current user: public

If you have questions about the server, please let us know.

Query: [L] COG0470 ATPase involved in DNA replication, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst MSTSTEKRSKENLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFSKGFKLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRIANVLVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPRPSDLKAVLKSILEDDWGTAHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLLTKLADIEYSISKGGNDQIQGSAVIGAIKASFENETVKANVLast
1 -104.000[L] COG0470 ATPase involved in DNA replication  ali  100  1MSTSTEKRSKENLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFSKGFKLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRIANVLVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPRPSDLKAVLKSILEDDWGTAHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLLTKLADIEYSISKGGNDQIQGSAVIGAIKASFENETVKANV 340
2 -93.400[L] KOG0991 Replication factor C, subunit RFC2  ali follow..  33  25.SKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDRGIDVVRNKIKMFAQQKTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFG-----FINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLW-HLGYSPEDIIGNIFRVCKTFQMAEY-LKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVA.... 353
3 -91.700[L] KOG0990 Replication factor C, subunit RFC5  ali follow..  45  28.VGFGPPPQSKATPWVEKYRPQSLDDVAAHRDIIDTIDRLTNENKLPHLLLYGPPGTGKTSTILAVARKLYGPKYRNMILELNASDDRGIDVVRQQIQDFASTQSLGKSSVKLVLLDEADAMTKDAQFALRRVIEKYTKSTRFALIGNHVNKIIPALQSRCTRFRFAPLDGVHMSQRLKHVIEAERLVVSDCGLAALVRLSNGDMRKALNILQSTHMASKEITEEQITEEDVYLCTGNPLPKDIEQISHWLLNKPFDECYKDVSEIKTRKGLAIVDIVKEITLFIFKIKMPSA-VRVQLINDLADIEYRLSFGCNDKLQLGAIISTFTHARS........ 362
4 -72.800[L] COG2812 DNA polymerase III, gamma/tau subunits  ali follow..  22  1.........MSYQALYRVWRPQKLQDVVGQEHITKTLQNALVQEKFSHYLFSGPRGTGKTSAAKIIAKAINCSGSIVDVMEIDAASNNGVDEIRDIRDHVKFA--PSEVRYKVYIIDEVHMLTTGAFNALLKTLEEPPSHAIFILATTEPHKIPLTIISRCQRFDFKRISNDALVGRMKEILTHEGIEAEDEALVLVARAAEGGMRDSLSLLDQAISFAD----ERVTVEDVLAITGAVSHEVLTQVVESAQKGETAEALQLVNQLL-ANGKDPLRFVEDLIYYYRDLMLFKAAPEASQLL-ERAQINDSFKTLAGEINDASLFAAIEILNDCQQRMR.. 341
5 -69.700[DL] KOG2035 Replication factor C, subunit RFC3  ali follow..  24  4..............WVDKYRPKDLLGKDGVDYHIEQANKFLSADCMPHLLFCGPSGAGKKTRIKCLLRELYGVGSSNYHIEMTPSDVGIYDVVQDLVKEMAQTSSTSQRSFKVVVLCEADSLTRDAQHGLRRTMEKYANNCKIVLSCESLSRIIEPLQSRCIIINVPAPTDEDVTKVLRKVIERESFLLPENVLQKIVEKSEGNLRRAILMTEALRME----NESGVAESVVIPVPEWEIQETARLILQKQSSDMLLKVRERLYELL-SRCIPPTVIFKKLLEHLLPK--CPPQIAREVVSEAAKFEHRLVLGQKAIFHLEGFVAAFMDIYLTNASKPK. 354
6 -54.900[L] COG2256 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  19  5..SLDFSGDEDFRPLAARMRPQTVEQYIGQQHILKPLRRALEAGHIHSMILWGPPGTGKTTLAEVAANYANAE------VERVSAVTSGVKEIRAAIEKAREN--KLSGRRTILFVDEVHRFNKSQQDAFLPHIEDGTVTFIGATTENPSFELNNALLSRARVYKLTSLNQQEILQALHQAIADTAAVFADNVLDRLAELVNGDARMSLNYLELLYDMAREDDQGRIDLPLLAEVAGDIWYDLISAVHKSIRGSDPDAALYWAARMI-SAGCDPLYIARRLLAIASEDVGNADPRGMQVALAAWDCFTRVGPAEGE-RAIAQAIVYLACAPKSNAVYTAW 354
7 -54.700[L] KOG2028 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  19  90.HKLSSSSHRQHQPLSERMRPRTLDDVVGQDHLLSLLRSAVESNRLPSIVFWGPPGTGKTSIAKSLINSSKDPS-LYRFVSLSAVTS-GVKDVRDAVESAKRLNLEGRKR-TVLFMDEVHRFNKSQQDTFLPVIEDGSILFIGATTENPSFHLITPLLSRCRVLTLNPLKPNHVETLLRRAVDDSSVEVDDSVIEFLANNCDGDARVALNALEISATMATTRAGTDVSIDDAKEALGEQHYNLISALHKSMRGGDANAAIYWLARML-EGGEEPLYIARRLIRFASEDIGLADPSALTQAVACYQASHFLGMPECN-VILAQCTAYLALAPKSIAVYRAI 444
8 -45.600[L] COG2255 Holliday junction resolvasome, helicase subunit  ali follow..  17  9....SAAVINDEESIDRAIRPKLLTEYVGQPHVREQMEIFIQGDALDHVLIFGPPGLGKTTLANIIANEMGVNDLAAMLTNLEPHDVLFIDEIHRLSPVVEEIL------YPAMEDYQLDIMIGEGPAARSIKLDLPP--FTLIGATTRAGSLTSPLRDRFGIQRLEFYQVADLEHIVSRSAKCLGLELTPEGAHQLARRSRGTPRITNRLLRRVRDFAEVRADGAINGEVAMKALDMLN-DFMDRKLLLAVIDKFMGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFIQRTPRGRIATNHAYKHFGITR............................ 332
9 -31.100[L] KOG1968 Replication factor C, subunit RFC1 (large subunit)  ali follow..  19  348.DDSNKKESQPSQIWTSKYAPTSLKDICGNKGVVQKLQKWLQDGLYKAVLLSGPPGIGKTTAAHLVAKLE-------DVLELNASDTRSKRLLDEQLFGVTDSQSLMAKSRLVLIMDEIDGMSSGDRGGVGQLNMIIKKSMIIICICNDRHPKLRPLDRTTFDLRFRRPDANSMRSRIMSIAYREGLKLSPQAVDQLVQGTQSDMRQIINLLSTYKL-----SCSEMTPQNSQAVIKNSEKHIPWDICSRYLHGGMFHPSSKSTINDKLELYFNDHEFSYLMVQENYLNTTPDRIRQEPPKMSHLKHLELISSAANSFSDSDLVD............... 695
