current user: public

If you have questions about the server, please let us know.

Query: [OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MKRPLIIGVGGPVGAGKTMLIERLTRYLSTKGYSMAAITNDIYTKEDARILLNTSVLPADRIAGVETGGCPHTAIREDASMNFAAIEEMCDKHPDLQLLFLESGGDNLSATFSPDLVDFSIYIIDVAQGEKIPRKGGQGMIKSDLFIINKVDLAPYVGANVEVMKADTLKSRGNKDFFVTNLKTDEGLKSVADWIEKRLQLALLEELast
1 -82.200[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali  100  1MKRPLIIGVGGPVGAGKTMLIERLTRYLSTKGYSMAAITNDIYTKEDARILLNTSVLPADRIAGVETGGCPHTAIREDASMNFAAIEEMCDKHPDLQLLFLESGGDNLSATFSPDLVDFSIYIIDVAQGEKIPRKGGQGMIKSDLFIINKVDLAPYVGANVEVMKADTLKSRGNKDFFVTNLKTDEGLKSVADWIEKRLQLALLEE 206
2 -45.100[E] COG1703 Putative periplasmic protein kinase ArgK and related GTPases of G3E family  ali follow..  18  52.GNTLRLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSSPVTGGSILGDKTRMNDLARAEAAFIRPVPSSGHLGGASQRARELMLCEAAGYDVVIVETVGVGQSETEVARMVDCFISLQIAGGGDDLQGIKKGLMEVADLIVINKDDGDNHTNVAIARHMLRRKYDEWQPRVLTCSALEKRGIDEIWHAIIDFKTALTAS. 263
3 -23.000[R] COG0523 Putative GTPases (G3E family)  ali follow..  16  1MTPIAVTLLTGFLGAGKTTLLRHILNE--QHGFKIAVIENEFGEVSVDDQLIGD---RATQIKTLTNGCICCTRSNELEDALLDLLDSRDRGDIAFDRLVIECTGMADPGPIIQTFFDGVIALVDAVHANEQMNQFTIAIGYADRILLTKTDVAG----DSEKLRERLARINARAPVYTVV......................... 186
4 -22.400[E] COG4917 Ethanolamine utilization protein  ali follow..  17  3.....RIAFVGSVGAGKTTLFNAL------QGNYTLARKTQAVEFNDKGDIDTPGEYFNHPRWY----------------------HALITTLQDVDMLIY---------------------VHGANDPESRAGLLDIGVSKRQIAVISKTDMPDA---DVAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQEEAGE 153
5 -21.600[H] KOG2743 Cobalamin synthesis protein  ali follow..  18  40.AKIPVTIITGYLGAGKTTLLNYILTE--QHSKRVAVILNESGEGSALEKSLSQGGELYEEWLELRNGCLCCSVKDN----GLRAIENLMQKKGKFDDILLETTGLADPGAVASMF-DGIITIVDSKYGDGLINEATRQVALADIILINKTDLVP--EEDVKKLRTTIRSINGLGQILETQ......................... 233
6 -19.400[R] COG2403 Predicted GTPase  ali follow..  12  139.....SLKILGTGRIGKTAVSAYAARLIHERQYNPCVVAMGRGGPEEPEIVHGDRIEITPEMSRILTVGCRRCGGGMVGDVFITNMKRGTANRLDADFVILEGSGAAIPPVK----SNRHIVLVGANQPLINIKNFFGPFRIADLVIVTMCEEPMAGDEKVREIVDFIESINPEAEVITTV......................... 336
7 -18.000[R] KOG2486 Predicted GTPase  ali follow..  138......FALVGRSNVGKSSLLNSLVRR-----KRLALTSKKPGKT-----------------------------------------QCINHFRINDKWYLVDLPGYGYASAPHELKQVSVFLLVDASIPKPIDLEYASWLGQNQTLIFTKCDKRKKKKNGGKKPEANIKEFQDLIPWIMTSSVTNQGRDEILLHMAQLRNYWLKH. 318
8 -17.900[R] COG1084 Predicted GTPase  ali follow..  13  160.LDAFTVVIAGFPNVGKSTLLRTLTGA--------PEVADYPFTTKGIQI---------------------------------------HLERKWKRIQVIDTPGELQAMVALENIADVIMFIFDASET-SLYLGIRSVFDIPVVTVFNKMDLAENVKYLEEYINM--------EDPLKVSAFEGRGVSKIIKKLEGLYEKETRE. 331
