current user: public

If you have questions about the server, please let us know.

Query: [L] COG0507 ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MRTCGRRLAARLTSFVGWPAKSALAPGGRILTLKVMQFAPQQDEALKAVSQWLKGGRSQLFRLFGYAGTGKTTLARHFAENVDGEVVFAAFTGKAAQVLRSKGATNAKTIHSLIYRPRGEEEVEDEETGKTSIAPMFAINRQSPVAKAALIIVDECSMVDEALGKDLMSFGTPILVLGDPGQLPPVSGGGYFTNHEPDFLLTDIHRQARDNPIIQLAMQVREGKEIMHGDYGTAQVISKGQVTQPLVLEADQVLVGTNRTRRRYNQRLRELKGFTSEYPQSGDKLVCLRNDPAKGLLNGSLWQVMSSSKETVKPGINLMIRPEDDDMDRGAAKIKLLKAAFEDVEGEIPWSTRKRYDEFDYGYALTVHKAQGSQWNNVVLFDESWAFRDTRERWLYTAITRAAERLTIVRLast
1 -113.000[L] COG0507 ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member  ali  100  1MRTCGRRLAARLTSFVGWPAKSALAPGGRILTLKVMQFAPQQDEALKAVSQWLKGGRSQLFRLFGYAGTGKTTLARHFAENVDGEVVFAAFTGKAAQVLRSKGATNAKTIHSLIYRPRGEEEVEDEETGKTSIAPMFAINRQSPVAKAALIIVDECSMVDEALGKDLMSFGTPILVLGDPGQLPPVSGGGYFTNHEPDFLLTDIHRQARDNPIIQLAMQVREGKEIMHGDYGTAQVISKGQVTQPLVLEADQVLVGTNRTRRRYNQRLRELKGFTSEYPQSGDKLVCLRNDPAKGLLNGSLWQVMSSSKETVKPGINLMIRPEDDDMDRGAAKIKLLKAAFEDVEGEIPWSTRKRYDEFDYGYALTVHKAQGSQWNNVVLFDESWAFRDTRERWLYTAITRAAERLTIVR 410
2 -26.900[R] COG3972 Superfamily I DNA and RNA helicases  ali follow..  14  171..EGAKALTRASKRIVEDPEVTPAAAALAKLESEIANFDQKQRRAALVT-------IDGPQRIRGLAGSGKTVILAMKAAHLNDKILVTFFTKSLRSPIKDLVTKDWNNIHIRHGWYSSARDAAPRGVEPFSFACEELINSAQSLEYYDHILIDEGQDFPDGFYKLCFELKKNIVWAYDELQ--ARAEKNLPPGATNDTVLSKCYRNQRE--VLVAAHALGFGDHWRDVGYDVLTPDFQVGNDIEILRPVENSPVALDTDGLPPLIGNFIASSFEKEISWITKEIINFLDM---GLLPEDIIVVALDDRHMRNYFRYLSESLASHEISVNNIHADPYSEPPFSISGKIT--------------LSTVYRAKGNEAAVVFALGVDALSLRADRNKIFAAFTRTKAWLRVS. 632
3 -23.700[D] KOG0987 DNA helicase PIF1/RRM3  ali follow..  21  520.............HFILDERKYDRAYLIEKHEEWLTMVTSEQKKIYDEIMDAVLHDRGGVFFVYGFGGTGKTFLWKLLSAAIRSKSLNVASSGIAALLLDG-----GRTTHSRFGIPINPNESSTCNISRGSDLGEL-------VKEANLIIWDETPMMSKHCFESLDRTGKGIVFGGDFRQVLPV-NSSYIWEHCKVLELTKNMRKRDIEYFSKWILDVGDGKISQPNDGIALIDIPEEEEKDPKFFQGRAILCPTNEDVNSINEHMMSMLDGEERILKVGCPVMLLRNDPNKGLCNGTRLQVTQMADTVIQARF---------TGNRVGKIVLIPRMLITPSDTRLPFKMRRRQFPLSVAFAMTINKSQGQTLESVGLYLPRPVFSHGQ---LYVAISRVTSK..... 990
4 -23.100[A] KOG1802 RNA helicase nonsense mRNA reducing factor (pNORF1)  ali follow..  12  375...ISGYLYYKILGHQVVDISFDVPLPKEFSIPNFAQLNSSQSNAVSHVLQ------RPLSLIQGPPGTGKTVTSATIVYHLKDRILVCAPSNVAVDHLAAKSSVSNLALHNLVGRGAKDEVGELSASDTKRFVKLVRKTEAEILNKADVVLIDESTQSEPECLIPIVKGAKQVILVGDHQQLGPILERKAADAGLKQSLFERLISLGHVPIRLEVQYRMNPYSEFPSNMFYEGSLQNGVTIEQRTVPNGIPMMFWANYGREEISANGTSFLNRIEAMNC----ERIITKLFRDGVKPEQIGVITPYEGQRAYILQYM---------------------------QMNGSLDKDLYIKVEVA---SVDAFQGREKDYIILSCVRANEQLRDPRRLNVGLTRAKYGLVIL. 809