10 -30.800[K] KOG2680 DNA helicase TIP49, TBP-interacting protein  ali follow..  10  139VEVQIDRPASSGVASKSGKMTMKTTDMETVYDMGAKMIEALNKEKVQS-VIAIDKATGKITKLRSFSRSRDYDVHCVTLHEIDVINSRTQGFLALFTGDTGEIRSKAEIVPGVLFIDEVHMLDIECFSFLNRALENEMSPILVVATNKSPHGIPIDLLDRLLIITTQPYTDDDIRKILEIRCQEEDVEMNEEAKQLLTLIGDTSLRYAIHLITAAALSCQKRKGKVVEVEDIQRVYRLFLDV--RRSMQYLVEYQSQYMFSEPIKN-DEAAAEDEQDAMQI........................................................... 469
11 -28.700[DL] KOG1970 Checkpoint RAD17-RFC complex, RAD17/RAD24 component  ali follow..  21  78.LENSKEYLSENEPWVDKYKPETQHELAVHKKKIEEVETWLKAQVLERLLITGPPGCGKTTTLKILSKEHG-EWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVTDKKIILVEDLPNQFYRDSHTLHEVLRKYVRIGRLIFIISDSLSFPKEIQEEISNISFNPVAPTIMMKFLNRIVTIEANKNDKTSLELLCQGCSGDIRSAINSLQFSSSKGENNLRPRKKGMS............................................................................................................. 359
12 -25.200[L] KOG1942 DNA helicase, TBP-interacting protein  ali follow..  15  188...............VAVGDVIYIEANSGAVKRVGRSDAFATEFDLEAEYVPLPKGEVHKKKEIVQDVTLQDQMMKPRKTEITDKLRQEINVVNRYIDE-----GVAELVPGVLFIDEVHMLDMECFSYLNRALESSLSPIVIFATNRGPHGVPIDLLDRLVIIRTQIYDPSEMIQIIAIRAQVEELTVDEECLVLLGEIGRTSLRHAVQLLSPASIVAKMNGRDNICKADIEEVTSLLDAKSSAKLLHEQQEKYIS................................................................................... 458
13 -23.500[R] COG2607 Predicted ATPase (AAA+ superfamily)  ali follow..  17  38....QSAGKKGFLEHLPDPHTFPLVRLAGTELLVRNTEQFIVGRPANNVLMSGARGTGKSSLVKALLHEYADKGLR--LIEVDKSDLIGLPYLLTLLKECPEK---------IVFCDDLSFESGDTYKALKTALDQRCANVLVYATSNRRHLMVEEKISLSDRFGFYPFDQNDYLAAVQNWLEDFGVPYDETALQWAQTRGSRSGRSAWQFACDWAG........................................................................................................................... 279
14 -20.200[LO] COG1474 Cdc6-related protein, AAA superfamily ATPase  ali follow..  14  26IFKNKEVLRPSYTPDLLLHRNEQINSLA------TILVSALRGETPSNVLIYGKTGTGKTAVTRYVGKELE-KSLFCSVVYINCEVDTQYRLLANLARHFEEEVPMTGWPTDIIILDEIDKLIKKGDDVLYNLSRINTAKVSMIGVSNDTEFLDPRVKSSLEELIFPPYDAEQISDILKQRAKMNDGVLGEMVIPLCAAFAHGDARRALDLLRVSGEIAERENQPQVLEEHVRRAQEKIEIDRVVEVVRTLPTQSKLVLYSIILLRSRGREGKNVTTMYNVYRQLCHHIDVDILTQRRVTDLMSELDMLGIYGRTKEISLSVPVENTRKVLLEDYRLKPL 407
15 -18.800[L] COG1466 DNA polymerase III, delta subunit  ali follow..  12  10...............................TSFDDFSQAYAEKV-PAIALIGSA-------LEDDKDALIELLVSESFKELGG-QGLMPATLMSWTETF-----ALFQEHETLGIIHAEKFPLATKEFLSRYARNPQPHLTILIFTTKQEKALPSALSLSLFGEWPADRQKRIIRLLLQRAERVGISCSQSLASLFLRALASSLPDILSEFDKLLCSVG--KKTSLDHSDIKELVVKKEKASLWKFRDSLLKRDPVEGHQQLHFLL-EDGEDPLGIITFLRTQCL-----------YGLRSIEEGSKENKHRMFVLYGKERLHQALNSLFYAETLIKN. 296
16 -18.700[LD] KOG2227 Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase  ali follow..  15  110MRAVKEALHVSKAPSTILCREDEQIRI------FEFVKGCIDQQKAGSLYICGCPGTGKSLSMEKVVQQVGDWSTQAGLLSVNCTSLSKTTDIQHLQNLFSQKQESSSSRMMLIIADEMDYLITKDRGVLYDLFMLPFSRCILIGVANAADRFLPKLKSL-MVITFRAYSKDQILRILQRLRVLSYVAFQPKALELCARKVSGDMRKALCVCRSALEILEIETRGSVRMDHMAAALSKTFKSPVVETIQSLPQHQQIIICAAAKAFRGSKKDATVGELNKLYLEICKSWMISPAGITEFTNMCTVLNDQGIRDKLKRVSLRVDESDITFALQVNSLFILF 503
17 -18.200[S] COG4916 Uncharacterized protein containing a TIR (Toll-Interleukin 1-resistance) domain  ali follow..  12  2.........VDKKTLGDVFKTVGLPPYVKPKHFGEVRADISQVGK--HLLIEGPSGIGKTCVVFKVFEEL-QWSQGRDFTYVGCRDQNAEQIIDDFLKNAAAGNALSP---CVLVIDDFHLLSQAKRMEIGSTLKRLSEPAKVILIGVSLLSDAYDLGPRLGSYALTRASDVEIDKLISE---EQALAVLFEDRDVLLAESAGNFWLAQYVCNKVCAIEEVYETQDDAKILTFDI------LGIRGRLMAELTQRYLPIARTFAK........................................................................... 257
18 -16.300[O] KOG0739 AAA+-type ATPase  ali follow..  19  125......................RWNDVAGLEGAKEALKEAV-RTPWRGILLFGPPGTGKS----YLAKAVATEANNSTFFSVSSSDGESEKLVKNLFELARQHKP------SIIFIDEVDSLNENESEAARRIKTEFNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARAQMRLHLGSTPHNLTDANIHELARKTEGPVRKVQSATHFKKVCGPSRTNPSMMIDDLLTPCSPGDPGAMEMLEPVVCMSDMLRSLATTRPTVNADDLL................................................................... 424
