current user: public

If you have questions about the server, please let us know.

Query: [J] COG0480 Translation elongation factors (GTPases), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690
# Score Template Links and tools%idFirst MARINPLEKVRNIGIAAHIDAGKTTTTERILFYSGIIHKIGEVHEGTAVTDWMDQERERGITITAAAISTSWKDYQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGANFYRVHEQMRDRLRANAIAIQLPIGSENDFKGIVDLVRKRAYMYNNDQGTDIEETDIPADLQDQVEEYYTKLVEAVAETDDDLMSKYFDGEPLTEEEIRSALRKGTIAGTIVPVLCGSAFKNKGVQLMLDAVVDYLPAPTEVPPIQGTLPNGDAIERRADDNEPLAALAFKIMADPYGRLTFVRVYSGVLKKGSYVLNATKNKKERISRLVLMKADDRQDVEELRAGDLGAALGLKDTLTGDTITDEGAPVILESLFIPEPVISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVNVDPETNQTVIAGMGELHLEILVDRMLREFKVEANVGAPQVAYRETIRKPVTNVEGKFIRQSGGKGQYGHVVINLEPGEPGTGFEFVSKIVGGVVPKEYIGPAEQGMKESCESGILAGYPLIDVKATLVHGSYHDVDSSEMAFKIAGSMALKEAVLKASPVLLEPMMKVEVEVPEDYIGNVIGDLISRRGQIESQSTEQGLAKVASKVPLATMFGYATDIRSKTQGRGIFTMEFSHYEEVPRSVAETIIAKSKGNALast
1 -205.000[J] COG0480 Translation elongation factors (GTPases)  ali  100  1MARINPLEKVRNIGIAAHIDAGKTTTTERILFYSGIIHKIGEVHEGTAVTDWMDQERERGITITAAAISTSWKDYQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGANFYRVHEQMRDRLRANAIAIQLPIGSENDFKGIVDLVRKRAYMYNNDQGTDIEETDIPADLQDQVEEYYTKLVEAVAETDDDLMSKYFDGEPLTEEEIRSALRKGTIAGTIVPVLCGSAFKNKGVQLMLDAVVDYLPAPTEVPPIQGTLPNGDAIERRADDNEPLAALAFKIMADPYGRLTFVRVYSGVLKKGSYVLNATKNKKERISRLVLMKADDRQDVEELRAGDLGAALGLKDTLTGDTITDEGAPVILESLFIPEPVISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVNVDPETNQTVIAGMGELHLEILVDRMLREFKVEANVGAPQVAYRETIRKPVTNVEGKFIRQSGGKGQYGHVVINLEPGEPGTGFEFVSKIVGGVVPKEYIGPAEQGMKESCESGILAGYPLIDVKATLVHGSYHDVDSSEMAFKIAGSMALKEAVLKASPVLLEPMMKVEVEVPEDYIGNVIGDLISRRGQIESQSTEQGLAKVASKVPLATMFGYATDIRSKTQGRGIFTMEFSHYEEVPRSVAETIIAKSKGNA 692
2 -173.000[J] KOG0465 Mitochondrial elongation factor  ali follow..  43  62.DDIGRCNKLRNIGISAHIDSGKTTFTERVLYYTKRIKAIHEVRGRDNVMDSMDLEREKGITIQSAATYCSWKNYHFNLIDTPGHIDFTIEVERALRVLDGAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGSDPFRAIEQLNSKLKIPAAAVQIPIGSESSLSGVVDLINRVAIYNKGDNGEIIEKGPVPENLKPLMEEKRQLLIETLADVDDEMAEMFLEEKEPTTQQIKDAIRRSTIARSFTPVLMGSALANTGIQPVLDAIVDYLPNPSEVLNTALDVSNNEAVNLVPAVQQPFVGLAFKLEEGKYGQLTYVRVYQGRLRKGNYITNVKTGKKVKVARLVRMHSSEMEDVDEVGSGEICATFGIDCA-SGDTFTDGSVQYSMSSMYVPDAVVSLSITPNSK-DASNFSKALNRFQKEDPTFRVKFDPESKETIISGMGELHLEIYVERMRREYNVDCVTGKPQVSYRESITIPAD-FDYTHKKQSGGAGQYGRVIGTLSPVDDTKGNIFETAIVGGRIPDKYLAACGKGFEEVCEKGPLIGHRVLDVKMLINDGAIHAVDSNELSFKTATMSAFRDAFLRAQPVIMEPIMNVSVTSPNEFQGNVIGLLNKLQAVIQDTENGHDEFTLKAECALSTMFGFATSLRASTQGKGEFSLEFSHYAPTAPHVQKELISEFQKKQ 758
3 -144.000[J] KOG0469 Elongation factor 2  ali follow..  23  10RALMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIA--GSKAGETRFTDTRKDEQERCITIKSTAISLFFEGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELFQTFQINVIIATYGDDDGPMGPIMVDPSIGNVGFGSGLHGWAFTLKQFAEMYAGKFGVQVDKLMKNLQFVLDPIFMVFDAVMNIKKDKTAALVEKLGIKEGKPLMKVFMRKWLPAGDTMLQMIAFHLPSPVTAQKYRMEEAAVAIKTCDPNGPLMMYISKMVPTSDKGRFYAFGRVFSGKVATGMKARKKEDLYEKTIQRTILMMGRFIEPIEDIPSGNIAGLVGVDQVKGGTITTYKDAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIFE-ESGEHIIAGAGELHLEICLKDLEEDHAIPLKKSDPVVSYRETVQSESN-QICLSKSPNKHNRLHCTAQPMPDGLDGTGPNLLMDVTKGVQYLNEIKDSVVAGFQWATREGVLSDENMRGVRFNVHDVTLHAIHRGGGQIIPTARRVFYASVLTAEPRLLEPVYLVEIQCPEAAVGGIYGVLNRRRGHVFEESQVTGMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPLEAGTKPNQ... 827
4 -132.000[J] KOG0468 U5 snRNP-specific protein  ali follow..  19  122ADLMDTPPLIRNVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQ-LRYTDTLFTEQERGCSIKATPVTLVLKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQERQAITVCINKIDRLILELKLPPQDAYFKLKHIVEEVNGLLSTYGAPDDNLLVSPILGNVCFASSNSKTRKFSKKQPHNSAQRSFVEFILEPMYKLIAQVVGDVDTTLSDTLAELNVRVSKEEMKSNIRPLLRLVCNRFMGDSGFVDMCVEHIKSPLENAKRKVKEGDIYRDMISCNQYGTLMVHSSKMYDDCTFFQVLARIVSGTLHAGQEVRDEEDSRILQVGRLWVFESRYKVELNRVPAGNWVLIEGIDQCIVKTSTVPEDLYIFRPLKFNTQSIIKIAVEPVNPSELPKMLDGLRKVNKSYPLLSTRVE-ESGEHVILGTGELYLDCVMHDLRKMYEIDIKVADPVVAFCETVVETSS-LKCFAETPNKKNKITMISEPLEKGLAERSIWAFGPDSTGPNILTAVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDGVIANEALHRGGGQITARRVAYSAFLMATPRLMEPYLFVEVQAPADCVSAVYTVLARRRGHVTQDAPVSGSPTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDPLDKSIIIRPLE. 925
