKHIQLLSDMNKKGDFTYFGRKDESTSKFYNGDCAITTASSGSLASIRHYAKFNFGVGMMPYDADAKNA-IIGGASLWVM--DGKDKETYKGVAEFLQYLVKPEIAAHQKTGYLPITTAAYEL......................... 358

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.