19 -15.900[R] KOG2170 ATPase of the AAA+ superfamily  ali follow..  15  66...............YHTLDADIANLLFGQHLVKDVVVNSIKSHWYNELSFHGYTGSGKNYVAEIIANNTFRLGLRSTFVQNDFPDKNKLEEYQVELRN-RILTTVQKCQRSIFIFDEADKLPEQLLGAIKPFLDYYSRRSIFILLSNKGGGEIARITKEQYEVPFLPLQREHVRSCVGAYLRKRGLVSNVDFVERVLNSSSSGCKRVDAKTDLEMA........................................................................................................................... 341
20 -15.800[O] COG1222 ATP-dependent 26S proteasome regulatory subunit  ali follow..  21  146......................TYEDIGGLERQIEELNEAIV---LTHVLMYGPPGTGKTLMARACASKT-----NATFLKLAGPQGDGARLVRDAFALAKERKPT------IIFIDEIDAIGAKRSDSLLNQLDSSSEEVKIIAATNRVDILDPALL-RSGRLDRKPLPNTLGRKRILQIHARKMSVRDDVNFDELARSTEG--AQCKAVCVEAGMAALRKEKTEISQNDFMDGIQEVLSRKKSKLL............................................................................................ 398
21 -15.600[O] KOG0728 26S proteasome regulatory complex, ATPase RPT6  ali follow..  21  139...............VEKVPDSTYEMVGGLDKQIKEIKEVIE---VKHVLLYGPPGTGKTLLARAVAHHT-----ECTFIRVSGSEGEGSRMVRELFVMAREHAPS------IIFMDEIDSIGSSRIESLLNQLDEATKNIKVIMATNRIDILDPALL-RPGRIDRKPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPG--AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNM............................................................................................ 398
22 -15.600[L] KOG1514 Origin recognition complex, subunit 1, and related proteins  ali follow..  14  380LEKAKATLLLATRPKSLPCRSKEMEEI------TAFIKGSISDDQ-RCMYIHGVPGTGKTISVLSVMKNLKAEVEAGSVVEINGLKLASYEGLSGHRVGWKKALQSLNERFAILLIDELDVLVTRNQSVLYNILDKPNSKLVVLGIANTPEKLLPRISSRMQRLCFGPYNHRQLQEIISTRLEGINA-FEKTAIEFASRKVSGDARRALEICRRAAEVADYRLKKSVIMADVEVAIQEMFQAPHIQVMKSVSKLS-RIFLTAMVHELYKTGMAETSFVATTVSSICLTNGEAFPGWDILLKIGCDLGECRIKHRLQKLQLNFPSDDVAFALKDNKDLPWL 767
23 -15.300[O] KOG0727 26S proteasome regulatory complex, ATPase RPT3  ali follow..  21  153......................SYNDIGGCDIQKQEIREAVE---LTHVLLYGPPGTGKTMLAKAVANHT-----TAAFIRVVGSEGEGPRMVRDVFRLAKENAPA------IIFIDEVDAIATARFDALLNQMDDQTVNVKVIMATNRADTLDPALL-RPGRLDRKPLPDRRQKRLVFQVCTSKMNLSDEVDLEDYVSRPDK--AEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDF............................................................................................. 404
24 -15.200[R] COG2842 Uncharacterized ATPase, putative transposase  ali follow..  16  70......................AFIETATSRQIFKTLEFAQIANCLA--TVYGMSGVGKTKAIQEFAK----SHANVWLVTASPSRSSLSEILYEIALELRLIARKIKGTEGLLIVDEADHLPYEALEELRIMQEEAGIGLVLVGNDKVYTRMYARLWSRVKNTSIQKTKKADT----QAVAQAWGLETDEEALKVMQSITEGGLRILTQTYACRNGS.......................................................................................................................... 280
25 -14.900[O] KOG0737 AAA+-type ATPase  ali follow..  17  412......................TFADIGSLDETKESLQELVM-KPCRGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTI-GEDEKNVRALFTLAAKVSPT---------IIFVDEVDSMRVGEHEAMRKIKNEFGDRILVLAATNRPFDLDEAIIRRFERRIMVGLPSVESREKILRTL--SKEKTENLDFQELAQMTDGDLKNAYRPVRELIKQECLKDQERRKREEAEKNSEEGSEAKEEVSLRPLSMEDMKVAKSQVAASFAAEGAGMNELKQ............................................................. 706
26 -14.900[O] KOG0651 26S proteasome regulatory complex, ATPase RPT4  ali follow..  20  148......................SYSDVGGLAEQIRELREVVE----KGCLLFGPPGTGKTLLARAVASQLDCN-----FLKVVSSAGESARMIREMFNYARDHQPC------IVFMDEIDAIGGRRFSELLNQLDDSLGKVKVIMATNRPDTLDPALL-RPGRLDRKGLPNEQSRLEILKIHSNKITKHGEIDFEAVVKLSDG--ADLRNVCTEAGMFAIRAEREFVIDEDFMKAVRKVGDAKRLET............................................................................................. 399
27 -14.800[R] COG0714 MoxR-like ATPases  ali follow..  17  5...............ISVLTQNLSQTIVGKDEAIRLVLVALLSG--GHALLEDVPGVGKTLLAKSLARSINGKFQRVQCTDLLPTDITGTNIWNPSSREFEFLPGPAFA--NILLADEINRATPRTQAALLEVMEEKQVTV-FVIATQNPIEYQGTFEAQLDRFALS-ISLEEVEALQKAV---RQVKLTEDLQQYLLRLVRASPRGTTALQRATQAFAFLEERDYAIDDDVKFVAPHV----------------------LAHRLIPASGKDPKAILQRLLDSV....................................................... 301