5 -122.000[J] COG4108 Peptide chain release factor RF-3  ali follow..  25  7.PYFGEVSKRRTFAIISHPDAGKTTITEKVLLFGRAIQVAGTVKNQHAKSDWMEMEKERGISVTTSVMQFPYGDCLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAKGVEDRTRKLMEVTRLRDTPIVTFMNKLDREIRDPMELMDEVENELKIACSPITWPIGCGKEFKGVYHIHRDETILYTSGQGHTIQEERIIK---------GLDNPELDQAVGADLAAQLREELELVLGASHEFDRELFLQGELTPVFFGTALGNFGVDHMLDGLTQWAPSPMPRQAAE------RVVEASEEKFTGFVFKIQANMDPKHDRIAFVRIVSGTYKQGMKMNHVRLGKQVNISDAVTFMAGDRARAEEAFAGDIIGLHNHGTIQIGDTFTQGE-TLKFTGIPNFAPELFRRIRLRDPLKQKQLLKGLVQL-SEEGAVQVFRPLQNNDLIVGAVGVLQFDVVVSRLKSEYNVEAIYEGVNVATARWVEDVKKFEEFKRKNQSNLALDGGDNLAYIAPTMVNLNLAQER........................................................................................................................................................................ 519
6 -94.800[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  22  2......IENLRNIAIIAHVDHGKTTLVDKLLKLSGTLDR--KEAESERVMDSNDQEKERGITILAKNTAIKWNGYNINIVDTPGHADFGGEVERVMSMVDSVLLVVDAQDGPMPQTRFVTQKAFKAGLRPIVVVNKIDRPGARPDWVIDQIFDNLGATDEQLDFPIVYASALNGIAGLDHEKMDDN--------------------------------------------------------------------------------MDALFQAIIDHVPAP------------------VVDTEGPFQMQISQLDYNSFGVIGIGRITRGKVKSNTPVVAISDDGSGRILKIMGHHGLQRVEVAEAEAGDIVCVSGMEELFISDTLCDPQNVEALPPLTVDQPTVSMTFREGKFVTSRNIKERLEKELLHNVALRVEPGDSPEKFKVSGRGELHLSVLIETMRREG-FELAVGRPEVVIIEKDGEKQEPYENVTIDIEE---QHQGSVMEQMGLRKGDLSNMIPVRLEYTIPARGLIGFRNNFLTLTSGTGILTSTFSHYGPIKAGEVSNRQNGVLVSMATGTALTYLETLQSRGKLFLGPGDEI-------YEGQLAG-INSRDNDLVINPTKG-KKLDNMRASGKDEVIALVPPIRFTLEQALEFIADDELVEVTPKLRKKMLNENDRK. 598
7 -84.600[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  21  35..SEFTPDKIRNFGIVAHVDHGKSTLADRLLEMCGAVP-----PGQKQMLDKLQVERERGITVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQGVQAQTIANFWLAFEKNIQIIPVINKIDLPGADIKSVETQLKNLFEFNPEECLHI----------------------------------------------------------------------------------------------SAKSGLNVDKVLEAIIDRVPAP------------------TAIIDAPFRSMIFDSYFDHFGAIAHIMVKEGSVKKGDKIQSYQNEKVYDVSEVGVMRPEKCTELRAGQVGYLVCMRTVNEAVVGETLFAETTSKTFAEIKGVKPTVYAGLFPVETSDYESLKQAVERLCLNDPSVTVIPDSSKALGRIGFLGVLHMEVFGARLSQEYDASVILCQPSVEYRAKIKDNE---TIRKKRYDGMEEIRILDPSKFPDESDVDSFLEPMVKVRMIVPNEMMGTVNGLCSECRGERGEITSIDSTRLVILWRLPLAEVAVERLKKLTSGYASFDYEPDGWQDTRLVKLTILINSKEVSEFSQIIPAMARDRAKILVQRLKREIPRQQFEVTIKACIGSSTKAIVIQPMKRDFSQLLKGN---GMERLNKKLSHQKK.. 621
8 -79.900[M] COG0481 Membrane GTPase LepA  ali follow..  25  1......MKNIRNFSIIAHIDHGKSTLSDRLIQTCGGLS---DREMEAQVLDSMDLERERGITIKAQSVTLNYKTYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEMNLEVVPILNKIDLPAADPERVAEEIEDIVGIDAMEAVRC----------------------------------------------------------------------------------------------SAKTGVGIEDVLEEIVHKIPAP------------------EGDPNAPLQALIIDSWFDNYGVVSLVRIKNGTLRKGDKIKVMSTGQSYNVDRLGIFTPKQTILNCGEVGWVVCAIKDILGAPVGDTLTSHNNPSVLPGFKKVKPQVYAGLFPISSDDYEAFRDALGKLSLNDASLFYEPENSTAGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVEKTDG-EVIYVDSPSKLPPLNNITE-------------------------------------------------------------------------------------------IREPIAECNMLLPQTYLGNVITLCVEKRGVQTNMVYHGNQVALTYEIPMGEVLDFFDRLKSTSRGYASLDYGFKRFQAADMVRVDIMINGERVDA 494