5 -20.800[L] KOG1803 DNA helicase  ali follow..  12  238....................................TLNPSQVAAVSAAM----NTQRNLLCIQGPPGTGKTRVIAEIVHQLKKKVLVCAPTHVAVRNAMDAEEKAEQQLCLLANTKDEFQNHKSASKLEEIKKQLSTMSTSDPLYKKDVMIVDEAAQTEPATWVPVLTTCKKLILVGDQKQLPAVLSDKAMKGNFKLSLMEKLAEEFSSNNLLNEQYRMNKKIMNWSNEVFYENQLTAHSTVSDITLRDICPNLPEDHVLNN--KDRSHEEFESHSFTNTDELNLVTE--VDLGINPKAIAVIS--------------------------------------YYAQIEKLRRSIPFRVDVN---TVDAFQGHERQVVIFCLVRDNDELNETRRLNVAVTRARRQFVLI. 645
6 -20.100[A] KOG1804 RNA helicase  ali follow..  14  309....................................VLNENQKLAVKRILS--GDCRPLPYILFGPPGTGKTTIIEAVLQVHDSRILVCAPSNSAADLVCLRLHESKVLQPATMVRVNATCR-FEEIVIDAVKPYCRDGEDIWKASRFRIIIVDEAGQASE--LGLMSDISGQIVLAGDPMQLGPVGLNVSFLERLMSTKLVKNYRS--HEALLMLPSRL-HRELEVCADPTVVTSLLG----EKLPKKGFPLIFHGVRGSEAREGKSPSWFNPAEAVQVL-RYCCLLAHSISSQVSASDIGVITPYRKQVEKIRILL---------------------------------RNVDLMDIKVG---SVEEFQGQEYLVIIISTVRSNEDLSNSKRFNVAITRPKALLIVL. 711
7 -16.300[F] COG1618 Predicted nucleotide kinase  ali follow..  15  6.....................................................KEKTMLRIAVTGSPGVGKSTVVAKTAEKLAEKPGFKI-GGIRTAEIRKEGHREGFSIRDLLSHVKGSGPRLGKYHVNLDDLERIGANAVRNALACDLVVIDEIGPMELSAVEEVLESDKPVLAV-----LHHSSRHPLAQRFRKGFEVLTVDKGNRDELPEKITNRFLR............................................................................................................................................................................................ 181
8 -16.300[L] KOG2108 3`-5` DNA helicase  ali follow..  14  246....................................SLNDRQRDAA------CSNISTPLMVIAG-PGSGKGLLPSNILA--------MTFTKAATSEMRERIGK-ISTFHRAIIEAVRLYEEEKKNGSKTSVPCESGEKACDALDYHDLIIVDETSTMQYKLLR-MLGSHNHITIVGDDDQ------------ITVKECHNEEAQCAYVIDKIIEITNDGSTPCCSHGDIAILYRRQVSGKVFQNAFRQRKIPFNVHGVAFYRKKVVQVILAMLKTTFSECDRVFKALLPFEKEEKKRIIEHIEKISTSRKCSFISAASNDLRSVLQYLMDDVAEFISTHCTTTEEEDAIKEKKGCNQLHSFITTIHQANENEIPLLHESNGNATSLEEERRLLYVAMTRARKKLFFLY 802
9 -15.800[R] COG3973 Superfamily I DNA and RNA helicases  ali follow..  13  191....DEMLQEVLSHHSDTQMKNIVSTIQK-----------EQNQIIR-------NEKSKILIVQGAAGSGKTSAALQRVAYLAGQIVLFSPNFLFNSYVSSEENMEQATFQEYIEHRLGRKFKCESPFDQLEYCLTETKGGDFPTRLAGILFIDEAQDYSPFQMAYMRSIAASMTVLGDINQSIYAHTINGDQRMDACFRLKRTYRSTRQ--IVEFTKAMRSGEMPLVVKTEGHELAQEIGRLKKKGHETIAVICKTAHQCIQAHAHMSEY------------------------------TDVRLIHKENQPFQKGVCV--------------------------------------------IPVYLAKGIEFDAVLVASEEHYHTEHDRRLLYTACTRAMHMLAVFY 754
10 -14.900[L] COG0210 Superfamily I DNA and RNA helicases  ali follow..  20  7....................................GMNDRQAQAVQTT-------EGPLLIMAG-AGSGKTRVLTHRIAYLPWNILAITFTNKAAREMKERALA-IATFHTLMKRILKQLNIDPKKWNERSILGTISNAKNDLLDEKGYIHVDETNHAQYQLIKLLASRFKNICVVGDADQMQNILDFEKDYPDAKVVLLEENYRSTKK--ILQAANDVINNNRNRRPKKLWTQNADGEQLVLGKNFKDFAVLYRTNAQSRTIEEAIRDLIAYLTIVANPADNISFERNEPKRGVGPGTLDKLRQFAYESDQSLLEAASNLLMSPLKGKAAQA--YLDSLRLQNTLESQARIENIEEFLSVTKMTLHAAKGLEFPVVFLISEDPDELEEERRLAYVGITRAEEVLFMTN 617