28 -14.700[O] KOG0652 26S proteasome regulatory complex, ATPase RPT5  ali follow..  19  162...............VDEKPTEDYNDIGGLEKQIQELVEAIV---MTHVLLYGPPGTGKTLMARACAAQT-----NATFLKLAGPQGDGAKLVRDAFQLAKEKAPC------IIFIDEIDAIGTKRFDSLLNQLDSSDERIKVIAATNRADILDPALM-RSGRLDRKPHPTEEARARILQIHSRKMNVHPDVNFEELARSTDD--AQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASL............................................................................................. 420
29 -14.600[R] COG1223 Predicted ATPase (AAA+ superfamily)  ali follow..  21  103......................TLDDVVGQEEAKRKAKVILEYLRNPEVLFYGPPGTGKTMMAKALSNEA-----KTPFLSVKSTK--GARRVHELYERARQLAP-------IVFLDEFDAIVSEIVNALLTELDNSNEGICTIAATNRVELLDASIRSRFEEEIEFRLPSYEERLEILRRNLEEFPVPVKARLELVAAASEGDLVEKVI--KASLHKAIAEGKDKIETEDLLTKMPSRQPPKQMFV............................................................................................. 352
30 -14.600[O] KOG0726 26S proteasome regulatory complex, ATPase RPT2  ali follow..  19  164....DDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVE---LTHVILYGPPGTGKTLLAKAVANQT-----SATFLRVVGSEGDGPKLVRELFRVAEEHAPS------IVFIDEIDAVGTKRYDSLLNQLDDSRGDVKVIMATNRIETLDPALI-RPGRIDRKPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDD--ADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEG.............................................................................................. 432
31 -14.600[O] COG1219 ATP-dependent protease Clp, ATPase subunit  ali follow..  20  48IIREEVQEAQAESSGHKLPAPKEIRTVIGQERAKKVLAVAVYNHGKSNILMIGPTGSGKTLLAETLARLLNVPFTIADATTLTEAGYVG-EDVENIIQKLLQKCDVEKAQMGIVYIDEIDKISRGVQQALLKLIEG-TRNILFICGGAFAG-LIPEFVGRLPVI-LDELDEAALMQILTEPKNA-DLEFRPDALKAVARKAKTGARGLRSILEGILL........................................................................................................................... 381
32 -14.200[F] COG1618 Predicted nucleotide kinase  ali follow..  15  1....................................MRIEGKEKTMLRIAVTGSPGVGKSTVVAKTAEKLEGHREGFSIRDLATGKTGILHVNLDDLERIGANAVRNALACDLVVIDEIGPMELISVSAVEEVLES-DKPVLAVLHHSSRHPLAQRFRKGFEVLTVDKGNRDELPEKITNRFLR............................................................................................................................................................ 181
33 -13.400[U] COG3267 Type II secretory pathway, component ExeA (predicted ATPase)  ali follow..  18  19....................ARYLYLSQRHQEAIVHLQAGLGDGG-GFAMLTGEVGTGKTTVARAILASLPGKTRAGMIFEVSYPKKATLKKLTQVLHEFL-LAEHAQGIQVLLMIDEAQHLAPDVLEQLRLLLETESHKLLKVLLIGQPE--LRQLAQRITRYHLLPLNEEQTADYIRFQASGNPELFNRKACQWIAEQTHGIPRLINLVCDAALKQAYQAGEPTLSLARIKLAC........................................................................................................ 262
34 -13.400[O] KOG0729 26S proteasome regulatory complex, ATPase RPT1  ali follow..  22  166...............VEEKPDVTYSDVGGCKEQIEKLREVVE---LLHVLLFGPPGTGKTLCARAVANRT-----DACFIRVIGSEGEGARMVRELFEMARTKKAC------LIFFDEIDAIGAGGDNEVQRTMLEPRGNIKVLMATNRPDTLDPALM-RPGRLDRKSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPN--AEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKF.............................................................................................. 423
35 -13.400[H] COG1239 Mg-chelatase subunit ChlI  ali follow..  10  33.RRLVQDEVRDNLTRKLRSGEELFPGVVGYDDTVPQLVNALLARQ--NFILLGLRGQAKSRILRAITELLDPEVPVIDGVDMPDDPLNGDVDPIKAARLGTSLGLLPRANRGIFAVNELADLSPKVQVALFNILQEIRLELDVMLVFSARGKIVTPLKDR-IRTHYPTDVQLGMDITAQEAVKEEGVVVPPFIAELIEDIAF-SQRLPISLMELACANAERRSLVSGDAPVVRVTDVYAGLPAITGKMELEYEGELKGADNVAKDLIRK....................................................................... 382
36 -13.300[O] KOG0743 AAA+-type ATPase  ali follow..  19  707...................HPSTFETLA-KKKIIDDMERFLKRREF--YLLYGPPGTGKSSLIAAMANYL-----KFDVFDLELSSIYENAQLKSILLSTTNRS--------ILVIEDIDCSGRVTLSGLLNFVDGLWSSFIIVFTTNHKERLDPALLSYCTGLGFRTLLNHPLCEEIEALIDSTEVTPAELAEELMQDDTDVVLRGVVSFVENRKVEISKTKELEGSTCR............................................................................................................. 963
37 -13.100[O] KOG0740 AAA+-type ATPase  ali follow..  18  399......................NWEDIAGVEFAKATIKEIV-RGPPKGILLFGPPGTGKTLIGKCIASQS-----GATFFSISASSGEGEKMVRALFAVARCQQP------AVIFIDEIDSLGDGEHESSRRIKTEFEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQVINLMSKEQCCLSEEEIEQIVQQSDAFSGADMTQL------------RGASLGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSPKDLE................................................................... 661