9 -25.900[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  19  55...........NIGTIGHVDHGKTTLTAAITKCLSDLGQASFMD--YSQIDKAPEEKARGITISSAHVEYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQVGVKQVVYINKVDMVEPDMIELVE----------------------------------------------------------------------------------------MEMRELLSEYGFDGDNTPIVSGSALCALSITKLMEAVDSYITLPER------------------KTDVPFLMAIEDVFSSGRGTVVTGRVERGTLKKGAEIVGYGSHLKTTVTGIEM----FKKQLDAAVAGDNCGLIKREQLKRGMIVAQPGTVAPHQKFKASFYILTKEEGGRRTGFVDKYRPQLYSRTSDVTVELTHPDPNDSDKMVMPGDNVEMICTLIH....................................................................................................................................................................................................................................... 410
10 -23.800[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  16  19.MIAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIDQLSSLHNDSKLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKHLVVINKMDLVDYSFTRIREDYLTFAGQLPGNLDIRFVPLSALEGDNVASQSESMPWYSG----------------------PTLLEVL--------ETVEIQRVVDAQPMRFPVQYVNRPNLDFRGYAG------------------------------------------------------------------TLASGRVEVGQRVKVLPSGVESNVARIVT----FDGDREEAFAGEAITLVLTDDISRGDLLLAADEALPAVQ-SASVDVVWMAEQPLSPGQSYDIKIAGKKTRARVDGIRYQVDINNLTLPLNGIGLVDLTFDEPLVLDRYQQNPVTGGLIFIDRLS.................................................................................................................................................................................................................. 425
11 -23.100[J] COG0050 GTPases - translation elongation factors  ali follow..  24  14...........NVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQI--DNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIVFMNKCDMVD--------------------------------------------------------------------------------DEELLE-------LVEMEVRELLSAYDFPGDDLPVVRGSALKALKIIELAGYLDSYIPEPE-----------------RAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVGEEVVGIKDTVKSTCTGVEM----FRKLLDEGRAGENVGVIKREDIERGQVLAKPGSIKPHTTFESEVYILSKD............................................................................................................................................................................................................................................................................................ 315
12 -23.000[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  19  1MKIMASQKPHLNLITIGHVDHGKSTLVGRLLYEHGEIHIIEEYRKEAEVMDRFKEERERGVTIDLAHRKFETDKYYFTLIDAPGHRDFVKNMITGTSQADAAILVISAREGVMEQTREHAFLARTLGVPQMVVINKMDATSPPYSERYNEVKADA--------------EKLLRSIGFKDISFVPISGYKGDNVTKPS-----------------PNMPWYKGPTLLQALDAFKVPEKPINKPLRIPVED--------------------------------------------------------------VYSITGIGTVPVGRVETGVLKPGDKVIFLPADKQGDVKSIEM----HHEPLQQAEPGDNIGFIAKNDIKRGDVCGHLDTPPTVVKAFTAQIIVLNHPSVIAPGYKPVFHVHTAQVACRIDEIVKTLNPKDGTTL...................................................................................................................................................................................................................................................... 370
13 -23.000[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  14  33.HEVISRQATINIGTIGHVAHGKSTVVKAISLERNITIKLGYANAKIYQLDDPSCPRPECYRSCGSSMPDEFPVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCQPQTSEHLAAIEIMKLKHLILQNKIDLVKERQAKEQY----------------------------------------------------------------------------------------EQILAFVQGTVAEG--APIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEV---------DDLKGGVAGGSILKGVLKVGQETEEGKLMCKSIFSKIVSLFAEH-NDLQYAAPGGLIGVLCRADRMVGQILGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVL........................................................................................................................................................................................................................................... 429
