current user: public

If you have questions about the server, please let us know.

Query: [H] COG0321 Lipoate-protein ligase B, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MHNFTDMRDENSHDEIWLVEHYPVFTQGQAGKAEHILMPGDIPVVQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRDLVTLLEQTVVNTLAEIGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPFLRINPCGYAGMEMAKITQWKEDATTDNIAPRLLANILALLNNPPYEYIAALast
1 -104.000[H] COG0321 Lipoate-protein ligase B  ali  100  1MHNFTDMRDENSHDEIWLVEHYPVFTQGQAGKAEHILMPGDIPVVQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRDLVTLLEQTVVNTLAEIGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPFLRINPCGYAGMEMAKITQWKEDATTDNIAPRLLANILALLNNPPYEYIAA 191
2 -83.200[CH] KOG0325 Lipoyltransferase  ali follow..  26  26.KLVSERKAHQIPDTLLSLQHPPTYTLGKRRTDHNLLTKIGAELHYTQRGGDITFHGPHQAILYPIISLRSIGFGARNYVETLERSMIEFASIYGVKARGNKCETGVWVGDRKIGAIGVRISSGITSHGLALNIDPDMKYFEHIVPCGIADKEVTSLRRTDTLLPSEEIHEQLVSCLAKAFSYDDVV.... 220
3 -23.700[H] COG0095 Lipoate-protein ligase A  ali follow..  11  37..LCRSVGARMVPPTVRGWVHEKTVSLGIQDSKLAFLQEQGYRVVVRNSGGLAVVLDSGVLNLSMVLPDAERGIAIERGYETMFTLIKDMFVDCNEVIEAKEGSYDLSIQGQKFAGISQRRMAKGVAVQIYLAVEGDQAARSELIR-DVKPEVMGTLSDMKENMTVNGCLVRLFNSLRHY........... 245
4 -18.200[H] KOG3159 Lipoate-protein ligase A  ali follow..  16  30..IFRTHNVAQNGEILLMWSNRPAVVIGRHQNP-PYANKNNIQIVRRHSGGGTVYHDLGNL--ISLL-TTHAQHCRPKNLKFISD-ALNQQFSVKIVPNKRDDME-LHPGERKCSGTAARIARGQAYHHLTLLVGADLQVLSKSL--KIESNATRSVRADDANANVEQSKLAIVEAYRKLFEESHIKTV.. 229
5 -12.200[H] COG0340 Biotin-(acetyl-CoA carboxylase) ligase  ali follow..  14  43...............................................GKFGRVWHSTDQDLLASFCFFLSVNNVDSALLFRIGTEAVMRLGESLGIQEAVMKWPNDVLVQGKKLSGVLCETIPVKTGTGIGVNGNVGADELLGI------DQPATSLQELGRPVDMEEQLKRLTKEIKHLIQ......... 176
6 -6.550[S] COG2029 Uncharacterized conserved protein  ali follow..  12  5.............DLLIIKDRRIDYD-GSAIRSHWAYRNFGIL------DSLVVFRGRCDVKVEEMVDIEDKGDDMIHYIKLFIARLVEILRDLGVDAEREGD--DIYVEGRKLSSIATVSPVSLKIH-IGINVSTS-------VPREVNAIGLDELG-----VDALEFMERSGRELVEEYE......... 177
7 -6.440[H] COG1648 Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain)  ali follow..  14  4.........................................FPLFLDLTNKPVLVVGGGEVACRKIDALLRADAKVTVISPQVAPALQAWIEQGKCHWIQHFYSSHQVWATTDNPELNHQVYKDAKEQGILVNVVDDQPYCDFITP------SMIERGRIQLAISSGGASPVLIRNIRETLEAVLAQNLAL 154
8 -6.380[S] COG1650 Uncharacterized protein conserved in archaea  ali follow..  11  55.....DILASLGKYAIFISRHEPLFTVHTPGSWPDVSVANPRLASALFRA-EATHHAPNTSATFIEVGSTEAEWRDKRAVGVLAQALEEALTKEFEGPTPTMAIGDLHYVTISVLRGEFDLGHVVPKYINILKKHTISIKKTIIFRKNIKNPIRTEIIELLRAKGIEVTLK.................... 250
9 -6.220[H] COG1587 Uroporphyrinogen-III synthase  ali follow..  32..........................................................GVPIEVPLLSFIKTMDVYEEVGASIQSYWIVFTSANAVRFFFNTWPRQELKKLPSIAAVGSSTQRELSRYGISVDLMPNEYVAESLVETMVKRLKPCRVLFPKGNLARPTVKVGLETNGFIVDEMTVYETK.. 163
10 -6.050[T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases  ali follow..  11  46.................VESGSVILMEGSHSAHLYTVLHGWAFRYKTLEDGRLNYVMPGDLVGLQGTVMGEMEHSVEALSPTLAFDLTWIAASEERMLDNHLLSIGRRTAIERAAYLIAFLYRKAKAANLL-ETPIPVTQQHVADTLGLSIVHTNKTLRKLVDRGLIRWIDKGCL................ 226

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.