9 -17.800[R] KOG1533 Predicted GTPase  ali follow..  12  31.WTMYGVLVIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDVNITEMITVNDVMDRLGLGPNGALKYCI------ETLGANCNWLLIEANHKKYLIIDCPGQLELYKSEGELWKVALHLADSLYCSDPSKFISVALSTLATMCLSKADLFSEDGTKLNEAICGVISDFDLVSFVPLAVENKESMMKVIQMVDAANGFSLTEQ 288
10 -17.800[R] COG3596 Predicted GTPase  ali follow..  13  35THYEPVIGIMGKTGAGKSSLCNALF------AGEVSPVSDVAACTRD--------------------------------------PLRFRLQIGEHFMTIVDLPGVGESGVRDTEYLDLILWLIKADDRHFYRQVIGEAYRHKMLFVISQSDKAEPTSGGNILSTEQKQNISRKIPVCAVSVRLQWGLRVMAERMIKCL....... 216
11 -17.600[K] KOG1534 Putative transcription factor FET5  ali follow..  14  4....VAAFVCGVASSGKSTFCGALMSYMKSVGRSCHLVNLDPAATVDIRDLISIDDVMEELDYGPNGGLIYCF------EFLMENLDWLNIGDYDEDYLIFDMPGQIELYTHVPILPALAVYLLESQFLVDRTKFFAGVLEVPHINLLSKMDLLKDNNNELNRCIVQLIDDFNMVNFLPLESGNEESVSRVLSYIDDATQWYEDQE 260
12 -17.600[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  16  39.KKPIIIIVVGMAGSGKTSFLHRLVCHTFDSKSHGYVVNLDPAVNIDIRDTVKYKEVMKQYNLGPNGGIL--TSLNLFATKFDEVVSVIEKRADQLDYVLVDTPGQIITEAFASTFPTVVTYVVDTPRSSSPITFMSNMLYACSILAFNKTDVADYTATLANSLSLSLYEFYRNIRSVGVSAISGAGMDGFFKAIEASAEEYMET. 290
13 -17.000[H] COG1763 Molybdopterin-guanine dinucleotide biosynthesis protein  ali follow..  16  3.....IFGITGWKNSGKTTLTEKLVAELVRRGWKVSTVKHA-KPGADSFRHRQAGATEVAIVSGNRW-----ALMHELRGEDEPPLESILSRLAPCDIVLVE........................................................................................................ 100
14 -16.100[R] KOG0395 Ras-related GTPase  ali follow..  12  17.KNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTI--EDFHR------------------------------------------KVYNIRGDMYQLDILDTSGNHPFPAMRRLTGDVFILVFSLDN-DEVKRLQKQILEVKSVICGNKNDHGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMS 197
15 -15.600[F] COG1618 Predicted nucleotide kinase  ali follow..  12  7EKTMLRIAVTGSPGVGKSTVVAKTAEKLAEKGFKIGGIRTAEIRKEGHREIRDLATGKTGILSHVKGSGPRLGKYHVNLDDLERIGANAVRNALACDLVVIDEIGPMELISAVEEVLESDKPVLAVLHHSSRHPLAQRFRKGFEVLTVDKGNRDELPEKITNRFLRKL...................................... 183
16 -15.500[R] KOG2878 Predicted kinase  ali follow..  13  23.GRPFILGISGPQGSGKSTLASALDTELTRKNESVVKFSLDLAKNNPNNPLVQHRGLAGTHDVTFLNNVLNAFVKGSDEEVSIPFYDKSKFGGYGTTYVIFEGWMVGFEPLDSCMLSVRARSTRWQNI-NRKLADYQPIFQKIDSLVELEAQ-------EINYVYRWRLQQEHALKARIHKGMSDEEVIEFVNHYMPQYV...... 246
17 -15.500[U] COG0552 Signal recognition particle GTPase  ali follow..  14  118.GRLNVILLVGVNGVGKTTTIGKLAHKMKQEGKSVVLAAGDTFRAGAIEQLEVWGERTGVPVIKQTAGSDP-------AAVIYDAVHA--AKARNADVLICDTAGKRVIEREVPEAPHEVLLALDATTGQNAMAQAKEFSKATNVIALTKLDGTAKGGIVLAIRNE-------HIPVKLVGL--GEKVDDL............... 307
18 -15.400[R] COG1159 GTPase  ali follow..  13  11......IAIVGRPNVGKSTLLNKLL------GQKISITSRKAQTTRHR-----------------------------------------IHTEGPYQAIYVDTPGLHMEEKSSIGDVELVIFVVEGTRWTPDDEMVLNKLRDGKILAVNKVDNVQE-KVDLLPHLQFLASQMNFLDIVPISAETGMNVDTIAGIVRKHL....... 173