14 -22.600[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  19  3.....KEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIRTIEKFEKEAQVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGENGQTREHALLAQTLGVKQLIVCNKMDSTEPPFSE-------------------------------------------------------ARFTEITNEVSGFIKKIGYNPKAV--PFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNASGKTLLEALDSI---------------------IPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQNVTTEVKSVEM----HHESLPEAVPGDNVGFVSVKDIRRGSVCSDSKQDPAKEARTFHAQVIIMNHPQISNGYTPVLDCHTAHIACKFNELKEKVDRRTGKKV...................................................................................................................................................................................................................................................... 387
15 -21.600[J] KOG0458 Elongation factor 1 alpha  ali follow..  14  159.AFVKSALPHLSFVVLGHVDAGKSTLMGRLLYDLNIVSQLRKLQRESEIMDQTNEERERGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNADGQTKEHMLLASSLGIHNLIIMNKMDNVDWS-QQRFEEIKSKL-----------------------------------------------------------------------LPYLVDIGFFEDNI-----------NWVPI---SGFSGEGVPNLMSTLENAAFKI---------SKENEGINKDDPFLFSVLEIIPSKKTSNDLALVSGKLESGSIQPGESLTIYPSEQSCIVDKIQVGSQQGQEETDVAIKGDFVTLAYPEDIQNGDLAASVDYSSIHSAQCFVLELTTFDMNPLLPGTPFILFIGVKEQPARIKRLISFIDKGNTASHLGSKQRAFVEIELIEVKRWIPLLTAHENDRLG...................................................................................................................................................................................................................... 590
16 -20.100[J] KOG0459 Polypeptide release factor 3  ali follow..  14  94..AEANKKRHLNVVFIGHVDAGKSTIGGQILFLSGQVRQIQKYEKEAKIMDTNEEERLKGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEGGQTREHVQLAKTLGVSKLIVVNKMDDPTVNWSKEYDEIEQKMVPFLKASGYNTKKDVVF--------------------------LPISGLMGKNMDQRMGQEICPWWSGPSFFEVLDSIEIPPRDPNGPFRMPIID-----KFKDMGTVVMG-----------------------------------------------------------KVESGSIREGDSLVVMPNKEQVKVVAIYC----DEDKVKRAGPGENLRVIEDEDILSGFVLSSIVNPVPAVTEFVAQLQIKAILHIHAVVEECEIIELKSQI---DLKTRKPMKKKVLFVKNGAAVVCRIQVTNSICIEKFSDFPQLGR.......................................................................................................................................................................................................................... 507
17 -20.000[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  18  183............VTIMGHVDHGKTTLLDKF--------RKTQVAAVET-----------GITQHIGAFLVS-SGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAQVPIILAVNKCDKAEADPEKVKKELLAY---------------EDYGGDVQAVPV------------------------------------------------------------------------------SALTGDNLMALAEATV-----------------LAEMLELKADPNGPVEGTVIESFTDKRGLVTTAIIQRGTLRKGSVLVAGKC------AKVRLMFDENGKTIDEAYPSMPVGITGWRDLSAGEEI------LEVESEPRAREVVDWRKYEQEQEKGQEDLKIIEEKRKEHKEAHQKAREKYGHLLWKKRSILRFLERKEQIPLKPK-ERDSNVLSVIIKGDVDGSVEAILNIIDTYDASH------ECELELVHFGVGDISANDVNLAETFDGVI-----GFNVNAGNVIQQSAAKKGVKIKLHKIIYRLVED----------------LQEELSSRLPCAVEEHPVGEASILATFSVTEGKKKVPVAGCRVQKGQLEKQKKFSLTSLKHHKDDISIVKTG.............................. 689
18 -19.500[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  15  8...........NIGLVGHVDHGKTTLTKALS---------------GVWTDTHSEETKRGISIRLGYADITFRKRKVSFVDAPGHETLMATMLSGAALMDGAILVIAANEPCQPQTKEHLMALDVIGVKDIVVQNKIDIVSKERALESY----------------------------------------------------------------------------------------REIKEFVKGTCAED--APIIPVSAQQGANIDILIETIEERIKTPKRDVDKPARMYVARSFDINKPGAD---------PEHLAGGVIGGSLVQGRLRVGDEI-KDGKQTWMSLHSTITGLVAGGEEMEEVGPGGLVGVLTKADSLSGSVAGEPGTLPPVRH------SFTMETHLLERVVGTKEETKVEPIKTGEPLMINVGTTTTVGVVKSARADDADVVLKLPACAEEGQRIALSRRVGARWRLI................................................................................................................................................................................................................. 402
