current user: public

If you have questions about the server, please let us know.

Query: [E] COG0334 Glutamate dehydrogenase/leucine dehydrogenase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MTENNNLVTSTQGIIKEALHKLGFDEGMYDLIKEPLRMLQVRIPVRMDDGTVKTFTGYRAQHNDAVGPTKGGVRFHPDVDEEEVKALSMWMTLKCGIVNLPYGGGKGGIVCDPRQMSIHEVERLSRGYVRAISQFVGPNKDIPAPDVFTNSQIMAWMMDEYSALDKFNSPGFITGKPIVLGGSHGRDRSTALGVVIAIEQAAKRRNMQIEGAKVVIQGFGNAGSFLAKFLYDLGAKIVGISDAYGALHDPNGLDIDYLLDRRDSFGTVTNLFEETISNKELFELDCDILVPAAISNQITEDNAHDIKASIVVEAANGPTTPEATRILTERGILLVPDVLASAGGVTVSYFEWVQNNQGYYWSEEEVNEKLREKLEAAFDTIYELSQNRKIDMRLAAYIIGIKRTAEAARYRGWALast
1 -120.000[E] COG0334 Glutamate dehydrogenase/leucine dehydrogenase  ali  100  1MTENNNLVTSTQGIIKEALHKLGFDEGMYDLIKEPLRMLQVRIPVRMDDGTVKTFTGYRAQHNDAVGPTKGGVRFHPDVDEEEVKALSMWMTLKCGIVNLPYGGGKGGIVCDPRQMSIHEVERLSRGYVRAISQFVGPNKDIPAPDVFTNSQIMAWMMDEYSALDKFNSPGFITGKPIVLGGSHGRDRSTALGVVIAIEQAAKRRNMQIEGAKVVIQGFGNAGSFLAKFLYDLGAKIVGISDAYGALHDPNGLDIDYLLDRRDSFGTVTNLFEETISNKELFELDCDILVPAAISNQITEDNAHDIKASIVVEAANGPTTPEATRILTERGILLVPDVLASAGGVTVSYFEWVQNNQGYYWSEEEVNEKLREKLEAAFDTIYELSQNRKIDMRLAAYIIGIKRTAEAARYRGWA 414
2 -93.300[E] KOG2250 Glutamate/leucine/phenylalanine/valine dehydrogenases  ali follow..  34  83.....DKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTENELEKITRRFTMELAKFIGPGVDVPAPDMNTGEREMSWIADTYASTIGHNAHACVTGKPISQGGIHGRISATGRGVFHGIENFINQASPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGLDLRTAAYVNAIEKVFKVYSEAGVT 556
3 -20.400[E] COG2902 NAD-specific glutamate dehydrogenase  ali follow..  15  740...RTNYFQKNADGTPRDLLAFKFDPKHLDGLPDPRPFREIFV---------TEVEGVHLRFGKV---ARGGLRWSDRGQRTEVLGLVKAQQVKNAV--IVPVGAKGGFFPKNRDEVFNAGREAYKTYIRTLLSITDNIVDVVAADKGTA--TFSDTANGLAHEAGF-------DDAFASGGSAGKMGITARGAWETVKRHFREMDTDIQTTPFTVAGVGDMSGDVFGMLLSEKIRLIAAFDHRDIFIDPDPDTDKSFAERKREAVAAIGLDKSVATPFEIMTAGIGTYIKAAVENDPIRVNATELRAKVIGEGANLGITQKGRIAYALAGGRCNSDAIDNSAGVNSSDVELASAVNSGRLTMPKRNQLLASMTPDVAQLVLRNNYQQSLAILGLANREELGRLMGALEATG.. 1229
4 -7.920[V] KOG1515 Arylacetamide deacetylase  ali follow..  151........................................................................YRYAPSSSGGNSRKLPVMLQFH--------GGG-GSNDSVANDFFCRRMAKHCDIIVLAVGYRLAPENRYPAA-CEDGFKVLKWLGKQANLAECNKSMGNSRRPG---GEVKKSEVNKHIVDAFGASLVEPWLANHADPSRCVLLG-ANIADYVARKAIEVGQNLDPVKVVAQVLMYP-------FFIGSVPTQSEIKQANSYFYDKPMCILAWKLFLPEEEFSLGRSPPLKFMPPTLTIVAEHDWMRDRAIEELRKVNVDA----VLEYKDAVHEFATLLLRTPQAQACAEDIAIWAKKYISLRGHE.................................. 457
5 -7.830[R] COG1712 Predicted dinucleotide-utilizing enzyme  ali follow..  13  2...................................................................................................................................................................................................................LKIGIVGCGFIGGQICRAIDGVSAELYALCDSS--------------ESKALELAASLKTCKPSYMKIEELIRGVDLIIESASQNAVRFIVPQALKADVMILSVGALADEELRDTLFG..................................................................................... 109
