current user: public

If you have questions about the server, please let us know.

Query: [R] COG0536 Predicted GTPase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500
# Score Template Links and tools%idFirst MNRFIDRVVLHLAAGDGGNGCVSVHREKFKPLGGPDGGNGGHGGDIILEVTAQVHTLLDFHFHPHVKAERGANGAGDHRNGARGKDLVLEVPPGTVVLNEKGETLADLTSVGMKFIAAAGGNGGLGNAALASKARKAPGFALIGEPGEAHDLILELKSMADVGLVGFPSAGKSSLISVMSAAKPKIGDYPFTTLQPNLGVVNVGHETFTMADVPGLIPGASEGKGLGLDFLRHIERTSVLVHVVDTATMDPGRDPISDIEALEAELAAYQSALDEDTGLGDLSQRPRLVVLNKADVPEAEELAEFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQDARKKRPKEKAESVIIKPKAVDHRTKGQFQIKPDPEVQGGFIITGEKPERWILQTDFENDEAVGYLADRLAKLGIEDGLRKAGAHVGANVTIGGISFEWEPMTTAGDDPVLTGRGTDVRLEQTSRISAAERKRASQVRRGLIDELDYGEDQEASRERWEGLast
1 -132.000[R] COG0536 Predicted GTPase  ali  100  1MNRFIDRVVLHLAAGDGGNGCVSVHREKFKPLGGPDGGNGGHGGDIILEVTAQVHTLLDFHFHPHVKAERGANGAGDHRNGARGKDLVLEVPPGTVVLNEKGETLADLTSVGMKFIAAAGGNGGLGNAALASKARKAPGFALIGEPGEAHDLILELKSMADVGLVGFPSAGKSSLISVMSAAKPKIGDYPFTTLQPNLGVVNVGHETFTMADVPGLIPGASEGKGLGLDFLRHIERTSVLVHVVDTATMDPGRDPISDIEALEAELAAYQSALDEDTGLGDLSQRPRLVVLNKADVPEAEELAEFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQDARKKRPKEKAESVIIKPKAVDHRTKGQFQIKPDPEVQGGFIITGEKPERWILQTDFENDEAVGYLADRLAKLGIEDGLRKAGAHVGANVTIGGISFEWEPMTTAGDDPVLTGRGTDVRLEQTSRISAAERKRASQVRRGLIDELDYGEDQEASRERWEG 501
2 -88.300[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  35  89.GNFVDVRIVKCKSGAGGSGAVSFFRDAGRSIGPPDGGDGGAGGSVYIQAVAGLGSLAKMK--TTYTAEDGEAGAARQLDGMRGRDVLIQVPVGTVVKWLPPQKVRELVEREMRVCLLKGGQGGLGNMHFLTNLIRNPRFSKPGRNGLEQHFLFELKSIADLGLIGLPNAGKSTILNKISNAKPKIGHWQFTTLSPTIGTVSLGFDVFTVADIPGIIQGASLDKGMGLEFLRHIERSNGWVFVLDLSN----KNPLNDLQLLIEEVGTLEK----------VKTKNILIVCNKVDIDAEKSESFAKYLQVEKSQEWDCVPISALREKT............................................................................................................................................................................. 499
3 -53.900[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  15  2..................................................................................................SSTLAKIAEIEAEMARTQKNKATAHHLGKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVL------KPLGHKKIIENELEGFGIRLNSK---------PPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLN-----KIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKN.......................................................... 328
4 -51.900[R] COG1163 Predicted GTPase  ali follow..  13  2..................................................................................................STTVEKIKAIEDEMARTQKNKATSFHLGAKLAKLRRELLTSASSGSGGGAGIGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTVPGVIRYKGAKIQMLDLPGIIDGAKDGRGRGKQVIAVARTCNLLFIILDVN------KPLHHKQIIEKELEGVG---------IRLNKTPPDILIKKKEKGGISITNTVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLEASSRRYMPAIYV----LNKIDSLSIEELELLYRIPNAVPISSGQDWNLDELLQVMWDRLNLVRIYTKPKGQIPDFTDPVVLRSDRCSVKDFCNQIHKS.......................................................... 330
5 -47.800[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  13  64............................................................AIIDEFPRLEQIHPFYGDLLHVLYNKDHYKLALGQVISKISKDYVKLLKYGDSLYRCKCLKVAALGRMCTVLKRITPSLAYLEQIRQHMARLPSIDPNTRTVLICGYPNVGKSSFMNKVTRADVDVQPYAFTTKSLFVGHTDYKYLRYQVIDTPGILDRPFEDRNCSITALAHLRAAVLFFLDISGSCGYTIAQQAALFHSIKSLF----------------MNKPLVIVCNKTDLMPMENISEEDRKLIEESEEQVLLKMSTLTDEGVMSVKNAACERLLDQRVEAKMKSKKIN---------DHLNRFHVAIPKPRDSIERLPCIPQVVLEAKAKEAAAMEKRKTEKDLEEENGGAGVYSASLKKNYILQHDEWKEDIMPEILDGHDPDILQRLAELEREEGIREAGVEEADMEMDIEKLSDEQLKQLSEIRKKKA... 504
6 -45.500[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  18  2...................................................................................................GIIERIKEIEAEMARTQKNKATEYHLGQAKLRTQLLEPPKGASGGGEGFE----VTKYGHGRVALIGFPSVGKSTLLTMLTGTHSEAASYEFTTLTCIPGVIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVAKSSDLVLMVLDASKSE------GHRQILTKELEAVGLRLNKT---------PPQIYFKKKKTGGISFNTTAPLTHIDEKLCYQILEYKIHNAEVLFRENATVDDFIDVIEGNRKYIKCVYVYNK------IDVVGIDDVDRLSRQPNSIVISCNLKLNLDRLLARMWDEMGLVRVYSKPQGFDEPFVLSSDRGGCTVE..................................................................... 319
7 -33.600[R] COG1084 Predicted GTPase  ali follow..  20  124........................................................................................................................RREAFGRISSVIKRIEGDLDFLDFAKNKLRNMPTVDLDAFTVVIAGFPNVGKSTLLRTLTGAEPEVADYPFTTKGIQIGHLERKWKRIQVIDTPGLLDRPEDMNNIELQAMVALENIAVIMFIFDASETCGYTL---------------ESQYSLYLGIRSVFDIPVVTVFNKMDLAENVKYLEEYINMVE-----DPLKVSAFEGRGVSKIIKKLEGLYEKETREAHDN....................................................................................................................................................... 335