19 -18.500[R] COG5258 GTPase  ali follow..  15  109...........TVVALGNVDAGKSTLVGVLTT--------GRLDDGKGLA--YKHEVLTGRTSAVSLRLLGFSDKLVLLVDVGGHERYLRTALRGLSQPDYVMLVVAANSGVQKMTKEHLGIAVAIGIPVFVVVTRIDITPSEFQKTVEEVVRILKMPGV---------------------------------------------------SKIPYIIKDTNDVVLAA-----------------KAMPAGRVAPVFYVSSVTGHGLDLLLRFLSLLPRRRR-----------------WDYGGEFLMYISDIYLVKGVGVVIGGLVEKGILHVGDRVWLGPYSDGKWMQTVVKSIHFNRTPVESAKAGSFITLDKVEKVEKGMVLSARPLKADVLVLRHPTVITGGYIKEIDKGELMVGDSGVVKIELSRPWHIDSGVFVFRNGPTRILGRI............................................................................................................................................................................................................................................... 508
20 -18.000[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  12  3............IVTSGHVDHGKTALLKAL---TGT-------------TAHLPEEKKRGMTIDLGYAYLPLENKVLGFIDVPGHEKFLSNMLAGLGGVHYAMLIVAADEGVAVQTKEHLAILRQLQFHEIVVITKADR---------------------------------------------------------------------------------TNSAQIES-----------LIQTIKQDYSFLRNANYFVTSAETGQGISELRHYLANLAEL-------------------ADTQKPFRYAIDRVFSVKGAGTVVTGTAFSGTVKVNDEIY-LSTGQKIRIKAIHA----QNTSSEQGIAGQRLALLDRTPMKRGDWLLQNEPLPPTDRISV-ASRTTGKLTLLQGKNAAKNDRTLAEIILDSPLFLAFGDSGDTKTLIAGARVLEINSPKRHKRTEVRLNFLANLALAENASQRIALTLQHNATTARQLMWTEQLTSLQLD-KALAERDAVRYQDWCFNPNYVQEKTQQILTALNIYHEQHNDLGVSKARLYRMATLNQ-----PENLIHHFIDEMLDDGRLQQTRGWIHLPEHKIQFNTEEKSRWTDVLNEFEKANGQAIWVRDMANALAIDESIMRNFMYKAGKLGYLTPIVKDRFFLTETLYAYARLIKQIAEEK..... 570
21 -16.800[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  20  448............VTIMGHVDHGKTTLLDRF--------RESRVTEGEA-----------GITQHIGAYQIKANGKKITFLDTPGHEAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPQRVTQELTEH--------------------------------------------------------------------GVFPVAWDPENGSEFVEI-------------------SAKFNQNLDELLDTVL-----------------VAEVQELKADPTVRAIGTVVEARLDQKGAIATLLVQQGTLHVQDPIVVGNT------GRVRTMTNDLGRRIKEAGPSTPIELTGLSDVQAGDHFAVFEDEKAARAAG-QTKSVNIIIKADVQGSAEALAASLQKIEVEGVKVDI---------VHSAVGDISLAAASNAIIIGFNVRPTGLAREQAAQEEVDIRLHSIIYKVIEEVETA-----MRGMLDP-------EFKEEIIGEAIVRETFNVSKVGTIAGVIRGKVASVRVIREGVVIHDGAIASLDVKEVGNAQEGGLMVEDFNDVEIDDTFEVYKMVEI..................................................................................... 941
22 -16.300[E] COG4917 Ethanolamine utilization protein  ali follow..  17  1.........MKRIAFVGSVGAGKTTLFNALQGNYTLARKTQAVE------------------------------NDKGDIDTPGHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIG--VSKRQIAVISKTDMPDADVAATRKLLLE-TGFEEPMFELNSHDPQSVQQLVDYLASLT............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 146
23 -14.800[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  14  46SIRLFRRTKSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGT-----------FVLHNENNTKKGKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALEFLPNIRAAS-ASVIKNKTPVLLCCNKTDKVTA---HTKEFIRKQMEKEIDKLR................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 202
24 -14.100[R] KOG2486 Predicted GTPase  ali follow..  16  128..EDCPADGLPEFALVGRSNVGKSSLLNSLV------------RKRLALTSKKPGKTQC--------INHFRINDKWYLVDLPGY-KFTKDYFLNRSTLVSVFLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCDKRKKK-----------------------------------------------------------------KNGGKKPEANIKEFQDLIQGFFET--------------------TPPWIMTSSVTNQGRDEILLHMAQLRNY............................................................................................................................................................................................................................................................................................................................................................................................................................ 314