19 -15.300[N] COG1419 Flagellar GTP-binding protein  ali follow..  12  170.FKNAKVLFVGTTGVGKTTSLAKLAARFKDEKKRVAILTLDTYRIAAAEQLKIYADIMDIPM---------------KIAYTPKEAEYEMMALKDYDIVLVDTAGRSLRALSEAVKPNITFLVLSMNYKLDDMKRIVERFSAVKPIILTKMDETSVYGTFVNISEIT------GLPIAFVT--NGQRVPD................ 347
20 -15.200[U] KOG0780 Signal recognition particle, subunit Srp54  ali follow..  16  99.AKPSVVMFVGLQGAGKTTTCTKYAYYHQKKGYKAALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDP-------VKIAVEGVDRFKKE--KCDLIIVDTSGEEMRQVAEATEPDLVIFVMDSSIGQAAFEQAEAFKETVSVVIITKMDGHAKGGGALSAVAAT------KSPVIFIG--TGEHMDEF............... 282
21 -14.900[C] COG3954 Phosphoribulokinase  ali follow..  10  3.AKHPVIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEVEGDSFHRYTRPEMDMAIRKARDAGRHIS--------EANDFSLLEHTFIEYQPLPEPTDVLFYEGLHGGVVTPQVARHVDLLVGVVPIVNGHSREAVMDPQFSRTHINF----QRVPTVDTSNPFAAKGIPSLDESFVVIHFRNLEGIDFPWLLAMLQGS........ 252
22 -14.800[R] COG2229 Predicted GTPase  ali follow..  15  2..RENKIIFTGPVGVGKTTAIAAISD--------EALVQTDASASDMTLDRKRNTTVAMD---------------------------GAISLDEDTKVHLYGTPGQERFNFMWEILSQ-LVLLLDNARTNPLKDLEFFLHSFRGVVGITKMDIRS--QPGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSID...... 173
23 -14.500[R] COG4240 Predicted kinase  ali follow..  14  86.KRPFIQGILGSQGTGKTTMSLVIQLILQHLGYRTLSLSLD-KTYSDRLVLLQQDPRLIWR-------------GTHDIDLGLNVLEQIRQGKSPVDILIFEGWFVGVRPIDPSLFNFPPSPILTDED-NLRLNHYLPLWEKLDSLILLYPTDYRCSLEWRKQAEQKMIAAGK-------TGMSNTQIEEFVNYFWRSLHPELFIQ 306
24 -14.500[U] KOG0781 Signal recognition particle receptor, alpha subunit  ali follow..  12  425QRKPYVVVFVGVNGVGKSTNLAKVAYWLQQHKVSVMMAACDTFRSGAVEQLRTHARRLQIPIFEKGYE-------KDPAVVAKEAIQE--ATRNGSDVVLVDTAGRALSKLINLNQPDLVLFVGEALVGNDAVDQLSKFNQKLDGILLTKFDTIDDKVGAALSMVYIS-----GSPVMFVGC--GQSYTDLKKL............ 623
25 -14.500[D] COG3640 CO dehydrogenase maturation factor  ali follow..  12  5..GMPKLIISGRGGSGKSTLVTLIAHTLKEQKKRVLVVDSDESNIGLSGIL-SLGLMQIGKIDHAMEGCACPMG-----AVTRDFLNHVRLE--EDQWVLVDTAGVEHFGRGIVEGADAVVMVVDPSDAVLLAEKAAKLTHEADKVILNKIDEETEPILTELLTSEGNEIKGPYSPAITKMNLKGESL.................. 244
26 -14.400[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  18  15.KEQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVAT------------------------------------------IPVDSKQILKFWDVGGQES-SEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMLMLANKQDRQDRMEVQKEVFNKIAEHISARDRVLPISALTGEGVKDAIEWMIVRLERNKKSR 193
27 -13.900[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  16  165DPNTRTVLICGYPNVGKSSFMNKVTRAFTTKSLFVGHTDYK-----------------------------------------------------YLRYQVIDTPGEMCSITALAHLRAAVLFFLDISGSALFHSIKSLFMNKPLVIVCNKTDLMPMENISEEDRKKTAMGASEEQVLLKMSTLTDEGVMSVKNAACERLLDQRVEA 356
28 -13.700[F] COG0572 Uridine kinase  ali follow..  13  6.HQCVIIGIAGASASGKSLIASTLYRELREQDQHIGVIPED-YKDQSHLSMEERVKTNYDHPSAMDHNLLLEHLQALKAGYTEHTRKKETVHLEPKKVIILEGI--LLTDIRLRQEMNFSIFV-----------------TPLDICLMRRMDVNERGRSMDSVMAQYQKTVRPMFLIVPRGGKNRIAIDILKAKISQFFE...... 213