8 -29.900[J] COG0012 Predicted GTPase, probable translation factor  ali follow..  26  2................................................................................................................................................................EIGVVGKPNVGKSTFFSAATLVDVEIANYPFTTIDANVGVTYAIAEPVKMIDVAGLVPGAHEGRGLGNKFLDDLRMASALIHVVDVTGKTDNHDPIEDIEFLEREIDYWIYGILSKGSEIRRINKPMIIAANKADAASEEQINRLIKE--GEKRGYIVVPTSAAAELTLRKAAKAILKDMNERQKKALLMIKEKVLDRFGSTGVQEVINKAVFELLNLIPVYPVQDENPHVFLMKKGSNPRDLAFKVHTDLGRGFLYAIKRRIGLQFNDIIKI.................................................................... 392
9 -24.100[R] KOG1491 Predicted GTP-binding protein (ODN superfamily)  ali follow..  18  4..............................................................................................................................................KKQVEEKKVLLGRPGNNLKAGIVGLANVGKSTFFQAITRCPGNPANYPFATIDPEEARVIVPSPRFTVYDIAGLTKGASAGEGLGNAFLSHIRSVDSIYQVVEIIHVEGDVDPVRDLEIINQELRLKDIEFAQKNSMFLLTAKPCIYLINLSERDYIRKKNKHLLRIDKYSPGDLIIPFSVSLEERLSHMSPE-----DAEEELKKLQTISALPKIITTMRQKLDLISFFTCGPDEVREWTIRGTKAPQAAGVIHNDLMNTFILAQEDVFEYKDDSAIKAAGVEDGDIIYF.................................................................... 387
10 -19.600[E] COG4917 Ethanolamine utilization protein  ali follow..  16  1..............................................................................................................................................................MKRIAFVGSVGAGKTTLFNALQGNYTLARK-----------TQAVEFNDKGDIDTPGEY---FNHPRWYHALITTLQDVDMLIYVHGAND---------------------PESRLPAGLLDIGVSKRQIAVISKTDMPDADVA-ATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE.................................................................................................................................................... 159
11 -19.200[R] COG3596 Predicted GTPase  ali follow..  15  41.................................................................................................................................................................IGIMGKTGAGKSSLCNALFAGESPVSDVAACTRDPLRFRLQIGEHFMTIVDLPGVGESGVRDTEYAALYREQLPRLDLILWLIKADDRALATD-----EHFYRQVIGEA------------YRHKMLFVISQSDKAEPTSGGNILSTEQKQNPVHPVCAVSVRLQWGLRVMAERMIKCLPREPSSPVVALLQHP.................................................................................................................................................. 231
12 -18.700[R] KOG2486 Predicted GTPase  ali follow..  17  78........................................................................................LFIPPETDISGEDSASLTTRILKGSNIVLSKYAR----QADYVKSSVKTEDCPADG--------------LPEFALVGRSNVGKSSLLNSLVRRKALTSKKPGKTQCINHFRI---NDKWYLVDLPGY-ELKQDWNKFTKDYFLNRSTLVSVFLLVDA----------------SIPVKPIDLEYAS---WLGQNQVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDPWIMTSSVTNQGRDEILLHMAQLRNYWLKH........................................................................................................................................................... 318
13 -18.200[R] KOG0410 Predicted GTP binding protein  ali follow..  21  136.ESLEELEQLADTAGLAVVGSTYQKLASPNPR-----GSGKVAEIKSAINALDVETVIFDDELSPGQLRNLEKAFGGDVRVCDRTALILDI--NQRAATHEAALQVALAQRMWTHLERQSGGQGMGEKQIEVDKRILRT--------QIGVLKKELESVRKVSLVGYTNAGKSTLLNQLTGANVLAENRLFATLDPTTRRVQMNGKEFLLTDTVGFIQKLPTT--LVAAFLEEIAESSLLVHVVDISHPL-AEQQIEAVEKVMSELD--------------VSSIPKLVVWNKVDRVDDPQKVKLEAEETGDT-----ICISALTGEGLDDFCNAVHEKLKD............................................................................................................................................................... 474
14 -18.100[R] COG1159 GTPase  ali follow..  14  11.................................................................................................................................................................IAIVGRPNVGKSTLLNKLLGQKISISRKAQTTRHRIVGIHTEGPYQAIYVDTPGLHMEEKRNRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLN--------------------KLRDGKAPVILAVNKVDNVQEKVDLLPHLQFLASQMNLDIVPISAETGMNVDTIAGIVRKHLPEAIHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFVTNERGGYDINGLILVEREGQKKMVIG--AKIKTIGIEARKDM...................................................................... 265
