current user: public

If you have questions about the server, please let us know.

Query: [L] COG0389 Nucleotidyltransferase/DNA polymerase involved in DNA repair, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350
# Score Template Links and tools%idFirst MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLDPQMERQLVLGLLast
1 -133.000[L] COG0389 Nucleotidyltransferase/DNA polymerase involved in DNA repair  ali  100  1MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTANYPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVTDSVHCHGSATLIAQEIRQTIFNELQLTASAGVAPVKFLAKIASDMNKPNGQFVITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRILWERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDLLIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLDPQMERQLVLGL 351
2 -96.700[L] KOG2094 Predicted DNA damage inducible protein  ali follow..  31  83.RDCVCIDMDAYFAAVEMRDNPALRTVPMAVGS----SAMLSTSNYLARRFGVRAGMPGFISNKLCPSLTIVPGNYPKYTKVSRQFSQIFDENENTLEDLKIEESICPKCEKSRFGTGREEAVREIRFRVEQLTGLTCSAGIASNFMLAKICSDLNKPNGQYVLENNAIMEFLKDLPIRKVGGIGRVCEAQLKAMDIQTVGDMNLKKNLYPLCFTPLSQESFLRTALGLPGRPSESDPRRKSISVERTF-SPTSDFNILLEEHQEICRMLEEDVRKSGI-VGGKTVTLKLKLSSFDVLTRSLTPSVKSLEDIQKFSLELLEKEK-GKEIRLLGVRLSQLIFEEDEK..... 480
3 -78.000[L] KOG2093 Translesion DNA polymerase - REV1 deoxycytidyl transferase  ali follow..  26  319.QADRKAELELFAQRFEHHFHDGDKAEKVRSGFDKMSLSEIASCSYEAREKGIRNGMFVGQALKLCPELKTIPYDFEGYKEVAFTLYDTVAQYTLNIEAVSCDEMFVELTDLHELNVDVMAFVSHLRQEVYSKTGCPCSAGVAGNKLLARMATKEAKPNGQFLLDSNDILAYMAPMSLDLLPGVGSSISHKLKQAGLNNCGDVQNTTLEKMEKVLGKLGQNLFQNCRGIDDRPLAYEQIRKTVSAEMNFGIRFTNSVECEQFLCQLSEEVTKRLV--EIRRKARSINLKIMVRAADIINKSSLIATDDVNVITTVVLDLMKDADPPDELRGLGIHLTRLEDANEVRKENNI 688
4 -68.600[L] KOG2095 DNA polymerase iota/DNA damage inducible protein  ali follow..  28  16.RVVLLVDMDCFFCQVEEKQHPEYRNRPLAVVQNPWRGGGIIAVNYAARAKGVTRHMRGDEAKDLCPEIVLCQADTSKYRDAGKEVANVLQRFTQLLERASVDEAYLDITETVNRLLIGASVAGEVRAAVKKETGYECSAGIAHNKILAKLAAGMNKPNKQTILPLTETASLFDSLPVGKIKGLGGKFGEVVETLGIKFMGQVVKFSEVDLQRKFDKNGTWLFNISRGIDLEAVTPRFYSKSIGCCKKFPGRITGLKTLQHWLGELSSEINDRLEKIENNRRAKHMVVQYQDIDGEEVASSRSTADYDQESIVRLSLDLIKANTKTNAIKFLGISVGKFETVSSGQNKL.. 458
5 -7.320[S] COG3743 Uncharacterized conserved protein  ali follow..  16  141................................................................................................................................................................................DLKAISGIGPKLEKVLNGLGIWTYAQIAAWSPQEIAWVDDYLS.................................................................................................................................... 183
6 -6.730[R] COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains  ali follow..  13  390............................................................................EAFNRAKMDYDHLVSQIQQLGGLEGFIAKRAMLEKMKDEI-------LGLPEEEKRA--------------LAALHDTARE---------RQKQKFLEGFFIDSIPGVGPARKAALRSFGIETAADVTRRGVKQVKGFGDHLTQAVIDWKASCERRAVMAKMAAKRHRLESALTVGATELQRFRLHAPARTMPLMEPLRQAAEKLAQAQADLS.............................................................. 589
7 -6.280[S] COG1478 Uncharacterized conserved protein  ali follow..  11  23.......DIVQALEASLQDAGISPVDGDVFVLAES----AVATA--ENRIVELASIKPGEKALSLGPREMELVLQECDELFGGVPGAALTITKGILSPNAGIDASNAPDGHVVLLPEDPRKSSETIRKRLEQRYSCKLGVIIGDSRTQPLRLGCTGLALGISGFVPVEDARGTFDIYGKPLRLTYKAAADNLVSAAELLMGEAGERVPCVLVRGAP....................................................................................................................................... 231
8 -6.240[T] COG2200 FOG: EAL domain  ali follow..  12  12LRTALQEGQFFLEYQPLVKPSSSVVGFEALLRWRHPLVGIIPPNVF-AEADGLMSDIGRWLLERACRAAMDWPSHFTIAVNLSPAEFGLTDRVAQTLDLVGMRADRLELEITESVLLERTINNLDTLNTL-NVLGVQISLFYSSLSYLKNFPFDTIKID----------QYFIRDLEVRSIIALAHGLGMNVTAEGVETAEQAIWLQKEGCDRLQG....................................................................................................................................... 234
9 -5.550[J] KOG2411 Aspartyl-tRNA synthetase, mitochondrial  ali follow..  16  15MREYLCNLHG--FVDIET---------PTLFKRTPGG----------AKEFLVPSREPKFCSLPQSPQQLLMVGGLDRYFQVARCYRDSRPDRQPEFTQIDIEMSFVDQTGI-------QSLIEGLLQYSWPNDKDPVVV-MTFAEVLATYGTD--KPDTRFGMKIIDISDVFRNTEIGFL.......................................................................................................................................................................... 174
10 -5.480[L] COG1039 Ribonuclease HIII  ali follow..  10  56.......EAEKLASDFGHIAQVVPQKQTNLIGTDEVGNGLMVTASFFLKEIGVADSKKLTDEKIC---LVVEPAKYNEVIAHNQAIYLLEKQLGHKPENIVIDAFTTEANYKKYVNKEQNHPLTKVTLLTKAE---DQFLAVAVSSIISRYLFL------------ENLKKLSKESGFTLPSGAGKIAAQIIKSQGVDALNQLAKLHFANTQKAIKI...................................................................................................................................... 289

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.