29 -13.600[T] KOG4252 GTP-binding protein  ali follow..  16  9...AIKMVVVGNGAVGKSSMIQRYCKGIFTKDYK-KTIGVDFLE------------------------------------------RQIQVNDEDVRLMLWDTAGQ-AITKAYYRGAQACVLVFSTTDRGSFEAVSSWREKVVAVLVQNKIDLLDDSCIKNEEAEALAKRLR--LRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQ 176
30 -13.400[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  15  3.RKTIIVGVSGASCSGKSTLCQLLHAIFE----GSSLVHEDDFYKTDAEIPVKNGIADWDCQESLNL-FLENLHYIRDHGVLPTHLRNRENKNVAPEALIEYADIIKEFKAPAIPTLEQHLVFVD------------GFMMYVNEDLINAFDIRLMLVTDFDTLKR........................................ 152
31 -13.300[J] KOG1191 Mitochondrial GTPase  ali follow..  15  350LQSGLQIAIVGRPNVGKSSLLNAWS------KSERAIVTEVAGTTRD--------------------------------------VVEANVTVRGVPITLLDTAGIRETNDIVEKIADVIIMAVSAVEGWTEEDTELLYLKQPMILVMNKIDCAP--PGSCDQLEDQRKKEEVFHKSVFTSAVTGQGIEELEDAILEILG...... 534
32 -13.300[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  20MPEGKLILLNGGSSAGKTSLALAFQDLAAECWMHIGI---DPPEQLDLARVRPEYYTWDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVTREWLVDALRVFEGCRVWMVGVHVSDEEGARR----------ELERGD--RHPGWNRGSARAAHADAEYDFELDTTATPVHELARELHESYQACPYPMAFNR 218
33 -13.200[R] COG1160 Predicted GTPases  ali follow..  13  5.....VVALVGRPNVGKSTLFNRLT------RTRDALVADFPGLTRDR---------------------------------------YGHAHIAGYDFIVIDTGGIDGTEEGVEEKADIVLFLVDARAGIGIANYLRQRQNKITVVVANKTDGIDADSHCAEFYQLGLG------EIEQIAASQGRGVTQLMEQVLAPFAEKMENA 171
34 -13.200[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  18  15.DQEVRILLLGLDNAGKTTLLKQ---------------------------LASEDISHITPTQGFNI----------------------SVQSQGFKLNVWDIGGQRKIRPYYFENTDILIYVIDSADRKRFEETGQELAELLELIFANKQDLLTAAPASEIAEGLNLHTIRDRVQIQSCSALTGEGVQDGMNWVCKNVNAKKK.. 182
35 -13.100[M] COG1663 Tetraacyldisaccharide-1-P 4`-kinase  ali follow..  16  58...VVVVGNIHAGGTGKTPIVAALVSGLQEKGVKVGIISRGYGRKSKAVHVLNAESRAEDAGDEPLLLFRKTGAPTAVGSSRAEAGRALLAAHPDIGLIVADDG------QHYALRRDVEIAVFPAADTDLDLLPNGNLLDSVDAVVVSGGKADALFRPSENMFHSRIERLNNPSEILDTGRLKNQTVVAVA.............. 255
36 -13.100[P] COG1348 Nitrogenase subunit NifH (ATPase)  ali follow..  12  3.....QVAIYGKGGIGKSTTTQNLTSGLAELGKKIMVVGCDPKADLDTLREEGEDVDLDTIMKTGFGNIKCVESGGPEPGVSINMLEQLGAYEDELDYVFYDVLGDVVCGGFAMPIR---------------------EGKAKEIYIVASGEMMAMYAANSKGISKFANTGGVRLGGIICNSRKVKNEKELLEAFAKELG...... 201
37 -12.900[U] COG0541 Signal recognition particle GTPase  ali follow..  16  98.QPPAVILMAGLQGAGKTTSVGKLAKFLKERHKKVLVVSADVYRPAAIKQLETLAQAVGADFFPSDVS-------QNPVQIAQAALSE--AKLKFYDVLIVDTAGDEIKQIHAALNPIETLFTVDAMTGQDAANTAKSFNEALPLVVLTKVDGDARGGAALSIRQEKTDALEPFHPERVASRILGMGVLSLIEDLERSVDREKAEK 318
38 -12.900[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  12  18.KEEMELTLVGLQFSGKTTFVNVI-----ASGQFAEDMIPTVGFNMRK------------------------------------------ITRGNVTIKVWDIGGQPRFRSMYCRGVNAIVYMVDAADLDKLEASRNELHSLLDLVLGNKRDLPGALDETGLIERMNLSSIQDRECCYSISCKEKDNIDITLQWLIQHSKSQSR.. 186