6 -7.470[R] COG2085 Predicted dinucleotide-binding enzymes  ali follow..  14  1..............................................................................................................................................................................................................MSHTKPSIAILGAGRVGSSLARSAVAAGYEVK--------VAGSGAVDKIALTAEILMPGAVPSTADQAVKDA-------DIVFLAVPLHKFRSVNPATLEGKIVIDTMNHWVPVNGELEEIDQDPRSTSEIIAEAGSTMVKSFNHIGYHEIEQDAGTGRAIAYATDDVDAGAQVAQLIKSFGFVPLNIGALENGRILE......... 186
7 -7.240[R] COG5322 Predicted dehydrogenase  ali follow..  13  80...................................................................................................................LTAEEMLSQPRAIAQRVVDAVESLKDQGAQVVGLGG--TAIVGNRGLQTLERTGIPVTTGN-----------SLTAYAAYRNVLESMDRLGVEPADTEVAVVGYGSIALVIAKLLAGHGCRLCLVHRGS---------EAQGRQGLAYLPEPMHAQVRLSNDIEHCYEHVQFYVAATSTGGLIDPYRLR--PGSVVVDAAKPYRKDRNDILIIDGGLVSASS-LAPKKFLNGCLAETLILGLEGRAEAFSIGRELPEDKVLEIGRIAELHGFSPSPMASYGEPVKDRHFAALRPF.... 366
8 -7.160[C] COG0281 Malic enzyme  ali follow..  16  164...........................................................................................................................................................................................HGTAIISAAAIINSLRIVGKKIEDVRLVASGAGAASIACLNLLLSLG-----MKRENITVCDSKGVVYKGRDDKMDQTKKEYAIEDNGWRKLADAIPNADIFLGCSAAGALTQDMVKSMAAHPIILALANPNTGRSDYPNQVNNVLCFPFIFRGA-EMKRAAVYAIADLALEEQNEVVTSAYGGEGATFGADYVIPRPFDPRLIVRIAP------AVAKAAMESGVA 406
9 -6.550[C] KOG1257 NADP+-dependent malic enzyme  ali follow..  13  115.........TVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTGERILGLGDLGVYGMGI---PVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGN--HNAFRFLRKYREKYCTFNDDI---------------QGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVE-LSEQEAQKKIWDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAPSTIIGVAGAGRLFTPDVIRAMASPVIFALSNPTAQAECGPVKLTDGRVFTPGQGNNV-AVILC-------------NTRHISDSVFLEAAKALTSQLTDEELAQANIQEVSINIAI-KVTEYLYANKMA 540
10 -6.480[CHR] COG1052 Lactate dehydrogenase and related dehydrogenases  ali follow..  15  141.............................................................................................................................................................................................................SKELRCSRVGILGTGRIGQAAARLFKGVGAQVVGFDPYP---------------------NDAAKEWLTYVSMDELLS-TSDVIATKDSHHLINAKTIAQMKGVYLVNTARGAVIDSQADSLDKGKI----------AGAALDAYEFEGPYIPKDNGNNPITDTVYARLVAHERIIY--TPHIAFYTETAIENMVFNSLDACTT..... 318

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.