15 -17.800[R] COG0218 Predicted GTPase  ali follow..  19  25..............................................................................................................................................................LPEIALAGRSNVGKSSFINTMLNRKARTSGKPGKTQLLNFFNID---DKMRFVDVPGY-KEREKWGCMIEEYLTTRENLRAVVSLVDLRHDPSADD-------------------VQMYEFLKYYEIPVIIVATKADKIPRGKHESAIKKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKL................................................................................................................................................................. 195
16 -17.000[R] COG2262 GTPases  ali follow..  22  115.................................................................................ARTHEGKLQVELAQLRH-----LATRLVRGWTHLERQKGGIGLRGPGETQLETDRQSRLERVEKQREQGRQSRIKADVPTVSLVGYTNAGKSTLFNRITEARVYAADQLFATLDPTLRRIDVDVGETVLADTVGFIRHLPHD--LVAAFLQETRQATLLLHVIDAADVR-VQENIEAVNTVLEEID--------------AHEIPTLLVMNKIDMLEDFEP----RIDRDEENKPIRVWLSAQTGAGIPQLFQALTERLSG............................................................................................................................................................... 363
17 -16.900[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  21  20..........................................................................................................................................................EMELT----LVGLQFSGKTTFVNVIASGQFAEDMIP--TVGFNMRKITRGNVTIKVWDIGG-------QPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDK---------------QLAGIPVLVLGNKRDLPGATGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQSR............................................................................................................................................................ 186
18 -16.800[P] COG0370 Fe2+ transport system protein B  ali follow..  20  6.................................................................................................................................................................YCILGNPNTGKTSLFNALTGSYEYVGNWSGVTVEKKVG--TLRSKTGKLIDLPGILNPISRDETVVTRFLLE-EKFDCMLNIVDSSQ-------------IERNLNLTVQLLE--------YGAPVVMGLNMIDVAAGRG-IHLNIQNLAKKLRIPILPVVARSGKGTEDILSTLSEKHVAPAIP........................................................................................................................................................... 167
19 -16.800[J] KOG1191 Mitochondrial GTPase  ali follow..  15  216.....DVVELQC---HGSEVCLRRVLRTCVEAGARLAEPG--NGRLDLSQAENVEKLISAKSSAAADAALEGIQGGFSSLVKSLRAQCIELLTEI-------EARLDFEDEMPPLDIES-------INKITSMSQDVESALDTANYDK-------LQSGLQIAIVGRPNVGKSSLLNAWSKSRAIVTEVAGTTRDVVEANVTVRGVPITLLDTAGIRETNDIVEKIGVE-ETAAKVADVIIMAVSAVEGWTEED-----TELLRKIQSDKVSFYDLFGGLLYLKQPMILVMNKIDCAPPGSCDQLEDQRKKEEVFHKSVFTSAVTGQGIEELEDAILEILGLDRVPTGGHQWTVNQRQC---------------------------EQLVRTKEALVRLREAIEDEIPIDFWTIELREAALSLAQISGQDV...................................................................... 597
20 -16.500[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  22  17..........................................................................................................................................................EVRIL----LLGLDNAGKTTLLKQLASED-------ISHITPTQGFVQSQGFKLNVWDIGG-------QRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEE---------------KLSCVPVLIFANKQDLLTASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK............................................................................................................................................................ 182
21 -16.200[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  15  17..........................................................................................................................................................QYSIL----ILGLDNAGKTTFLETLKKEYSLAFK-ALEKIQPTVGIPVDSKQILKFWDVGG-------QESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMD---------------EIEGVPILMLANKQDRQDRMEVQDIKIAEHISARDSRVLPISALTGEGVKDAIEWMIVRLERNKKSRPPI....................................................................................................................................................... 196
22 -16.000[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  21  17..........................................................................................................................................................EMRIL----ILGLDGAGKTTILYRLQVGE-------VVTTIPTIGFVTYKNLKFQVWDLGG-------QTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLRE---------------ELAGAILVVLANKQDMDGCAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK............................................................................................................................................................. 181