25 -13.700[R] COG3596 Predicted GTPase  ali follow..  12  40...........VIGIMGKTGAGKSSLCNALF------GEVSPVSD-------------AACTRDPLRFRLQIGEHFMTIVDLPGVGEYAALYREQLPRLDLILWLIKADDRALATDEHFYRQVEAYRHKMLFVISQSDKQKQNISRKICLLHELFQPVHPVCAVSVRLQWGLRVMAERMREPSSPVVALLQHPFRTWVAREQARDDFGETVDTILDTVSTFP...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 260
26 -12.600[R] COG1084 Predicted GTPase  ali follow..  16  160.......LDAFTVVIAGFPNVGKSTLLRTL------------TGAEPEVADYP------FTTKGIQIGHLERKWKRIQVIDTPGLLDRPVEMVALENIADVIMFIFDASETCESQYSLYLGIRSVFDIPVVTVFNKMDLAENV-----KYLEEYINMVEDPLKVSAFEGRGVSKIIKKL................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 321
27 -12.400[R] COG2229 Predicted GTPase  ali follow..  19  5...........KIIFTGPVGVGKTTAIAAI------SDEALVQTDASASDMTLDRKRNTTVAMDYGAISLD-EDTKVHLYGTPGQERFNFMWEILSQGSMGLVLLLDNARTNPLKDLEFFLHSFRGKAPVVVGITKMDIRSQPGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSI............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 172
28 -12.400[R] COG0218 Predicted GTPase  ali follow..  12  18..SHYPQDELPEIALAGRSNVGKSSFINTMLNRKN-LARTSGKPGKTQLLNFFNIDDK------------------MRFVDVPGY-CMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADKPRGKWNKHESAIKKKLNFDPSDDFILFSSVSK-AGMDEAWD................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 189
29 -12.100[R] COG1160 Predicted GTPases  ali follow..  11  2........ATPVVALVGRPNVGKSTLFNRL------------TRTRDALVADFP-----GLTRDRKYGHAHIAGYDFIVIDTGGEEKMAEQSLLAIDEADIVLFLVDARAGLTAADIGIANYLQRQNKITVVVANKTDGIDADSHCAEFYQLGLGEIEQIAASQGRGVTQLMEQVLAPFAEKMENADENDRTSEEEQDEWEQEFDFDSEEDTALIDDALDEELEEEQDIVGRPNVGKSTLTNRILGE--DRVVVFDMPGTTR---------DSIYIPMERDGQQYTLIDTAGVRKRGKVHLAVEKFSVIKTLQAIQDANVVLLTIDARENISDQDLSLLGFILNAGRSLVIVVRVKSELDRRLDFIDFARVHFISALHGSGVGNLFDSIKEAYACATQKMTTSLLTRILQPMIGGRRIKLKYA-HPGGYNPPIIVVHGNQM------DKLPDSYKRYLSNYYRKSLKII---GSPRLLFQEGSNPFAGRKNKLTPNQLRKRKR............................................................................................................................................................................................. 494
30 -10.800[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  17  22...........ELTLVGLQFSGKTTFVNVI-------------ASGQFAEDMIP-------TVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAAD-SRNELHSLLDKPQLAGIPVLVLGNKRDLPGA----DETGLIERMNLSSI.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 152
31 -10.600[R] COG1159 GTPase  ali follow..  16  11............IAIVGRPNVGKSTLLNKLL--------------GQKISITSRKAQTTRHRIVGIHTE---GPYQAIYVDTPG---MNKAASSSIGDVELVIFVVEGTRWTP-DDEMVLNKLRDGKAPVILAVNKVDNVQEK-VDLLPHLQFLASQMNFLDIVPISAETGAGIVRKHLPEAIHHFPEDYITDRSQRFMASEIIR--EKLMRFLGAELPYSVTVEIERFVTNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKD.................................................................................................................................................................................................................................................................................................................................................................................................................................... 264
32 -10.600[P] COG0370 Fe2+ transport system protein B  ali follow..  11  5...........TYCILGNPNTGKTSLFNAL---TGSYEYVGN--SGVTV------EKKVG----------TLRSKTGKLIDLPGIYDLNPISRDETVVTDCMLNIVDSSQ---ERNLNLTVQLLEYGAPVVMGLNMIDVAAGRGIHLIQNLAKKLRIPILPV-----VARSGKGTEDIL--STLSEKHVAPAIPLVLQYGEPAEKAIKEIQALTKEQFLSKNEVTEAFLTSNSAFEQENHFHQVRASYIHDICLTSVEYTRNSDIPLSDKLDKIFKLLGIPIDGFIGGSLTDWVTSFLTTIGASGFIIDLVADGIIAGVGGVLVF---SGYMARIAVVM-------DRVMEIFGLNGKAFIPMIIGFGCNVPGIMAARSIEESKERTLTILVSPFMSCSARLPVYALFVGVFFEKHQALVVLSLYVI-----LMALIVTKILSKTILKKDNSVFV--------------VELPPYRLPSLKTLWRSTWEKGKGFLRKAGTFIFAGSVII-LNYAGPSGLDVPMGESFLAIIGGMLAPLLVPGFGTQAGATLIPGFLAKEVVVSTMAIIYAVGESSLGSIVSTFYTPLSAYCFMLFILLYIPCLATVAAIRKE................................................................................ 631