11 -13.600[T] COG1702 Phosphate starvation-inducible protein PhoH, predicted ATPase  ali follow..  17  121......................................TLGQKHYVDAI------DTNTIVFGLGPAGSGKTYLVQALQSKQVSRIILTRPAVEAGEKLNEKIDPYLRPLHDALRDMVEPEVIPKLMEAGIVEVAPLAYMRGRTLNDA-FVILDEAQNTTPAQMKMFLTFGSKMVVTGDITQVPGGQKSGLRLVRH-ELTSSDVVRHQLVGHIVDAYEDYEEREARELKR.................................................................................................................................................................................... 332
12 -13.300[T] COG1875 Predicted ATPase related to phosphate starvation-inducible protein PhoH  ali follow..  14  252......................................SAEQRVAIDLLND----DAVGIVSIGGPAGTGKSALLEAVMERRIQRKIIVFRPGYLPGDQEEKMGPWAQAVFDTLSSMVSQNIIDEALSRGLIEVLPLTHIRGRSLHDA-FVIVDEAQSLERNVLLTMLSQNSRVVLTHDVAQRLRVGRYDGIVSVVEALKDHELLQRSERSRIAELVTQVLDAPSL........................................................................................................................................................................................ 458
13 -11.800[R] COG1444 Predicted P-loop ATPase fused to an acetyltransferase  ali follow..  10  219.....................................ATQDQVEVLKLFEVFYHKPKKQALVIIADRGRGKSAALGLGLAGIRVQIVVSAMEYSNLETLLEFALKGLEALGYKPGVEREGGEIRAIKASGIFID--VTPYMLLKRENADIVAIDEAAGVPLPVLYAVHKKFNRLVFATTIHGYEGAGRGFSIRTDVYLYEMEEPIRYGRGDPVEEWLFDAAEPAKIEAEDLEYVKRQEVLYLKEEDILKSEEVFAHYRNEPDDLGMLLDAELAYEGGLDDLSIDQALRGLKLPGNIIPDRFLKYWRLPEFAKLRGWRIVRIATHPELQDMGLGTLMLKKIEEEARE-------LGMDYVGVGFGVYDR--VRNGYVPIHLSPERNPSSGEYSVLLVKPLNEKAEAYV... 635
14 -10.700[R] COG0802 Predicted ATPase or kinase  ali follow..  20  1................................MKRLMMITQSPEATMAFAQKLADLAGDVITLEGDLGAGKTSFTKGLALGLGIKRVVKSPT-----TIIREYKGRLPLYHMDVYRLNEEEE---------------DLGFDEYFHGDGVTVVEWASLIEGRLPPVRLAI--TITHAGENER.................................................................................................................................................................................................................................... 131
15 -10.600[U] COG3267 Type II secretory pathway, component ExeA (predicted ATPase)  ali follow..  14  22...................................LYLSQRHQEAIVHLQAGLGDGGG-FAMLTGEVGTGKTTVARAILASLPGKTRAGMILN---------PTFSDLELLEAICDEFEVSYPKKATLKKLTQVLHEFLLAEHAQGIQVLLMIDEAQHLAPDVLEQLRLLTNKVLLIGQPE----------LQEKLRLPQLRQLAQR------ITGRYHLLPLNEEQTADYIRFRIEQASGNPELFNRKACQWIAEQTHGIPRLINLV.............................................................................................................................................. 237