23 -15.800[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  25  16..........................................................................................................................................................ELRLL----MLGLDNAGKTTILKKFNGED-------IDTISPTLGFLEHRGFKLNIWDVGG-------QKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVE---------------RLAGATLLIFANKQDLPGANAIREALELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFT........................................................................................................................................................... 182
24 -15.700[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  20  18..........................................................................................................................................................ELRIL----ILGLDGAGKTTILYRLQIGE-------VVTTKPTIGFLSYKNLKLNVWDLGG-------QTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQE---------------ELQDAALLVFANKQDQPGASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEEQ............................................................................................................................................................. 182
25 -15.700[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  20  21..........................................................................................................................................................EMRIL----MLGLDAAGKTTILYKLKLNQ-------SVVTIPTVGFVTYKNIKFNVWDVGG-------QDKIRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIISD---------------EMRDCLLLVLANKQDLPGAAQITDVLQLDKLKDRLWNVQPTCALTGDGLLEGLAWLSQNAKL............................................................................................................................................................... 183
26 -15.600[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  23  17..........................................................................................................................................................EMRIL----MVGLDAAGKTTILYKLKLGE-------IVTTIPTIGFVEYKNISFTVWDVGG-------QDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNE---------------ELRDAVLLVFANKQDLPNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIAS............................................................................................................................................................... 179
27 -15.100[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  18  20..........................................................................................................................................................EAKIL----FLGLDNAGKTTLLHMLKDERLVQHQ---PTQHPTSEELSIGKIKFKAFDLGG-------HQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLSD---------------ALATVPFLILGNKIDIPYAASEDELRYHGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYIN................................................................................................................................................................ 193
28 -14.100[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  21  56...............................................................................................................................................................NTVLLSGLSGSGKTVLFYQLRDGSSHQGAV--TSMEPNEGTFVLHNEPVHLIDVPG-------HSRLISKLEEYLPRAAAVVFVVDALEFLPNRAASEYLYDILTNASVIKNKT------------PVLLCCNKTDKVTAEFIRKQMEKEIDKLRVSRSAISTADIANDF............................................................................................................................................................................ 217
29 -13.900[R] COG1160 Predicted GTPases  ali follow..  13  140...................................................................................GEIEQIAASQGRGVTQLMEQVLAPFAEKMENADENDRTSEEEQDEWEQEFDFDSEEDTALIDDALDEELEEEQDKNIKIAIVGRPNVGKSTLTNRILGEDRVVFDMPGTTRDSIYIPMERDGQQYTLIDTAGVRKRGKVHLAV-IKTLQAIQDANVVLLTIDARENISDQD-------------------LSLLGFILNAGRSLVIVVNKWDGLDQDVKKSELDRRLDFIDFARVHFISALHGSGVGNLFDSIKEAYACATQKMTTSLLTRILQMATDEHQPPMIGGRAHPGGYNPPIIVVHGNQMDKL--------PDSYKRY--------LSNYYRKSLKIIGSPIRL-----LFQEGSNPFAGRKNKLTPNQLRKRKRLMKFIKKAKR........................... 504