33 -10.600[R] COG1163 Predicted GTPase  ali follow..  11  61.....ARTGVASVGFVGFPSVGKSTLLSKL---TGTESEAAEYE----------------TTLVTVPGVIRYKGAKIQMLDLPGIIDGAKDVIAVARTCNLLFIILDVNKPLH-HKQIIEKELEGVGIPPDILIKKKEKGGISITNTVPLTHLG------------------DEIRAVMSEYRIN------------------SAEIAFRCDATVDDLIDVLEASSRRYMPAIYVLNKIDSLSIEELELLYRIPNAVPISSGQDWNLDELLQVMWDRLNLVRIYTKPKGQIPDFTDPVVLRSDRCSVKDFCNQIHKSLVDDFRNALVYGSSVK-----------QPQYVGLSHILEDEDVVTI......................................................................................................................................................................................................................................................................................................................................... 366
34 -10.500[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  10  5VGDSSGSPKPIRIVVVGEKGSGKSSLIMAAA------------------RNTFHPNIPSLLPYTNLPSEFFPDRIPATVIDTSSRPEDKGKVVKEVRQADAIVLTFAFDRPETDRLSKYWLPLFRQRVPIIVAGYEVDNKEAYNHFSIEQITSALMKQYREVETSI-SAQRLDQAKDVLYYAQ------KAVIDPVGPVFDQENNVLKPRCIAALKRIFLLSDHNMDGILSDEELN---------------ELQKKCFDTPLVPCEIKQMKNVMQVTFPQGVNERGLTLDG---------------FLFLNTRLIEEARIQTLWTMLYSNDLRLGDDLVPYSS---------FKRQADQSVELTNVAIEFLREVYEFFDSNGDNNLEPHEMGYLFETA--PESPWTKPLYKDVTEENMDGGLSLEAFLSL--SLMTLIDPPRSLEYLMYIR--------------FPSDDPSSAVRVTRKRVLDRKEKKSERKVVQ-PKNAGKSALLNQFIRSYDDDSNNNNGSTDEHYAVNMVKEPGVISDTDKTL---VLKEVRIKDDGFMLSKEALAACDVAIFIYDSSDEYSWNR-AVDMLAEVATIAKDSGYVFPCLMVAA--TDLDPFPVAIQESTRVTQDIGIDAPIPISSKLGDVSNL.................................... 589
35 -10.500[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  10  166.......PNTRTVLICGYPNVGKSSFMNKV------------TRADVDVQPY--------TTKSLFVGHTDYKYLRYQVIDTPGILDRPFESITALAHLRAAVLFFLDISGIAQQAALFHSIKSLFNKPLVIVCNKTDLMPMEISEEDRKLIEEMKSEAMKTAMGASEEQVLEGVMSVKNAACERLLDQRVEAKMKSKKINDHLNRFHVAIPKPRDSIERLPCIPQVVLEAKAKEAAAMEKRKTEKDLEEENGGAGVYSASLKKNYILQHDEWKEDIMPEDPDILQRLAELEREEGIREAGVEEADMEMDIEKLSDEQLKQLSEIRKKKAILIKNHRLKKTVAQNRSTVPRKFDKDKKYTTKRMGRELSAMG-------LDPSSAMDRARSKSRGRKRDRSEDAGNDAMDVDDEQQSNKKQRVRSKSRAMSISRSQSRPPAHEVVPGEGFKDSTQKLSAIKISNKSHKKRDKNARRGEADRVIPTLRPKHLFSGKRGKGKTDR............................................................................................................................................................................................. 670
36 -10.500[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  16  18.......QKEAKILFLGLDNAGKTTLLHML--------------KDERLVQHQP-------TQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYD-SKRELDALLSDEALATVPFLILGNKIDIPYA---ASEDELRYHLGLTNF.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 151
37 -10.400[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  14  14...........KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATI----------------GVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRNIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKYNFEKPFLWLAKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDD.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 216
38 -10.300[R] KOG0395 Ras-related GTPase  ali follow..  12  11.TLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIED-----------------FHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGD-VSAKKNTNVDEMFYVLFSMAKLP.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 193
39 -9.730[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  19  7LKKMKQKERELRLLMLGLDNAGKTTILKKF--------------NGEDIDTISP-------TLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSAD-CQRELQSLLVEERLAGATLLIFANKQDLPGA---LSSNAIREALELDSI.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 147