16 -10.600[V] COG4096 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases  ali follow..  13  435.........EELLEMLGSEPQKQNQWFADNPGMSELGLRYYQEDAVRAVEKAIVKGQQEILLAMA-TGTGKTRTAIAMMFRL-KRILFLV-GEQALGAFEDDTFNSIFDIKGLTDKFPEDSTKIHVATVQSLVKRTLQSDEPMPVARYDCIVVDEAGELQFRSQLDYVSAYRRILKIA--TATPALHTVQIFGEPVYRYTYRTAVIDG-ITRNAQEGVYLSKGEQVERISPQGEVINDTLEDDQDFEVADFNRGLVIPAFNRAVCNELTNYLDPTGSQKTL---VFCVTNAHADMVVE------------------ELRAAFKKKYPQLEHDAIIKITGDADKDARKVQTMITRFNKERLPNIVVTVD-TTGVDIPSIIVFLRKVRSRILYEQMKGRA-TRNKTSFKIFD 861
17 -10.400[L] COG1112 Superfamily I DNA and RNA helicases and helicase subunits  ali follow..  11  366...............................GPGEYILDSSQLKAYQSML------TKRLSIIQGPPGTGKSFVTLKAIETLVLPILVACQTNHAVDQILIRLLHQGASVMRLFSNKRAAILLRGANVIGMTTTGLNKYRDILERINPKICFIEEAAVLEGPIIPAVFPSLEQLVLIGDHKQLRPGCSTYALRQDPFNLSISMFERLVENDTRLTMQRRMH-------PQIRRLVSSVYEDLSDYEITKYWPSIPGMGE---------IRRFFLTHSRIEDNDGFASKINLFEAQMLVQFAVYLINNGVEPQKITC-----------------LTFYAAQKDLIERLLSESLNREKHFIKVA---TVDGYQGEENDVVLLSLVRNNDRLSSPHRVCVSLSRARRGLFIF. 939
18 -10.300[KL] COG1061 DNA or RNA helicases of superfamily II  ali follow..  13  38.FRIPAMRYRAVVEALQAEDVFFIDEAKQLVPSLEMEPYPHQSEALA---AWKLAGRQGVVVLP--TAAGKTYLAQLAMQATPRTTLIVVPTLDLMHQWYA-------HLVAAFPDAE-GGGSRDKSPVLVATYDSAAIHAEALGNQYALIVFDECHHLPTDFSKVIAEYAIAPYRLG----LSATGKHADLNILIGQEVYRKRAEDLAGKALAEHEIV--NNLIQIRNDFLRQSKVSLGSIQGWQMFVQMSARSQSGRRAMLAHREAKEIALGTDSKLRILANLLAKHYPERVLIFTADNATVYKISQDLLIPAIT------------------------TPVKERHEILTKFREGEYNTLVASHV--NEGVDVPAAIILSGTGSTREYIQRL---RILRKGN...... 427
19 -10.300[R] COG2842 Uncharacterized ATPase, putative transposase  ali follow..  14  44........IADVEAKLAAYLEKKAVQAREFVEAPAFIETATSRQIFKTLEF--AQIANCLATVYGMSGVGKTKAIQEFAKSHANVWLVTASPS-------------RSSLSEILYEIALELGISDAPRRKGTLSRLIARKIKG---TEGLLIVDEADHLPYEALEELRIMGIGLVLVGNDKVYTRMKGGISPSH-----EYARLWSR........................................................................................................................................................................................................... 223
20 -10.200[R] COG3911 Predicted ATPase  ali follow..  10  1....................................................MQNDFDRVFVLTGGPGSGKTTLIAALRRA----FATSVVAGRGIVRDQSSIGGTALPWSDRTLFAELMLSWEMRSYQNAV-------------EQKGPVFFDR-GVPETLGYLRFIAPPWPDIFAQDEERKQTPDEAKCTYHALAEYELVPLPLAPVETRLRFVLADAG............................................................................................................................................................................................. 181