30 -13.900[R] COG0486 Predicted GTPase  ali follow..  17  88.....DVLELQG---HGGQVVLDLLLKRILQLEGLRLARPGENDKLDLAQAEAIADLIDASSEQAARSALKSLQGEFSNKVNQLVDSVIYLRTYV-------EAAIDFPDEEIDFLADGK------EAHLNDIITQLDHVRSEAKQGS-------LREGMKVVIAGRPNAGKSSLLNALAGREAAITDIAGTTRDVLREHIHIDGMPLHIIDTAGLREATDEVERIGIV-WSEIEQADRILLMLDST----------------EADNQDLEKVRSEFLTKLPSNIPVTIVRNKADLSGENEGIVEQNGY-------TVITLSAKTQQGIALLREHLKQSMGYQTNME.......................................................................................................................................................... 394
31 -13.400[R] COG2229 Predicted GTPase  ali follow..  19  3..........................................................................................................................................................ENKII----FTGPVGVGKTTAIAAISDEALTLDRKRNTTVAMDYGAISLDEDKVHLYGTPGLSQGSM------------------LVLLLDNARTNPLKDLEFFLHSFRGLLE----------------KAPVVVGITKMDIRSQPGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSIDP............................................................................................................................................................... 174
32 -12.500[R] KOG1533 Predicted GTPase  ali follow..  14  38...................................................................................................................................................................VIGAPGAGKSTFCAGLTNLDPANDTMAYAPLGPNGALKEANHKKYLIIDCPGQLE-LYKSEGELWKVIRFLEKSGCALHLADSL--------------YCSDPSKFISVALSTLATMVTMEMPQVNCLSKADLFSEDGTYEAICGVISDFDLVSFVPLAVENKESMMKVIQMVDAANGFSLTEQGDIRELILNSK............................................................................................................................................... 299
33 -12.400[K] KOG1534 Putative transcription factor FET5  ali follow..  13  8...................................................................................................................................................................VCGVASSGKSTFCGALMNLDPAAENFEWEPYGPNGGLIGDYDEDYLIFDMPGQIE-VPILPALIRHLQVTLNFRPCAVYLLESQ--------------FLVDRTKFFAGVLSAMSAMVMMEVPHINLLSKMDLLKDHELNRCIVQLIDDFNMVNFLPLESGNEESVSRVLSYIDDATQWYEDQEPKDPDRFEADDLEDDE.......................................................................................................................................... 276
34 -12.200[R] KOG0395 Ras-related GTPase  ali follow..  16  6.............................................................................................................................................SSGNCTLSVPAKNSYRMV----VLGASRVGKSSIVSRFLNGRPTIEDFHRKVYN-----IRGDMYQLDILDTSG----NHPFPAMRRLSILTGD---ILVFSLD------NRESFDEVKRLQKQILEVKSCLKNKTK--EAAELPMVICGNKNDHGELCRQVTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKIS.................................................................................................................................................. 205
35 -11.500[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  18  60..............................................................................................................................RKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLIGPEPTTDRFQFRALS-GFGNAFLNRESVTIVDTPGILSGEKQRIDRGYDFTG-AERVDRIILLFDAHK-----DISDEFKRCIEALAGNEDKIR--------------IVLNKSDMVDHQQLMRVYGALM............................................................................................................................................................................................... 271
36 -11.100[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  12  1...........................................................................................................................................................MKRPLIIGVGGPVGAGKTMLIERLTRY--------LSTKGYSMAAITNDIYTKEDARI---EDASMNFAAIEEMCDKHPDLQLLFLESGGDNLSATFSPDLVDFSIYIIDVAQGEKIPRKGGQGMIKSD---LFIINKVDLAPYVNVEVMKADTLKSRGNKDFFVTNLKTDEGLKSVADWIEKRLQLALLEE.......................................................................................................................................................... 206
37 -10.800[R] KOG1673 Ras GTPases  ali follow..  12  77..................................................................................................................................DDDTTTEPTVSGRRFGSSSDSDLVSLKIS----LLGDCQTGKTTFVV-------KYVGDENQSFLEMTGLVQGVTISFSIWDVGG----EKRSKDHIPIACKD---AVAILFMFDLTS----RSTLNSVFGWYSQARKWNKTAI------------PILIGTKFDDPNLQWTIVTQARAYAKVMNASLFFSSATHNINVNKIFKFILARLFNLPWKIDRNLTLGE.................................................................................................................................................. 281