40 -9.640[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  18  19...........RILLLGLDNAGKTTLLKQL--------------ASEDISHITP-------TQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSAD-TGQELAELLEEEKLSCVPVLIFANKQDLLTA---APASEIAEGLNLHTI.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 148
41 -9.630[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  19  15.......SREMRILILGLDGAGKTTILYRL--------QVGEVVTTIP-------------TIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSAD-SKDELLYMLREEELAGAILVVLANKQDMDGC---MTVAEVHHALGLENL.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 148
42 -9.630[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  18  8LFSRLFAKKEMRILMVGLDAAGKTTILYKL--------KLGEIVTTIP-------------TIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSND-ARDELHRMLNEDELRDAVLLVFANKQDLPNA---MNAAEITDKLGLHSL.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 148
43 -9.580[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  21  9FDKLWGSNKELRILILGLDGAGKTTILYRL--------QIGEVVTTKP-------------TIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTD-ASKELHLMLQEEELQDAALLVFANKQDQPGA---LSASEVSKELNLVEL.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 149
44 -9.570[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  18  23...........RILMLGLDAAGKTTILYKL--------KLNQSVVTIP-------------TVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSAD-ARQELHRIISDREMRDCLLLVLANKQDLPGA---LSPAQITDVLQLDKL.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 152
45 -9.530[F] COG1618 Predicted nucleotide kinase  ali follow..  13  1MRIEGKEKTMLRIAVTGSPGVGKSTVVAKTA--EKLAEKPGFKIGGIRTAEIRKEGHREGFSIRGANAVRNALACDLVVIDEIGPMELISQVSAVEEVLESDKPVLAVLHHSSRHPLAQRFRKG-----EVLTVDKGNRDEL-PEKITNRFLRKLG........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 184
46 -9.410[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  14  60.....AKTGDARIGFVGFPSVGKSTLLSNL---AGVYSEVAAYE----------------TTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDVIAVARTCNLILIVLDVLKPLG-HKKIIENELEGFGIPPNIGFKKKDKGGINLTATCPQSELD----------------------ETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKI----------------QISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVK-----------NPQKVGKDHTLEDEDVIQI......................................................................................................................................................................................................................................................................................................................................... 364
47 -9.300[R] KOG0394 Ras-related GTPase  ali follow..  15  1..MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATI----------------GADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWRESDPENFPFVLIGNKVDVDDGNSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIA............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 173
48 -9.110[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  13  1MAGTRDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSENYITTI----------------GVDFKIRTMDINGQRVKLQIWDTAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNCDSVQKVNKCEENERRVVLESDARNYAQSMNISFFETSAKEDKNVEPMFTCITSLVL............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 171
49 -9.040[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  14  8LYNNWNKKEQYSILILGLDNAGKTTFLETL--KKEYSLAFKALEKIQPTVGQNVATIPVD------------SKQILKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSD-CSTTLQSVVMDEEIEGVPILMLANKQDRQDR---MEVQDIKEVFNKIAEHIS................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 158

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.