21 -10.200[L] COG2256 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  16  7................DFSGDEDFRPLAARMRPQTVEQYIGQQHILKPLRRALEAGHIHSMILWGPPGTGKTTLAEVAANYANAEVERVSAVTSGVKEIRAAIE---------------------------------KARENKLSGRRTILFVDEVHRFNKSQQDAFLPHDGTVTFIGATTENPSFELNNALLSRARVYKLTSLNQQEILQALHQAIADTERG........................................................................................................................................................................................... 185
22 -10.100[L] COG0470 ATPase involved in DNA replication  ali follow..  16  1..............MSTSTEKRSKENLPWVEKYRPETLDEGQNEVITTVRKFVDEGKLPHLLFYGPPGTGKTSTIVALAREIYGKLELNASDDRGIDVVRNQ-------------------------------IKDFASTRQIFSKGFKLIILDEADAMTNAAQNALRRVIERCVLANYAHKLTPA-----LLSRCTRFRFQPLPQEAIERRIANVLV--HEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDEDEISDD............................................................................................................................................... 230
23 -10.100[L] COG1484 DNA replication protein  ali follow..  11  57...CSCMAERKVKRLLGASEITHAFRQLGFKEFRTEGKPQAIKDAFECTKEYVADCRKNSIALLGQPGSGKTHLLTAAANELCYVPVIYFPFVEGFTDLKNDFALLEAKLNRMK--------------------------------QADVLFIDDATDWQLEQMYSVLNYRYL-------NHKPILLSSELTIEGLVRVLGTKIYEMCSDYLVIIKGAAYE............................................................................................................................................................................................. 257
24 -10.000[L] KOG0991 Replication factor C, subunit RFC2  ali follow..  12  53.........................................NEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPLELNASNDRGIDVVRNKIKMFAQQ------------------------------KVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIALACNASDKIIELTDAQILTRLMNVIEKERVYTDDGLEAIIFTAQDMRQALNNLQSTFSGFGFINSENVFKVCDEPHPLLVKEMIQHC--VNANIDEAYKILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKLE...................................................................................................... 315
25 -9.800[R] COG3910 Predicted ATPase  ali follow..  15  35........................................................KTPITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAE-LRAEDVLGYIRRQNENGIVRNNSLDRRSHGEGFLDIMHRRLHGAGLYFLDEESPLSAAIIRQAADSGGQLIIA--EATIYYFDEDGITERLYDELENIAFLRR........................................................................................................................................................................................................... 247
26 -9.530[S] COG3421 Uncharacterized protein conserved in bacteria  ali follow..  23.....DWVEDRKSTLEEIEQTDFFALPEFVERNLKYPFFEWQKSALENFVIFDRASKLK-LLFNMATGAGKTMMMAALILYY-RHFLFFVNQ-KTENNFIDPAHAKFLFTEKILQGDTVIPIRKVEMFSPHSDGIEIKFTSIQKLYNDIVMLGDEAHMVLELLLNKNGNPGQNVLL-----TATLPENADVQQKYADKIITKFGLKEFLQKGYTKEINLVSSTLNKKERVLHALLFAWYRHQIKPVMLFRSKTIDESKADYSAFLNWAENVQADDFEFLDTFSGSLNNSDNANEQGKTRTEQALKFMQDNKFGFAHLANWVKQNYQKHNVIITNSETNKNKTEKTDSETEKLLNNLEA-PIRAIFTVDRTEGWDVLNLFDIVKKSGKTAAATVSEKQLIGRGVR...... 514
