current user: public

If you have questions about the server, please let us know.

Query: [H] COG0237 Dephospho-CoA kinase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MTLVIGLTGGIASGKSTVANMLIEKGITVIDADIIAKQAVEKGMPAYRQIIDEFGEDILLSNGDIDRKKLGALVFTNEQKRLALNAIVHPAVRQEMLNRRDEAVANREAFVVLDIPLLFESKLESLVDKIIVVSVTKELQLERLMKRNQLTEEEAVSRIRSQMPLEEKTARADQVIDNSGTLEETKRQLDEIMNSWALast
1 -97.900[H] COG0237 Dephospho-CoA kinase  ali  100  1MTLVIGLTGGIASGKSTVANMLIEKGITVIDADIIAKQAVEKGMPAYRQIIDEFGEDILLSNGDIDRKKLGALVFTNEQKRLALNAIVHPAVRQEMLNRRDEAVANREAFVVLDIPLLFESKLESLVDKIIVVSVTKELQLERLMKRNQLTEEEAVSRIRSQMPLEEKTARADQVIDNSGTLEETKRQLDEIMNSWA 197
2 -84.000[H] KOG3220 Similar to bacterial dephospho-CoA kinase  ali follow..  41  1.MFIVAVTGGIATGKSTISKVFERQGIPVIDADKIAREIVEPGQPCWRQIREVFGDEVLLPSKEINRAVLGKMIFEDKELRGKLNKITHPTIHRKIFWQVCKLLVTGHAWIVLDLPLLFETGLMDFIHKIVCVTCDSDKQLERLIARNELSESEARHRVDSQMPLDKKCEKSHFVIDNNGSVEEAESSAMSIYNLM. 196
3 -17.400[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  18  128..RLVGLAGPPGAGKSTVANEV---------VRRVNKLWPQKAASFDAEVNPPDVAIVLPMDGHLYRSQLDAMTFDPALLLNCLKKLKNPSFDHGVGDPVEDDIFLQHKVVIVE--ILLEEGISDMFDEKWFIDVNLDTAMQRVENRHGKPPDVAKWRVDYN--IIKSKTNADLLIRSM.................. 331
4 -16.600[F] COG0572 Uridine kinase  ali follow..  18  8.CVIIGIAGASASGKSLIASTLYREHIGVIPEDGYYKDQSHLSMEERVKTNYDHPSAM---DHNLLLEHLQALKAGKPVELPLYSYTEH-------TRKKETVHLEPKKVIILEILLLTDIRLRQEMNFSIFVDTPLDICLMRRMKRDVNERGRSMDSVMAQYQKTVRKQYADIIVPRGGKNRIAIDILKAKISQF. 211
5 -15.600[F] COG1102 Cytidylate kinase  ali follow..  17  5.CLVITVSGLAGSGTTTLCRNLAKYGFKHVYAGLIFRQMAKERGMSLEEFQKY------------------------AELHPEIDREVDRRQVEAAKECNVVIEGRLAGWMVKNADL-------------IWLDAPIRVRAERVAKREGISVEEAFMKIAEREMQNRKLSIYDLIIDTSKSPEGVFAIVKAAIDHL. 177
6 -15.600[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  14  5.TIIVGVSGASCSGKSTLCQLLHAIGSSLVHEDDFYKT---------AEIPVKNGIADWDCQESLNLDAFLENLLRNRENKNVAPEALIEYADIIKEFKAPAIPTLEQHLVFVDGFMMYNEDLINAFDIRLMLVTDFDTLKRRREARTGYITLEG.......................................... 165
7 -15.000[C] COG3954 Phosphoribulokinase  ali follow..  13  6..PVIAVTGSSGAGTTTTSLAFRKIHAAEVEGDSFHRYTRPEMDMAIRKARDAGRHISYFGPEANDFSLLEHTFIEYGQTGKGQSRKYLHTYDEAVPWNQVPGTFTPWQPLPEPTDVLFYEGLHRHVDLLVGVVPIVNLEWIQKLIRDGHSREAVMDSVVRSMDDYINFSRTHINFQRVPTVDTSNPFAAKGIPS.. 224
8 -14.800[H] COG1072 Panthothenate kinase  ali follow..  17  81..YIISIAGSVAVGKSTTARVLQAL-VELITTDGFLHPNQVLKE---RGLMKKKG-----FPESYDMHRLVKFV---SDLKSGVPNVTAPVYSHLIYDVIPDGDKVQPDILILEGLNVLQVFVSDFVDFSIYVDAPEDLLQTWYINRAKLTKEEAIKTAMTLWKILPTRERASLILTKSANHAVEEVRLRK...... 308