38 -12.200[O] KOG0733 Nuclear AAA ATPase (VCP subfamily)  ali follow..  20  172......................SLSDIGGLDDCINELLELVA-HPPRGVLLHGPPGCGKTMLANALANELGVPFISISAPSISGMSGESEKKVREVFEEAKSLAP-------LMFIDEIDAVTPKIVAQFLTCMDTDGKPVLVIGATNRPDSLDSALRGRFDREICLTVPSQDAREKILRTMAKGLKLSGDFDFRQLAKQTPGYVGADLKAL................................................................................................................................ 388
39 -11.900[L] COG1484 DNA replication protein  ali follow..  14  60MAERKVKRLLGASEITHAFRQLGFKEF-AIKDAFECTKEYVADCRKNSIALLGQPGSGKTHLLTAAANELMRTCYVPVIY---FPFVEGFTDLKNDFALLEAKLNRMK-QADVLFIDDLFKPVNGKPRA-----TDWQLEQMYVLNYRYLNHKPILLSSELTIEGLVRVD-EALGTKIYEMCSDYLVIIKGAAYELNHRLEG.......................................................................................................................................... 264
40 -11.900[O] KOG0730 AAA+-type ATPase  ali follow..  16  238......................GYDDVGGVRKQMAQIRELVE-KPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEI-GESESNLRKAFEEAEKNAPS---------IIFIDEIDSIAPKIVSQLLTLMDKSRAHVIVMGATNRPNSIDPALRGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGDLAALCTALQCIREKMDVIDLEDDSIDAEILNSMAVSNEHFHTALGNSNPSALRETVVEVPNVSWEDIGGLENVKRELQETV....................................................... 529
41 -11.600[R] COG1373 Predicted ATPase (AAA+ superfamily)  ali follow..  14  26.....................KKLDESLMKWSPRLLSELKFDRDRI--YTLRGPRQVGKTTLVKLIIRELLETIEHQSIFYFTCDLVADEKELFEVLDLYLKWAAAFRLERKYIFLDEISSV-RDWEKGLKYLVDTGALNNATVVLTGSIKSSIERLPGR------RGEGEGTLDKIFFPMKFSEYAETLNSDLKQFMEANGGGIPRAVNEFFSKNKIDSSIYEIYIQSLIGDLARWNIPEMPVKQTLRSIAGKLTTPV--SWRSITDETDIGAHVTVRKYVTALEDSFVL................................................. 332
42 -11.600[R] COG3911 Predicted ATPase  ali follow..  18  1........................................MQNDFDRVFVLTGGPGSGKTTLIAALRRA---VVAGRGIVRDQSSIGGTTLFAELMLSWEMRSYQNAVEQKGPVFFDRLRLSGLPVADHVSTAAKRFRYNPRVFIAPDEAKCTYHALAEIYTELGYEPLPLAPVETRLRFVLADAGLN........................................................................................................................................................ 183
43 -11.400[L] COG0593 ATPase involved in DNA replication initiation  ali follow..  12  122.................KHLFDNF--VEGKSNVGQKLAQAPGEPSANPFFLYGGTGLGKTHLLHAIGNGILADKPNARVLYIHANN----HMVKAVRDNKMDQFKKFYRSLDALLVDDIQFFAEKTQEEFFHIFNSFETGRQIILTSDRYPKEIEKIEERLSRFAIEPPDLETRVAILLKKAEEHNMNLPEEVAFFIAQRLRTNVREALNRVKAMQDFKGGDIDIDFVRDTLKDILALQERLVTIENIQKVVAEYYRIKVSDLKSKSRARSVTPRQIAMALAKELTNRSLPEIGRATTVLNACREVPKFREQDNSIQEDWANLIRTLS............ 453
44 -11.400[QK] COG3284 Transcriptional activator of acetoin/glycerol metabolism  ali follow..  17  326....................PPALRRLGGDAPVIAALQAKAAKRTRLPILIQGETGTGKEHLARAIHEAINCAAIPEQLIEFTGASAKG------------RKGLIEQADGGTLFLDEIGDMPLALQSRLLRVLAE-KVRIRIVSASHSQGAFREDLYYRLNAATLDRPDFDWVLEQLLKRHGDGELILSPAALSALKAHDPGNIRELDNVIGVAAALA---ENGVVELGDLPDQLLANADTVGGNEASATLSLTLTACNWNISEAARRLGLDRSTVHRQIKRY........................................................ 620
45 -11.400[O] COG0465 ATP-dependent Zn proteases  ali follow..  16  150......................SFADVAGCDEAKEEVSELVDGGKIPKVLMVGPPGTGKTLLAKAIAGEAKVP-----FFTISGSD--GASRVRDMFEQAKKAAP-------IIFIDEIDAVHDEREQTLNQMLVE-GNEGIIVIAATNRPDVLDPALLRPGRFDRQVVGLPDVRGREQILVHMRRVPLDTDIASVIARGTPG--ADLANLVNEAALFAARGNKRVVSMVEFEKAKDKI-------MMGAERRSMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPEGDAISASRQKLESQISTLYG............... 471
46 -11.400[O] COG0466 ATP-dependent Lon protease, bacterial type  ali follow..  20  315...............IDEARRVLESNHNGLEKVKERIIQHLAVMKLSILLLTGPPGTGKTSLGKSIADALGREYVRISLGGVDEAEIRG-TYIGALPGRIIQGMRKAGTKNPVFILDEVDKLSTDPASALLEVLDPEQSEVFFIATANSLASIPWPLLDRMETIEISGYTKNEKLAIAKD-LDADKLKIEDEALKGIIDTREAGVRGLKKQLARTIVSGKTDLPYVVRADMLKEVLG....................................................................................................... 583