39 -12.900[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  13  39.QATINIGTIGHVAHGKSTVVKAISVRFKNELER---ITIKLGYANAKIYQLDDPSCPRPECYRSCGSSMPDEFPTDIPGTKGNFRL-------VRHVSFVDCPGHDILMATMLNGADAALLLIAGNESCPQPQTSEHLAAIE-LILQNKIDLVKERQAKEEQILAFVQGTVEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRD. 249
40 -12.900[R] KOG1673 Ras GTPases  ali follow..  12  101...SLKISLLGDCQTGKTTFVVKYVGENQSFLEMTGLNLMDKTFYVQGVTIS---------------------------------------------FSIWDVGGD-DHIPIACKDAVAILFMFDLTSRSTLNSVFGWYSQARKILIGTKFDDFVRLPPNLQWTIVTQARAVMNASLFFSSATHNINVNKIFKFILARL....... 266
41 -12.800[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  10  12...KFKIVLLGEGCVGKSSLVLRFVENKFSCKHLSTI--------------------------------------------ASFQNKTVNVEDCQADLHIWDTAGQ-ALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTLIVGNKIDLEEERQVTRQDAEAYAESEG--ALYMETSAQDNVGISDAFESLTAKMIEHSRTR 180
42 -12.800[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  16  19.NKEMRILMLGLDAAGKTTILYKL--KLNQSVVTIPTVGFNVET----------------------------------------------VTYKNIKFNVWDVGGQDKIRPLYFTGTKGLIFVVDSADSNRISEARQELHRIISLVLANKQDLPGALSPAQITDVLQLDKLKDRLNVQPTCALTGDGLLEGLAWLSQNAKLK.... 184
43 -12.800[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  20  15.SREMRILILGLDGAGKTTILYRLVTTIPTIGFNVEQVTYK-----------------------------------------------------NLKFQVWDLGGQTSIRPYYYSNTDAIIYVVDSADRDRIGISKDELLYMLRVVLANKQDMDGCMTVAEVHHALGLENLKNRTQIFKTSATKGEGLDQAMDWLSNTLQSRK... 181
44 -12.800[R] KOG0394 Ras-related GTPase  ali follow..  19  8...LLKVIILGDSGVGKTSLMNQYVNKKFSNQYK-ATIGADFLT------------------------------------------KEVQFEDRLFTLQIWDTAGQ-SLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIVLIGNKVDVDDGNSRVVSEKKKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKSGEEE 183
45 -12.700[F] COG2019 Archaeal adenylate kinase  ali follow..  1....MRSVITGVAGVGKTTVLDIVARESGIPVVNYGTLMFEVAKRRGLVENRDQ-------------------IRKLSRETQVDLQKLAGEEIGKMENAIVDTHMSIKTPFGYLPGLPEWVLFVIIEADPAIIKRRRDNDPTRARDDEGVDSIREHQEMNRYFAAAYSIFSGATVKIVKNEEGK---PEQAADEIVRVIK...... 181
46 -12.700[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  14  20...QFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTI--------------------------------------------AAFLTQTVCLDDTTVKFEIWDTAGQ-SLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRALSGNKADLANKRAVDFQEAQSYADDNS--LLFMETSAKTSMNVNEIFMAIAKKLPKNEPQN 188
47 -12.700[NU] COG2874 Predicted ATPases involved in biogenesis of archaeal flagella  ali follow..  13  37.....LTLIEGENDTGKSVLCQQFVYGGLMSGHNIAYYTTENTIKSFLRQMESLSLDVSDFYAWLRVFPVHLEGIDWSTEQMRSILNLVHIKTIRENIAIIDSLTMFTTYSTEDDVLEFKTILITLHQHAFKEDTLVRIRSACDCHLFLRKEQVGDRYVSVLEVSKIRGARKTTGNIVSFEVHPGFGLK................. 235