9 -14.700[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  15  25...LILLNGGSSAGKTSLALAFQDL-WMHIGIDLFWFALPPEQLDL-----ARVRPEYYTWDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMN---------VIADDVIWTREWLVDALRVFVGVHVSDEEGARRELERG----DRHPGWNRGSARAAHADAEYDFELDTTAPVHELARELHESYQA.. 209
10 -13.900[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  19  1..MLIAITGTPGVGKTTVAKLLAKLNYEYVSLKDFALE-----KGCGRRVNDEVEVEIDELAYFIERELKGKNAVLDGHLSHLMP-----------------------------------------VDLVVVLRAHPKLIGERLRERGKIGENVEAELVDAVLIEAIEEHENVIEVDTTNSPEDVVEEIVSLINS.. 153
11 -13.700[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  19  2LLPNILLTGTPGVGKTTLGKELASSGLKYINVGDLARE---------EQLYDGYDEE-------------YDCPILDEDR------------------VVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGKLTDNIQCEIFQVLYEEATASYKEEIVHQPSNKPEELENNVDQILKWIE 164
12 -13.700[TZ] KOG4203 Armadillo/beta-Catenin/plakoglobin  ali follow..  14  65.LILVGLAGPSGAGKTIFTEKILNFSIAIINMDNYNDG-------------TRVIDGNFDDPRLTDYDTLLDNI----HGLRDGKPVQVPIFKSSSRIGYRTLEVPSSRIVILEGIYALSEKLRPLLDLRVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQI-IEPDLKTAQIKILNKFN................ 241
13 -13.500[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  14  16..TMIVIVGPSGAGKDTLMDYAAAQLSGRPGFHFTRRVITRSCDAG--------GENHDAVSMHEFNQLEDAGAFAVSWQAHGLKYGIPAAVYRHL---------EAGDVVIANGSRSALPHFGTAFSRLKVVNIVARPDVRRLEQRGRESRDDILRRL-ERSSLAVAGDFDVTTVDNSGAIEDAGKTIMQVLQQ.. 192
14 -13.500[R] COG0645 Predicted kinase  ali follow..  14  3LAVTHGVSA---VGKSQVAMRLVELGAVRLRSDIERKRLFGEQPEH-------------------DRGQFAAGIYSSQASEATYAHLH----------QLAAKILQAGYPVVIDAAYLKQNQRQAACHLILDCQAPEAVIAGWLAQRQAATLDVIRTQQATREPLTAAETVQSKRVDTHDALDGLVDGIRQRLPGL. 185
15 -12.000[F] COG2019 Archaeal adenylate kinase  ali follow..  1..MRSVITGVAGVGKTTVLDIVARSGIPVVNYGTLMFEVAKRRG-----------------------------LVENRDQIRKLSRETQVDLQKLAGEEIGK-----MENAIVDPGLPEWVLRSINASVFVIIEADPAIIKRRRDNRDDEGVDSIREHQEMNRYFAAAYSIF-IVKNEEGKPEQAADEIVRVIK... 181
16 -11.700[R] COG3911 Predicted ATPase  ali follow..  19  5FDRVFVLTGGPGSGKTTLIAALRRAGFATSV--VAGRGIVRDQSSIGGTALPLFAELMLSWEMRFDRGVPETLGYLRLSGLPVADHVSTAAKRFRYNPRVDEERKQTPDEAKCTYHALAEIYTELGYELVPLPLAPVETRLRFVLADAGLN.............................................. 183
17 -11.500[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  16  11QPVFLIVAGPNGSGKSSVYANADLESVWIVNPDLLAGRISEVENKPLPEANLVAVQRIEAWIQSSISVHKTIGVETVLSTDKYRRLVE-------------AAEAVGFAIWL-----------------FYTVLDSPERSIERIKLRHDVPADKVRARYARSLDLPWFLERADWIWDNSGATPKLIGEKQD...... 183