47 -11.400[O] COG0542 ATPases with chaperone activity, ATP-binding subunit  ali follow..  22  567........................KRVIGQHEAIEAVSNAIRRSRIGSFLFLGPTGVGKTELCKTLANFLFDD--ENAMVRIDMSEFMEKHSVSRLVEGGYLTEAVRRRPYSVILLDEVEKAHHDVFNILLQVLDD--RNTVVIMTSNLGSHLIPEFINRIDET-FHPLGKENIREQLARLIKR-QLHFTDACLDFIGEVGVYGARPLKRAIQQ.............................................................................................................................. 821
48 -11.200[O] COG0464 ATPases of the AAA+ class  ali follow..  17  214......................MYEDLGGLKDAISKVREMIE-DAPKGVLLQGPPGTGKTMLAKAVANESDAYFISINGPEISKYYGESERAIREIFEDAEKNAP-------IIFLDEIDSIERRVVAQLLSLMDKARKNVIVIGATNRPEALDIALRGRFDREIELRVPDTEGRLEIFQIHTRGMPLADNVNLMDFAQITYGFVGADIAALSALRRILPKINLNEPEISKEILDALQVTREDFENALKDVQPSAIREILIEVPNVSWEDVGGLERVKELLKEVV....................................................... 505
49 -11.200[O] COG0606 Predicted ATPase with chaperone activity  ali follow..  18  190......................DLQDIIGQQQGKRALEIAAAGNH--NLLFLGPPGTGKTMLASRLCDLL----------EMSDEEAMETASIASLTQQEINQHNWKLRPFRLLFLDEMPEFERKVLDSLREPLESFPARFQLVGALNYLSRLSGPLLDRFDSIEIPALPKGTLANGGDRGESTAAVRLLKADAEFLESALH-SIRAYHRIIKVARTIADLQGEAQIARPHLAEALG....................................................................................................... 491
50 -11.100[O] KOG0741 AAA+-type ATPase  ali follow..  14  216......................EKMGIGGLDKEFSDIFRRAFAFRVFPILLYGPPGCGKTLLARQIGKMLNAR-----PKVVNGPEGESEANIRKLFADAEEEQR-ANSGLHIIIFDEIDAICKQVVNQLLSKIDGVEQNNILVIGMTNRPDLIDEALLRPGRLEVKEIGLPDEKGRLQILMRGHQLLSADVDIKELAVETKNAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDY......................................................................................... 499
51 -11.000[O] KOG1051 Chaperone HSP104 and related ATP-dependent Clp proteases  ali follow..  18  171..............LTELARNGQLDPVIGREDEIRRTIRVLSRRTKNNPVLIGEPGVGKTSIAEGLARRIIDDDSNCKLLSLDGSKFRG-ERIKSVLKEVEESETPI-----ILFVDEMHLLGMDAANLLKPMLARGKLHCIGATTLAEYKKYIEAFERRFQIILVKEPSIEDTISILRGLKEKHGVTISDRALVTAAHLASRYLTSAIDLVDEAAA........................................................................................................................... 403
52 -10.900[O] KOG2004 Mitochondrial ATP-dependent protease PIM1/LON  ali follow..  20  469...............LSVAKKALDEGHYGMKDVKERIMEFIAVNLLKILCFHGPPGVGKTSIAKSIATALNREYFRFSVGGMDVAEIKG-TYVGAMPGKMIQCMKKVKTENPLVLIDEVDKIGGDPASALLELLDPEQSRVLFICTANEISKIPGPLRDRMEMIDVSGYLAEEKVEIAHQ-LATEQLKIEDSALEELIKCRESGVRNLQQHIERI............................................................................................................................. 709
53 -10.700[F] COG2019 Archaeal adenylate kinase  ali follow..  15  3................................................SVITGVAGVGKTTVLDIVARESGIPVVNYGTLMFEVAKRRGLVENRDQIRKLQKLAGEEIGKMENAIVD-SIKTPFGYLPGLPEWVLRSINASVFVIIEADPAIIKRRRDNDPTRARDDEGVDSIREHQEMNRYFAAAYSIFSGATVKIVKNEEGKPEQAADEIVRVIK........................................................................................................................... 181
54 -10.600[R] COG3910 Predicted ATPase  ali follow..  12  10.................KEKPEGREEYPFSVPAMRHLERLEFKTPI--TFFAGNNGSGKSTLLEGLAAGMTAYAEETPEIFRGIVRNNSLDRRSHGEGFLDIMHRRLHGA-GLYFLDEPESLSPQKQLELAAIIRQAADSGGQLIIATHSPVLLAIPEATIYYFDEDGITERLYDELENIAFLRRFLDRPSKYLD................................................................................................................................................. 257
55 -10.600[K] COG1224 DNA helicase TIP49, TBP-interacting protein  ali follow..  17  39..........................LVGQKRAREAA-RLIKSGKMA-ILMAGPPGTGKTAIAVAISKEL---GKDIPFVQVSASESAEMKKTEALIQAMRKAIGVRIRETRTVLEGEVVGLDYELFAFMNRAMESEMAPIIILASIVAPHGIPLDLLDRLLIITTEPYSREEIKTIIEIRAAESGIMLSNEAMEKLTDIGKTSLRYAVQLLAPAYEFAKMRNSGKVELEDVERA......................................................................................................... 425
56 -10.500[K] COG2909 ATP-dependent transcriptional regulator  ali follow..  14  5...............SKLSRPVRLQNTVVRDRLLVKLSSAANYR----TLINCPAGYGKTT----LIAQWAADQSNLGWYSLDESDNQSERFATYLIAAIQLATGGHCSKSEYLVIDDYHLITNDAHEAMRFFLRHQPENLTLIILSRTLPSL--GIANLRVRDQLLELGMQQLAEAQQFFECRLSSPLEQGDSSRLCDEVEGSSRQPNSSAQKSAKRLAGLNASHLSDYLVDEVLDQVDSKARAFLLRCSVLRSMNDAL--IVRLTGED--NGQQLLEELER......................................................... 303