38 -10.600[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  19  46...................................................................................................................................................................VVGMAGSGKTSFLHRLVNLDPAVMSLPFGALGPNGGILRADQLDYVLVDTPGQIE-IFTWSASGAIITEAFASTTVVTYVVDTP--------------RSSSPITFMSNMLYACSILYKTRLPLVLAFNKTDVADHKFALEWMEDF-EFYRNIRSVGVSAISGAGMDGFFKAIEASAEEYMET........................................................................................................................................................... 290
39 -10.200[T] KOG4252 GTP-binding protein  ali follow..  19  3....................................................................................................................................................EEDMEVAIKMV----VVGNGAVGKSSMIQRYCKGI-------FTDYKKTIGVVNDEDVRLMLWDTAG----QEEFDAITKAYYRGAQACVLVFSTTD-------RGSFEAVSSWREKVVAEVGDI------------PTVLVQNKIDLLDDSCIKNEEAEALAKRLRLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPEL................................................................................................................................................... 183
40 -10.100[R] KOG0394 Ras-related GTPase  ali follow..  14  1.......................................................................................................................................................MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKK--------NQYKATIGAFEDRLFTLQIWDTAG----QERFQSLGVAFYRGADCCVLVYDVNSMKSFE--------------NLNNWREEFLIQASPSDPENFPFVLIGNKVDVDDGNSRVKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKSGEEEELYLPDT................................................................................................................................................... 190
41 -9.800[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  16  13...........................................................................................................................................................FKLV----LVGDGGTGKTTFVKRHLTGE--------KKYIATIGVTNFGEIKFDVWDTAG----QEKFGGLRDGYYINAQCAIIMFDVTS-------RITYKNVPNWHRDLVRVCENI------------PIVLCGNKVDVKERKVKAKTIT--FHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPA.................................................................................................................................................... 183
42 -9.590[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  13  1...........................................................................................................................................MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQ--------EFQESTIGALDDTTVKFEIWDTAG----QERYHSLAPMYYRG---AQAAIVVYDITN----EESFARAKNWVKELQRQASP-----------NIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSAR................................................................................................................................................... 195
43 -9.530[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  15  62..........................................................................................................................................................KPRIL----LMGLRRSGKSSIQKVVFH---KMSPNETLFLESTNKVSNSSFVNFQIWDFPGQIDFFDPTFDYEMIF----RGTGALIFVIDSQ--DDYMEALARLHLTVTRAYKVNTDI------------NFEVFIHKVDGLSDDHKIETQRDIHQRANDD-SFYLTSIYDHSIFEAFSKVVQKL................................................................................................................................................................. 237
44 -9.500[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  15  433.......................................................................................................................GSEGASATLCKNAGRALIRMISSSKAPEEEDEFDIMGKVI----MLGDSGVGKTSLLIRFRDGR-----YVPSYFLSTVGIVVVDGTRVKLQDTAG----QERFRSVTHAYYR---DAHALLLLYDVTN----KTTYDNIRAWLGEIREYAQE-----------DVVIVLIGNKADCSGSERQVKREDERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDD....................................................................................................................................................... 641
45 -9.330[T] KOG3886 GTP-binding protein  ali follow..  11  10............................................................................................................................TEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVL----LMGKSGSGKTSMRSIIFA---NYIARDTRRLGATILDRIHSLQVLNLWDCGG--QDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKD-MHYYQSCLEAILQNSPDA------------KIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSSCFRTSIWDETLYKAWSSIVYQL................................................................................................................................................................. 241