27 -9.400[L] COG1074 ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains)  ali follow..  14  296..EFDPALLDEATDLRNGAKKLLEKLKTDYFTRSPEQHLKSLAEMKPVIETLVQ-------------------LVISYGKRFEAA--------KQEKSIIDFSDLEHYCLA--ILTAENDKGEREPSEAARFYQEQFHE-----------VLVDETNLVQESILQLVTSETGNLFMVGDVKQ-PLL--TESGEGTGRKIDLNKNFRSRAD--ILDSTNELKLGAAYPDNDETETELLLIDNAEDTDASEEAEELETVQFEAKAIAKEIRKLISSPFKVIQYRDIVILLRSMPWAGADENELSLIRLENKKAPYYEAMKDYLAAGDRSDELYQKLNTFYGHLQKWGGKQRQANLRVLYDRARQYLMTIHSSKGLEFPVVFVAGLGRNFNMMELRVLYVALTRAKEKLFLI. 881
28 -9.370[LD] KOG2227 Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase  ali follow..  14  130......................................EDEQIRIFEFVKGCIDQQKAGSLYICGCPGTGKSLSMEKVVQQVGDWSTQAGLPPVDTLSVNCTSLSKTTDIFSKILGEKPGKNANTNSSPLQHLQNLFSQKQESSSSRMMLIIADEMDYLDRGVLYDLFMLFSRCILIGVANAID-CKPMVITFRAYSKDQILRILQERQPKALELCARKVAA............................................................................................................................................................................................ 342
29 -9.310[S] COG4916 Uncharacterized protein containing a TIR (Toll-Interleukin 1-resistance) domain  ali follow..  11  18....................................PYTYVKPKHFGEVRADISQVGKHL-LIEGPSGIGKTCVVFKVFEELQWS------QGRDFTYVGCRDQNAEQIIDDFL-----------------------KNAAAGNALSPCVLVIDDFHLLSQAKRMEIGSTPAKVILIGAGVSL--LSDAYDLGPRLGSYALTRASDVEIDKLISEGEQALA............................................................................................................................................................................................. 186
30 -9.270[F] COG2019 Archaeal adenylate kinase  ali follow..  11  2...........................................................RSVITGVAGVGKTTVLDIVARESGIPVV------NYGTLMFEVAKRRGLVENR-----------DQIRKLSRETQVDLQKLAGEEIGKMENAIVDTHMSIKTP-VLRSINASVFVIIEADPAII-----------------KRRRDNDPTRARDDEGVDSIREHQEMNRYFAAAYSIFSGATVK---------IVKNEEGKPEQAADEIVRVI.......................................................................................................................................... 180
31 -9.240[L] KOG0990 Replication factor C, subunit RFC5  ali follow..  13  56.........................................HRDIIDTIDRLTNENKLPHLLLYGPPGTGKTSTILAVARKLYGPLELNASDDRGIDVVRQQIQDFASTQS------------------------------SLGKSSVKLVLLDEADAMTKDAQFALRRVIEKALIGNHVNKIIPA-----LQSRCTRFRFAPLDGVHMSQRLKHVIE--AERLVVSDCGLAALVRLSNGDMRKAL-----NILQSTHMASKEITEEESKQITEEDVYLCTGNPLPKDIEQISHWLLNKPFDECYKD....................................................................................................... 293