57 -10.400[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  12  2...................................SIVRLKKLEQPVFLIVAGPNGSGKSS----VYANADLELEGRSVWIVNP------DLLAGRISEVEN--------------KPLPEANLVAVQRIEAWIQS-SVHKTIGVETVLSTDKYRRLVEAAEAVGFAIWSPERSIERIKLRVAKGGHDVPADKVRARYARSLDQLPWFLERADRAWIWDNSGATPKL................................................................................................................. 177
58 -10.300[O] KOG0731 AAA+-type ATPase containing the peptidase M41 domain  ali follow..  17  318......................YFKDVAGCDEAKQEIMEFVHGAKIPKALLVGPPGTGKTLLAKATAGE-----SGVPFLSISGSD--GPSRVRHLFQEARQAAP-------IIFIDEIDAINDERESTLNQLLVE-TTAGVVVLAGTNRPDILDKALLRPGRFD---IDKPDIKGRDQIFIYLKKIKLDHEPSQRLAALTPG--ADIANVCNEAALIAARHEGATVTMAHFESAIDRV-------IGGLEKKNRVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTCMTLG............... 641
59 -10.300[O] KOG0734 AAA+-type ATPase containing the peptidase M41 domain  ali follow..  15  280......................TFEHVKGVEEAKQELQEVVEGGKLPKILLVGPPGTGKTLLARAVAGEADVP-----FYYASGSE--GASRIRNLFREAKANAP-------VIFIDELDSVHPYSRQTINQLLAE-PNEGVIIIGATNFPEALDNALIRPGRFDMQTVPRPDVKGRTEILWYLNKIKFDQSVPEIIARGTVG--AELENLVNQAALKAAVDGKEMVTMKELEFSKDKI-------LMGPERRSVEIDNKNKTITAYHESGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQMDVSMG............... 599
60 -10.300[KE] COG3283 Transcriptional regulator of aromatic amino acids metabolism  ali follow..  14  195...............LSTQDLSAFSQIIAVSAKMKHVVEQARK---APLLITGDTGTGKDLFAYACHQASPRSAKPYLALNCASIPEDAVES-----ELFGHAPEGKKGFFEQVLLDEIGEMSPRMQAKLLRFLND-HVDVRVICATQK-YRLLPPLRDCPQDI---MPLTELFVARFADEQGVPRPKLSADLSTVLTRYGPGNVRQLKNAIYRALTQL---EGYELRPQDIVAVGEDAMEGSLDDITSRFERSVLTQLYRSTRKLAKRLGVSHTAIANKLREY........................................................ 504
61 -10.200[G] KOG3354 Gluconate kinase  ali follow..  15  17................................................FVVIGPAGSGKTTMAKAVSEKLGFEYIEGDDLHPKANIEK--DNDRHNCGGACAMELDKESIKGVVL--TCSALKRSYRDILRSSLEHRPAILRFIYLAASRETLIKRTTSRKNHY----MKADMVESQLAIL---EAPTADEKDVITIENGKEQSEEECLDIVHKMVN........................................................................................................................... 188
62 -10.200[R] COG3972 Superfamily I DNA and RNA helicases  ali follow..  210.............................QRRAALVTID-------GPQRIRGLAGSGKTVILAMKAAHLHMTRPNDKILVT--FFTKSLSPIKDLVTKFLINSAQSLEYYDHILIDEGQDFPDGFYKLCFELAKGDRDKKNIVWAYDELQNI........................................................................................................................................................................................... 388
63 -10.200[R] COG4152 ABC-type uncharacterized transport system, ATPase component  ali follow..  10  5.....................DHVTKTFGDYKAVDGLDLDIPEQQMFGLL--GANGAGKTTTFRMILGLLSITEGSISWFNITDYENKKVEELAKGNQQKIQFISAVLHKPELLILDEFSGLDPVNVELLKEAVISLKNSGVSILFSSHRMEHVEELCENLCILQKGKPVVQGKLKEIKRSFGKKNVTIHSDDDLRFLQSHEG......................................................................................................................................... 241
64 -10.100[L] COG0507 ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member  ali follow..  16  15FVGWPAKSALAPGGRILTLKVMQFAP--QQDEALKAVSQWLKGGRSQLFRLFGYAGTGKTTLARHFAENVDGE------VVFAAFTGKAAQVLRSKAPMFAINRQSPVAKAALIIVDECSMVDEALGKDLMSFGTP-------ILVLGDPGQLPPVFTNHEPDFLLTDIHRQARDNPIIQLAMREGKEIMHGDYGTAQVISKGQVTQPLVLEADQVLVGTNRTRRRYNQR.............................................................................................................. 267
65 -10.100[L] KOG2228 Origin recognition complex, subunit 4  ali follow..  14  560..............................TKLYQWVRQTIVLGEGNSVIIVGPRGSGKSVLVDDILSRAAQENEKSYVVRLNGTDDKLA--LREISRQLSIELESIESDEAIFVLEEFDLFVQHSRQMLLYNLQSRKAPILIIGLTTRSESLEKRVKSRFSHPMRPPSSLSEFEQILKSVLYVSDEGGKDQIITC-VDELLSDTRSHLHLVQHHYFASRNLKLLYVDLLFPILSMAPDRPLLADEDFANISLKVSDHKVELVKNL.......................................................................... 848
66 -10.100[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  11  3........................................VKPFFVRTVAILGGESSGKSTLVNKLANIFN-WEYGRDYVFSHLGGDEIADYDKIALGHAQYIDFAVKYANKVAFIDTCKKYEGREHPFVQALIDEYRFDLVILL--VDRKEFQNLLVEMLEEIEFVRVEEEDYDSRFLRCVE............................................................................................................................................................. 177