46 -9.290[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  16  6..........................................................................................................................................................DYDHLFKLLIIGDSGVGKSSLLLRFADNT--------ENYITTIGVINGQRVKLQIWDTAG----QERFRTITSTYYRGTH----VVVVYDVTN----GESFGNVKRWLQEIENNCDSVQ------------KVLVGNKCEENERRVVLESDARNYAQSMNISFFETSAKEDKNVEPMFTCITSLVLTAKLANPQSASKDQ.................................................................................................................................................. 185
47 -9.290[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  18  13...........................................................................................................................................................FKIV----LLGEGCVGKSSLVLRFVENK--------CKHLSTIQAVEDCQADLHIWDTAG----QEKYHALGPIYYRGSNGVLLVFDITD-------RKSFEKVKNWVLEIKTCLGN-----------TAEILIVGNKIDLEEERQVTRQDAEAYAESEGALYMETSAQDNVGISDAFESLTAKMIEHSRTRSTEPPSTN.................................................................................................................................................. 188
48 -9.250[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  15  5..........................................................................................................................................................DYDFLFKIVLIGNAGVGKTCLVRRFTQGL--------PGQGATIGVINGEKVKLQIWDTAG----QERFRSITQSYYRSAN----LILTYDITC----EESFRCLPEWLREIEQYASN-----------KVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVS................................................................................................................................................... 184
49 -9.250[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  14  1.......................................................................................................................................................MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQ-----TAGQERFRTITSSYYRGAHGIIVTYDVTD-------LESFNNVKQWLNEIDRYASE-----------NVNKLLVGNKCDLTSQKVVSTETAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIKTRMASQPAGGSKPP.................................................................................................................................................. 184
50 -9.190[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  18  10...........................................................................................................................................................YKLV----FLGDQSVGKTSIITRFMYDK--------TTYQATIGILEDRTVRLQLWDTAG----QERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERAG------------------DVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGVMFIETSAKAGFNIKPLFRKIAAALPGMESYSNTKNEDM................................................................................................................................................... 184
51 -9.150[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  14  4............................................................................................................................................ATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLF-------RYADDSFTAFVSTVGIRNDKRIKLQIWDTAG----QERYRTITTAYYRGAM----FILMYDITN----EESFNAVQDWSTQIKTYSWD-----------NAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPA................................................................................................................................................... 197
52 -9.090[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  13  35........................................................................................................................................................VISRQATINIGTIGHVAHGKSTVVKAISGVHTVSMPDEFPTDIPGTKGNFRLVRHVSFVDCPGMLNGAAV--------------MDAALLLIAGNESCPQPQTSEHLAAIE-----------------IMKLKHILILQNKIDLVKEREQYEQILAFVQGTEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPR--------------------------IRSFDVNKPGCE------------------DDLKGGVAGGSILKGVLKVGQETEV.................................................................... 296

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Harder T, Godzik A. JAFA: a protein function annotation meta-server. Nucleic Acids Res. 2006 Jul 1;34(Web Server issue):W379-81.