32 -9.170[L] COG1198 Primosomal protein N` (replication factor Y) - superfamily II helicase  ali follow..  14  228...VNFFVDQGAVTIVQKEVQRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGS-SQPPFLLQGITGSGKTEVYLQIIQGAGKTAILLVPTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGDAQVVVGARSAIFAPLKNLGVMIIDEEH--AREVAILRAQYNQATLVLGSAT--PSL--ESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQDRLVKKEQVVLMLNRRGYSSFNCDISLTLHMDTKTMNIPQVCPNCKSRSIRYYGTG----TQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGEADIL----------------TQMIAKGLDFPNVTLVGVLNADTALN----FRSSERTFQLLTQV. 649
33 -9.160[H] COG2087 Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase  ali follow..  15  2......................................................TDKNRSVFILGGARSGKSRFAEELAGKAGGRLHYLATGRAWDDEMRDRISH-----HQ---------ERRGGEWTTHEAPVDIATVLQRLDSPDSVILIDCLTL--AELEAAIVSTRAKLILVSNE-----VGLG-----IVPENRMAREFRDHAHQRVAAIAGEV.............................................................................................................................................................................................. 160
34 -9.100[R] COG2607 Predicted ATPase (AAA+ superfamily)  ali follow..  14  63.....................................VGRQTELLVRNTEQFIVGRPANNVLMSGARGTGKSSLVKALLHEYADKGL------RLIEVDKSDLIGLPYLLTLL-----------------------------KECPEKFIVFCDDLSFESGDETYKALKT----ALDGGLSQRCA................................................................................................................................................................................................................................. 171
35 -9.060[LO] COG1474 Cdc6-related protein, AAA superfamily ATPase  ali follow..  14  46......................................NEQINSLATILVSALRGETPSNVLIYGKTGTGKTAVTRYVGKELERVSEDKSLFCSVVYINCEVIDTQYRLLANLARHFEEEVPMTGWPTDQVFMKFKEAIDARDQV----IIILDEIDKLGDDVLYNLSRINTDMIGVSNDLKFTELGEEELIFPPYDAEQISDILKQRAKMAYNDGV................................................................................................................................................................................................. 240
36 -9.030[G] COG2074 2-phosphoglycerate kinase  ali follow..  40ASRIEAHLKKNKVDLITIEE------LVEIVSEHLRKEDPEVAEKYMLWRKIRQCKEPLIILIGGASGVGTSSIAFEVANRLGIRNMIST-VSRELLPSIYESSYTAYQSLRIPPPPELDEVLIGFRDHVESVSIGVEAVIERALTEGISIVIEGVHIVPGFIREDLVNKENVAMFV--------------LTVSDENVHKGRFYSRCRQMWARRPLKRYISYFWAI--------RRIHRYIENQARKHGVPVIENIDTTIDSIIKSLTKTT.......................................................................................................................................... 294

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.