67 -10.100[R] COG0645 Predicted kinase  ali follow..  4................................................AVTHGVSAVGKSQVAMRLVEALRSDIERKRLFGEQPEHDRG-QASEATYAHLHQLAAKILQAGYPVVID-AAYLKQNQRQAACHIAEETGVPFLILDCQAPEAVIAGWLAQRQA--EGKDPSDATLDVIRTQQATREPLTAAETVQSKRVDTHAASLDGLVDGIRQ.............................................................................................................................. 180
68 -10.100[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  14  2............................................LLPNILLTGTPGVGKTTLGKELASKS-----GLKYINVGDLARE--EQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTD-----TNVLYERLETRGYNEKKTDNIQCEIFQVLYEEATASYKE--EIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS................................................................................................................ 172
69 -10.000[T] COG2766 Putative Ser protein kinase  ali follow..  12  75.......................FEEFYGMEDAIEQIVSYLKHAKKQILYLLGPVGGGKSSLAERLKSLM--TKFRVVKVWPSILEQIAIAKTENDPDAYGYSGALCRANQGIMEFVEMFKAPIKVLHPLLTATQE-PFNGIILAHSNRNNKNNEAFLDRVYIVKVPYCEEIKIYEKLLNHSELAHAPCAPGTLETLSRFS-----ENSSIYSKMRVYDGESLKD--TDPKAKSYQEYRDYAGVDEGMNGLSTRFAFKILRVFNFDHAEVAANPVHLFYVLEQQIEREQFPQEQAERYLEFLKGYLIPKYAEFIGKEIQ..................... 488
70 -9.990[R] COG1672 Predicted ATPase (AAA+ superfamily)  ali follow..  12  2..........................FLDRERELQFLERRYEMGGPEFIVIYGRRRVGKTA----LLLEFISRHGGIYLLARETSNLENLKRFSDRLSEFLEYLNQKATERLVVVIDEFPYLDRSLPSILQEYWDLKLSNGRIFLIISMMEKLLSPIYGRRTQINLKPVDFLHAREFLPGYSLEDFIKA---------YGILGGSPAHLLEFDDSKTIKENLLEYLRSDSLLYQREELEEPRNYFAIMEAVAAG--KTSLGEIMNETGLSRATVAKYLSVLIE......................................................... 278
71 -9.990[O] COG4133 ABC-type transport system involved in cytochrome c biogenesis, ATPase component  ali follow..  13  5.....................RELLCERDERTLFSGLSFTLNAGEW--VQITGSNGAGKTTLLRLLTGLSRPDAEALAQAGLAGFEDIPVNQLSAGQQRRVALARLWLTRATLWILDEFTAIDVNGVDRLTQRMAQHTEQGGIVILTTHQPLNVAESKIRRISLTQTRA........................................................................................................................................................................... 204
72 -9.930[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  10  1.............................................MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISENNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYI-KGYRYELYCMSKVSRTTQCTVFTCIPQEEAWTFNSQRTAPDE-VPYTRETFDALCQRYEEPQSNNRWDSPLVVVLPKDTLDMEAIYKALYESQPLPPNQSTAPLGTTNYLFELDKIVQAIIKEILGAVKIKAFGQL--RIPGSRNPVKVATSMNALQLNRLRQKFITSTCHASQTSPTPLEQVPHLFVQFINANTI..................... 297
73 -9.920[R] COG5545 Predicted P-loop ATPase and inactivated derivatives  ali follow..  11  339ISKEQAKSVVLELALANSYSPKLAERYFGTNDLIAAVARAFEPG----TILQGKQKSLKSTFWEILAGEEFFTD------DLNGTEKDEVLKISQY----------------ILEYAEFENSYKKKDVSQLKAFEDFPRPSILVGTTNLDEFLYDPTGER----RFWVIKVLFKK------IPIKMLQQERDLIAAVAAYRNGE-----VEDEWLDAANKQYQSTDTWEEAVMAWAELQKEVSVGEILSDVLKIELAKQQNRVAAILRSHGWT................................................................... 636
74 -9.880[KT] COG3604 Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains  ali follow..  18  189.....................RDSVEIIGNSGPMLAMKADIDV---FNILIHGETGVGKELVARTIHQYVNCAAIPENLLESE-GHVKG---------AFTGADRARMGKFALLFLDEIGELPLSAQSKILRALQN-TVDVRILAATNEAGRFRADLYHRLSVYPIYSLLAGYFVEQARRKLGITQLKLHGDVLSQLIQYPPGNVRELEHVINRAALKAKA....................................................................................................................... 427
75 -9.800[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  14  2...............................................LIAITGTPGVGKTTVAKLLAKKLNYEYVSLKDFALEKGCGRRVNDEVEVEIDELAYFIERELKGKNAVLDG---------------LSHLMPVDLVVVLRAHPKLIGERLRER--GYDREKIGENVEAELVDAVLIEAIEEHENV---IEVDTTNKSPEDVVEEIVSLINSGIKKRVGIVD................................................................................................................ 163

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.