48 -12.600[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  16  15.KKEMRILMVGLDAAGKTTILYKLVTTIPTIGFNVETVEYK-----------------------------------------------------NISFTVWDVGGQDKIRPLYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNLVFANKQDLPNAMNAAEITDKLGLHSLRQRHYIQSTCATSGEGLYEGLDWLSNNIASKA... 181
49 -12.600[R] COG1341 Predicted GTPase or GTP-binding protein  ali follow..  13  29LRKPAKVMIIGDVDTGKTTLTIYLANELLSRGFRVAIIDSDIGQKG-SLAFVDSHFTSLDDLKAFSHYFIGTITPNQYFGEMVVGVMKLSELAKFSDVVLIDTTG------------------MIYGSGVELKRMKIEAVKPNLILALERNNELAPILKGYE............................................ 179
50 -12.600[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  14  12...TFKLVLVGDGGTGKTTFVKRHLTGEFEKKY-IATIGVEVHP------------------------------------------LSFYTNFGEIKFDVWDTAGQGGLRDGYYINAQCAIIMFDVTS-KNVPNWHRDLVRVCEVLCGNKVDVKERKVKAKTITFHR----KKNLQYYDISAKSNYNFEKPFLWLARKL....... 170
51 -12.500[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  16  16.NKELRILILGLDGAGKTTILYR---------------------------LQIGEVVTTKPTIGFNV----------------------TLSYKNLKLNVWDLGGQTSIRPYYYADTAAVIFVVDSTDKDRMSTASKELHLMLQLVFANKQDQPGALSASEVSKELNLVELKDRSSIVASSAIKGEGITEGLDWLIDVIKEEQ... 182
52 -12.500[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  14  9...KYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATI--------------------------------------------IDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSDSSVAVVVYDVANRLSFLNTSKWIEEVRNVLVGNKTDLVEKRQVSIEEGDSKGREYG--VMFIETSAKAGFNIKPLFRKIAAALPGMESYS 177
53 -12.500[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  16  14.ERELRLLMLGLDNAGKTTILKK---------------------------FNGEDIDTISPTLGFNI----------------------TLEHRGFKLNIWDVGGQKSLRSYYFESTDGLIWVVDSADRQRMQDCQRELQSLLVLIFANKQDLPGALSSNAIREALELDSIRSHHCIQGCSAVTGENLLPGIDWLLDDISSR.... 179
54 -12.300[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  15  468...MGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGID-------------------------------------------RNKVVVVDGTRVKLQIWDTAGQERFRSVTHA-AHALLLLYDVTNKTTYDNIRAWLGEIREVLIGNKADCSGSER-QVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEH 638
55 -12.300[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  13  18.QKEAKILFLGLDNAGKTTLLHM---------------------------LKDERLVQHQPTQHPTS----------------------ELSIGKIKFKAFDLGGHQIARRVYYAKVDAVVYLVDAYDKERFAESKRELDALLSLILGNKIDIPYAASEDELRYHLGLTNFTTGKEVFMCSIVRKMGYGEGFKWLSQYIN...... 193
56 -12.200[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  11  9...LIKFLALGDSGVGKTSVLYQYTDGKFNSKF-ITTVGIDFREKR---------------------------------VYRASGPDGATGRGQRIHLQLWDTAGQ-SLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMVLCGNKSDLEDQRVVKEEEAIALAEKYG--IPYFETSAANGTNISQAIEMLLDLIMKRMERC 188
