current user: public

If you have questions about the server, please let us know.

Query: [J] COG0256 Ribosomal protein L18, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MLNKVQSRKRRHLRVRNKISGTPERPRLAVYRSEKNIYAQVIDDVNGTTLVSASTLDKDFSAKAGSNKEAAKLVGGIVAKKALDKGIKQVVFDRGGYIYHGRIKELAEAAREAGLEFLast
1 -76.800[J] COG0256 Ribosomal protein L18  ali  100  1MLNKVQSRKRRHLRVRNKISGTPERPRLAVYRSEKNIYAQVIDDVNGTTLVSASTLDKDFSAKAGSNKEAAKLVGGIVAKKALDKGIKQVVFDRGGYIYHGRIKELAEAAREAGLEF 117
2 -41.600[J] KOG3333 Mitochondrial/chloroplast ribosomal protein L18  ali follow..  20  56...ELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEALVEHQNGKVVVASTREWAIKKHLYSTRNVVACESIGRVLAQRCLEAGINFMVYQPTPWAASDSMKRLQSAMTEGGVVL 171
3 -30.800[J] KOG0875 60S ribosomal protein L5  ali follow..  18  1...........................MIVRVTNRDIICQIAEGDMIVCTAYAHELPKYGVKVGPTNYAAAYCTGLPLARRLLSRSAFTCYLDAGLARTGNKVFGALKGAVDGGLSI 123
4 -11.200[J] KOG0407 40S ribosomal protein S14  ali follow..  14  1MAPRKAKVQKEEVQVQLGPQVRDGE--AHIYASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGGNKT-QSALRALARSSMKI 126
5 -10.500[J] COG0100 Ribosomal protein S11  ali follow..  21  3.......KANTASRVRKKVRKTVSEGIVHVHASFNNTIITITD--QGNALSWATSGGAGFKGSRKSTPFAAQVAAEAAGKVAQEYGVKNLEVRIKGPGPGRE--SSVRALNALGFKI 109
6 -9.220[J] KOG0408 Mitochondrial/chloroplast ribosomal protein S11  ali follow..  19  100...........................VYIRASKNNTLVTVMD--KNEVITSTSCRLEGFKNARKKTTIAGQTTGVAAGQRLVRRGIRTVRVQVKGL--PGR-MTCVKGLTVAGVHV 186
7 -7.670[R] COG3380 Predicted NAD/FAD-dependent oxidoreductase  ali follow..  18  9.....................................................................GTGIAGLSAAHALRSAGQTVQLFDKG-HGSGGRMASSEAGTLDLGAQY 57
8 -6.260[O] COG5664 Predicted secreted Zn-dependent protease  ali follow..  15  107.............SALPKLTITYTLPELAIETHWQTFIAGVKKHELVFIKEMVSAIEAATVGLAVADDPQCRKIKSEMTKRLRAQRQKSRDFDKAELSDGGNVHQLILNLVNGG... 220
9 -5.780[H] COG1232 Protoporphyrinogen oxidase  ali follow..  18  16.....................................................................GAGPAGLTTAYTLAKAGRGVTVLEMDETYVGG----ISRTVDYKGFKF 59
10 -5.610[T] COG0784 FOG: CheY-like receiver  ali follow..  13  1...............................MTERRLRVLVVEDESMIAMLIEDTLCELGHEVAATASRMQEAL-----DIARKGQFDIAIIDVNL---GEPSYPVADILAERNVPF 79

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.