18 -11.500[G] KOG3354 Gluconate kinase  ali follow..  15  16VFVVIGPAG---SGKTTMAKAVSELGFEYIEGDDL--------HPKANIEKMSQGHPLNDNDRWGWLHNCGGACAMELDKESIKGVVLTCSALKRSYRDILRSSLEHRPAILR----------------FIYLAASRETLIKRTTSRKN-----KADMVESQLAILEAPTADEITISVENGKEQSEEECLDIVHKM. 186
19 -11.400[F] COG0125 Thymidylate kinase  ali follow..  14  4..LFITFEGPEGAGKTTIKNILTAEGLQVMAT--------EPGGIDIAEQIR----EVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQRFIDSPLAYQGYARGLGIDEVLSINEFAIGDMMHVTVYFSIDPEEGLKRIYANGSREKNRLDLE-EGYQELMKRFPERFHSVDAGQSKDLVVQDVLKVIDEA. 206
20 -11.400[F] COG1428 Deoxynucleoside kinases  ali follow..  11  7..KVIVLAGMIGAGKSSYTELIANE----LGTKAFYESIKD------NRILEMFYDDPKRWAFALQIYFLNTRFRSIKAALTDQNNVLDRSIYEDAEGNISEPEMDTYLDLLDNMMEELAYMPKKAPDLLIYLRGSLDTVLSRISLRGRPYEQTFDNPGLLDYYKHLHSRYDSWFINKPSDAKYVMQLIHEKLKR.. 214
21 -10.900[G] COG3265 Gluconate kinase  ali follow..  20  5CIIVMGVSG---TGKSCVGQALALLGAKFIDGDDLHPRANIQKMAA--------GQPLNDQDRAPWLERLSDVAYSLQQKNE--VGFLVCSALKKQYRDRLREGNEGIRFLWLT--------------------GDYDLVLHRMQQRAG--HFMPESLLKSQFATLEAPGSDEIPIDISSSIADVVEHCIAALSL.. 168
22 -10.700[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  17  35.PLVVFVLGGPGAGKGTQCARIVEK-THLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPV-----------------------EITISLLKREM-DQTMAANAQKNKFLIDGFPRNQDNDGKADVSFVLFFDCNNEICIERCLERGKSNRESLEKRIQSTKPIIDLYEEMGKVIDASKSVDEVFDEVVQIFDK.. 226
23 -10.700[F] COG0283 Cytidylate kinase  ali follow..  18  5..KVIAIDGPGASGKGTVAARVAALGYDYLDTGALYRLTA-HDEENVSELAKKLPAVFSDSRILLGGEDVSDGIRTEAIGMGASAVAQLPKVRASLLQRQRDFLTEKGLVA-------TGSVVFPQAELKIFLTAESKIRAERRAKQEGLAFERILSDIEARDEADRNRKVAPLLLDTSRTIEETVKKVLDWYRKV. 218
24 -10.400[G] COG2074 2-phosphoglycerate kinase  ali follow..  10  92..LIILIGGASGVGTSSIAFEVNRLGIRNMISTDMIREVMRKIVSRELL-------PSIYESSYTAYQSLRIPPPPELDEVLIGFRDHVESVSIGVEAVIERALTEGISIVIEGVHIVPGLVNKENVAMFVLTVSDENVHKGRFYSRCRQMWARRPLRRIHRYIENQARKHGVPVIENIDVVTTIDSIIKSLTKTTV 295
25 -9.960[F] COG4088 Predicted nucleotide kinase  ali follow..  13  1MPLII-VSGYPSSGKTTRSNELKKA-------------------------------EDRIHQNIDNTKDYRVIIINDESLNIEKETYRESKNEKAARGLLYSAVQRKSTFVICDALNYIKGFRYQLYCEVIHVAVPQDLCRKFNSNKEQPYPDDVLEQLMFRYEEPNGMTRWDFTVLHDDASCPIDDIWSVLIHN.. 179
26 -9.930[U] COG4963 Flp pilus assembly protein, ATPase CpaE  ali follow..  13  12NIAFIGAKGGV--GSSTIAHNCASTETILADMDLYGTANIDFDQDPAQGMA-----EAVFSPERLDEVFLDRLLTKCSDHLSLLAAPSLLDLDRQAFLPILEVLQRSAPVAVLDLPHQWCDWTRAVLDEVVITAVPDLANLR-----------NTKNLFDALIKLRPNDKLPHLVLNQVGMPKRPEITPADFLEPLE 205