57 -12.100[R] COG0218 Predicted GTPase  ali follow..  13  28......IALAGRSNVGKSSFINTMLNRKN--------LARTSGKPGKTQLLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDL--------------------DPSADDVQMYEFLKYYEIPVIIVATKADKIPRGKWNKHESAKKKLNFDPSDDFILFSSVSKAGMDEAWDAILE......... 193
58 -12.000[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  16  10...LFKLLIIGDSGVGKSSLLLRFADNTFSENY-ITTIGVD-------------------------------------------KIRTMDINGQRVKLQIWDTAGQ-TITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENVLVGNKCEENERRVVLESDARNYAQSMN--ISFFETSAKEDKNVEPMFTCITSLVLTAKLAN 177
59 -11.900[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  15  9...LFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATI--------------------------------------------VGFMIKTVEINGEKVKLQIWDTAGQ-SITQSYYRSANALILTYDITCEESFRCLPEWLREIEQVLVGNKIDLAERREVSQQRAEEFSEAQD--MYYLETSAKESDNVEKLFLDLACRLISEARQN 177
60 -11.800[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  13  125.NLKRLVGLAGPPGAGKSTVANEVVRRVNKPPDVAIVLPMD---------------LYRSQLDAMEDPKEAHARRGAPWTFDPALLLNCLKKLKNEGSVYVPSFDHGVVEDDIFVSLQHKVVIV---EGNYILLEEGSWKDISDMF-----DEKWFIDVNLDTAMQ---------RVENRHISTGKPPDVAKWRVDYN........ 309
61 -11.800[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  13  177TPRSPVVTIMGHVDHGKTTLLDKF--------RKTQVAAVET------------------------------------GGITQHIGAFLVSLPSGEKITFLDTPGHAAFSAMRARGAQVTIVVLVVAADDGVMKQTVESIQHAKILAVNKCDKAEAVKKELLAYDVVCEDYGGDVQAVPVSALTGDNLMALAEATVALAEMLELK. 348
62 -11.800[R] COG0486 Predicted GTPase  ali follow..  13  224LREGMKVVIAGRPNAGKSSLLNALA------GREAAIVTDIAGTTRD--------------------------------------VLREHIHIDGMPLHIIDTAGLREATDEVERIADRILLMLDSTEADNQDLEK----NIPVTIVRNKADLSG---------ENEGIVEQNGYTVITLSAKTQQGIALLREHLKQSMGYQTNME 394
63 -11.800[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  15  25.KSLLRFLTCGSVDDGKSTLIGRLL-------HDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFST-----EKRKFIIADTPG-----ATGASTCELAILLIDARKGVLDQTRRHSFISTL-VVAINKMDLVDYSEETFTRIREDYLTFNLDIRFVPLSALEGDNVAS................ 215
64 -11.800[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  12  53.TKSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGTFVLHNENNTKKGKVKPVHLIDVP------------GHSRLISKLEEYLPRAAAVVFVVDAL------EFLPNIRAASEYLYDILTNASVIKNKTPV-----LLCCNKTDKVTAHTKEIEGEVFSFSHCHNKVTVAEASGLTG-ETDQVQEFIREHVK...... 259
65 -11.700[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  15  8...LFKLLLIGDSGVGKSCLLLRFADDSYLDSY-ISTIGVD-------------------------------------------KIRTVEQDGKTIKLQIWDTAGQ-TITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRLLVGNKCDLTSQKVVSTETAKAFADELG--IPFLETSAKNATNVEEAFMAMTAAIKTRMASQ 176
66 -11.700[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  14  22...MFKILIIGNSSVGKTSFLFRYADDSFTPAF-VSTVGID-------------------------------------------KVKTIYRNDKRIKLQIWDTAGQ-TITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTLLVGNKCDMEDERVVSSERGRQLADHL--GFEFFEASAKDNINVKQTFERLVDVICEKMSES 190
67 -11.700[M] COG0481 Membrane GTPase LepA  ali follow..  16  1MKNIRNFSIIAHIDHGKSTLSDRLIQ-----------TCGGLSDREMEAQVLDSMDLERERGITIKAQSVTLNYKAKDGE--------------TYQLNFIDTPGHVDFSYEVSAACEGALLVVDAGQGVEAQTLA--NCYTA-VPILNKIDLPA---ADPERVAEEIEDI--AMEAVRCSAKTGVGIEDVLEEIVHKIPAPEGDP 187
68 -11.500[H] COG1072 Panthothenate kinase  ali follow..  16  78.RIPYIISIAGSVAVGKSTTARVLQALLSREHRRVELITTD----HPNQVLKERGLMKKKGFPE-----------SYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILIL---EGLNVLQSGMDYPHDPHHVFVSDVDFSIYVDAPEDLLQT........................................ 230
69 -11.400[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  11  12LSPGTMIVIVGPSGAGKDTLMDYAAAQLSGRGFHFTRRVITRSCDAGGENHDAVSMHEFNQLEDAGAFAVSWQAHGLKYGIPAAVYRHL---EAGDVVIA--NGSRSALPHFGTAFSRLKVVNIVARRGRESRDDILRRLERSSLAVAGDFDVT----------------------TVDNSGAIEDAGKTIMQVLQQSAGSSQ... 198
70 -11.400[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  14  9...LIKLLLIGDSGVGKSCLLLRFSEDSFTPSF-ITTIGID-------------------------------------------KIRTIELDGKRIKLQIWDTAGQ-TITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQILIGNKCDCEDQRQVSFEQGQALADELG--VKFLEASAKTNVNVDEAFFTLAREIKKQKIDA 177
71 -11.400[P] COG0370 Fe2+ transport system protein B  ali follow..  13  2..SQNTYCILGNPNTGKTSLFNALTGSYEYVGNWSGV-----------------------------------------------TVEKKVGTLRSKTGKLIDLPGIVVTRFLLEEKFDCMLNIVDSSQIERNLNLTVQLLEYG-VMGLNMIDVAAGRGIHLNI---QNLAKKLRIPILPVVARSGKGTEDILSTLSEKHV...... 162
72 -11.400[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  11  10...LFKTVLIGDSGVGKSNLLMRFTRNEFNIESKSTI--------------------------------------------VEFATRNIVLDNKKIKAQIWDTAGQ-AITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREMLVGNKTDLLHLRAVSTEEAQAFAAENN--LSFIETSAMDASNVEEAFQTVLTEIFRIVSNR 178
73 -11.400[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  19  1....MIIVTSGHVDHGKTALLKAL-------------------TGTSTAHLPEEK----KRGMTIDLGYA--------------------LPLENKVLGFIDVPGEKFLSNMLAGLGGVHYAMLIVAADEGVAVQTKEHLAILRIVVITKADRTN--SAQIESLIQTIKQD-RNANYFVTSAETGQGISELRHYLANLAELADTQK 169
74 -11.400[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  16  3.....LVVITGLPASGKSTRARQLRDHFVERGRKVHLISEN..................................................................................................................................................................... 38
75 -11.400[R] COG3910 Predicted ATPase  ali follow..  10  38.....ITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVAKAFYFARKKYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKAL---GEDFPEETPEIFRGIVRNNSLDRRS--HGEGFLDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADSGGQLIIAT......................... 210

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Harder T, Godzik A. JAFA: a protein function annotation meta-server. Nucleic Acids Res. 2006 Jul 1;34(Web Server issue):W379-81.