27 -9.910[R] COG4240 Predicted kinase  ali follow..  13  89..FIQGILGSQGTGKTTMSLVIQLIRTLSLSLDDLYKTYSDRLVLLQQDRLIWRGPP-----GTHDIDLGLNVL---EQIRQGKSPVIVPRFDKSAHAGAGDDVITGVDILIFE--VGVRPIDPSLFNPPSPILTDEDKAFARDMNLRLNHYLPLWEKLDSLILLYPTRKQAEQKMIAAGKTGMSNTQIEEFVNYF. 295
28 -9.830[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  15  83..KVICVEGPIAAGKSKFAKELAEE----LDMEYYPAVDLD--LIYINSYGYDM-RKLDPQLPPSCRSYDVRNFCLDPSHDLAAQQIRMYMLRYSQYIDALQHVLSTGQGVVLESDFVFMEAMFRQ-HLVIYLDLPVDAVKKQIKARNV-DYEVQSKVFSDAYLSDLEQLYKQQYLTAGGETEVVVEDIERI..... 307
29 -9.720[E] COG0703 Shikimate kinase  ali follow..  20  74....IFLVGPMGAGKSTIGRQLAQLNMEFYDSD---QEIEKRTGADVGWVFDLEGEE-----------------FRDREEK----------VINELTEKQGIVLATGGGSVK-TRNRLSARGV------VVYLETTIEKQLARLLHVETPPREVLEALANERNPLYEEI--ADVTIRTDDSAKVVANQIIHMLES.. 239
30 -9.490[F] COG0563 Adenylate kinase and related kinases  ali follow..  16  1..MNLILMGLPGAGKGTQAEKIIEYGIPHISTGDMFRAAMKNETELGLKAKSYMDAGELVPDEVTIGIVRDRLSQDDCQNGFLLDGFPRTVAQAEALEDILASLDKK-------------------LDYVINIDVPEQLLMDRLTGRRVSPTSGRTYHVIFNPPKVEGI--SELIQRDDDKPETVKKRLEVNQKQ.. 178
31 -9.380[R] COG0523 Putative GTPases (G3E family)  ali follow..  17  9......LTGFLGAGKTTL----------------LRHILNEQHGFKIAVIENEFGE-------SVDDQLIGD---RATQIKTLTNGCICCTRSNELEDALLDLLDSRDRGDIAFDRLVIECTGMADPGPIIQTFFSHDVLCERYLLDGVIALVDAVEQMNQFTIAQSQIGYADRILLTKTDVAGDSEKLRERLARIN 177
32 -9.160[F] COG0194 Guanylate kinase  ali follow..  15  46..LLIVLSGPSGVGKGTVRQAIFSFEYSISVTTRSPREGEVNGVDYFFKTRDEF-EQMIADNKLLEWAEYVGNYYGTP--VDYVEQTL-----------------QDGKDVFLEIEVQGALQVRNAFPEGLFIFLSLSELKNRIVTRGTETDALIENRMKAAKAEIEMMDAYDYVVEND-NVETACDKIKAIVLA.. 225
33 -9.060[F] KOG3078 Adenylate kinase  ali follow..  15  16..IRAVLLGPPGAGKGTQAPRLAEFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEK-------------------LDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMK--EPLIRRSDDNEKALKIRLQAYHTQ.. 193
34 -9.030[A] KOG2749 mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1  ali follow..  20  115...RVIIVGDIDSGKSTLAKMLLNWKPTFVDLNVGQSSITIPGTIAAAPI-----KMLVDPVEGFPLDKALIHYFGLTNPSVNLRLYRT-ELARELKEEFSANAESRASGMVIDTMGFIVREGYALLLHAIVIVVGQEEKLVYDLKK.................................................. 268
35 -9.030[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  13  7FVRTVAILGGESSGKSTLVNKLANI-FNTTSAWEYGRDYVFSHLGGDEIALQY--DKIALGHAQYIDFAVNKVAFIDT------DFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSSVDRKEFQNLLVEMLEENNIEFVRVEEEDYDSRFLRCVELVRE................... 181

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.