current user: public

If you have questions about the server, please let us know.

Query: [F] COG0563 Adenylate kinase and related kinases, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MNLILMGLPGAGKGTQAEKIIEKYGIPHISTGDMFRAAMKNETELGLKAKSYMDAGELVPDEVTIGIVRDRLSQDDCQNGFLLDGFPRTVAQAEALEDILASLDKKLDYVINIDVPEQLLMDRLTGRRVSPTSGRTYHVIFNPPKVEGICDVDGSELIQRDDDKPETVKKRLEVNQKQAQPLIDFYSEKGYLQNINGDQDISRVFEDINELLKGLSSLast
1 -103.000[F] COG0563 Adenylate kinase and related kinases  ali  100  1MNLILMGLPGAGKGTQAEKIIEKYGIPHISTGDMFRAAMKNETELGLKAKSYMDAGELVPDEVTIGIVRDRLSQDDCQNGFLLDGFPRTVAQAEALEDILASLDKKLDYVINIDVPEQLLMDRLTGRRVSPTSGRTYHVIFNPPKVEGICDVDGSELIQRDDDKPETVKKRLEVNQKQAQPLIDFYSEKGYLQNINGDQDISRVFEDINELLKGLSS 217
2 -99.500[F] KOG3078 Adenylate kinase  ali follow..  44  16IRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATS 232
3 -73.100[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  29  36LVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAKNKFLIDGFPRNQDNLQGWNKTMDG-KADVSFVLFFDCNNEICIERCLER---------------------------GKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDK... 226
4 -31.000[F] COG2019 Archaeal adenylate kinase  ali follow..  14  1MRSVITGVAGVGKTTVLDIVARESGIPVVNYGTLMFEVAKRRG-----LVENRDQIRKLSRETQVDLQKLAGEEIGKMENAIVDTHMSIKTPFGYLPGLPEWVSINASVFVIIEADPAIIKRRRDNDPT-----------------------------ARDDEGVDSIREHQEMNRYFAAAYSIFSGATVKIVK-NEEGKPEQAADEIVRVIK.... 181
5 -19.600[R] COG0645 Predicted kinase  ali follow..  14  2FLAVTHGVSAVGKSQVAMRLVEALGAVRLRS-DIERKRLFGEQPEHDRGQ--FAAGIYSSQATYAHLHQLAAKILQAGYPVVIDAAYLKQNQRQAACHIAEETGVPF-LILDCQAPEAVIAGWLAQRQ------------------------------AEGKDPSDATLDVIRTQQATREPLTAAETVQSKRVDTHDAASLDGLVDGIRQRLPGL.. 185
6 -17.500[G] COG2074 2-phosphoglycerate kinase  ali follow..  11  94..ILIGGASGVGTSSIAFEVANRLGIRNMISTDMIREVMRKIVSLDEVLIGFRDHVESVSIGV--AVIERALTE---GISIVIEGVHIVPGFIRED----LVNKENVAMFVLTVSDENVHKGRFYSR----------------------------CRQMWARRPLKRYISYFWAIRRIHRYIENQARKHGVIENIDVVTTIDSIIKSLTKTTVKGGE 299
7 -17.300[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  19  5.NILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVV----------DELDNQMREGGVIVDYHGCDFFPER-----------WFHIVFVLRTDTNVLYERLETR----------------------------------GYNEKKLTDNIEIFQVLYEEATASYKEEIVHQL--PSNKPEELENNVDQILKWIEQ 165
8 -17.300[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  18  1MLIAITGTPGVGKTTVAKLLAKKLNYEYVSLKDFALEK-VEIDELAYFIERELKGKNAVLDRAHPKLIGERLRERGYDREKIGEN-----VEAELVDAVLIEAIEEHENVIEVDTTNEDVVEEI............................................................................................. 147
9 -14.800[R] COG4639 Predicted kinase  ali follow..  18  11..VVLIGASGAGKSTFARKHFQPF---EVISSDFCRGLVSNDENSQSASRDAFDV--------LHYITTKRLAA---GKLTVIDATNVQPEDRKTLLQMAKQYHCFT-VAIVFDLPEELCHERNQQR-------------------------------SDRQFGSHVVRRHTQMLRRSLRSLEK--EGFRYVYTLKSPEEIANVAIELQPLWNNKKH 177
10 -14.100[F] COG1102 Cytidylate kinase  ali follow..  18  6LVITVSGLAGSGTTTLCRNLAKHYGFKHVYAGLIFRQMAKER---GMSLEEFQKYAELHPE--IDREVDRRQVEAAKECNVVIEG--------RLAGWMVKNADLK----IWLDAPIRVRAERVAKRE----------------------GISVEEAFMKIAEREMQNRKRYLNLYGIDINDLSIYDLIIDTSKWSPEGVFAIVKAAIDHLYEKV.. 181
11 -14.000[G] COG3265 Gluconate kinase  ali follow..  16  4KCIIVMGVSGTGKSCVGQALALALGAKFIDGDDLHPRANIQK----------MAAGQPLNDQ-LERLSDVAYSLQQKNEVGFLVCSALKKQYRDRLREGNEGI-----RFLWLTGDYDLVLHRMQQRA-----------------------------------PESLLKSQFATLEAP-------GSDEPDVIPIDISSSIADVVEHCIAALSL... 168
12 -13.900[F] COG4088 Predicted nucleotide kinase  ali follow..  15  1MPLIIVGYPSSGKTTRSNELKKALE-NIDNTKDYRVIIINDESLNIEKETYRESKNEKAARGLLYSAVQRELSK---STFVICDALNYIKGFRYQLYCESKSMYTTH-CVIHVAVPQDLCRKFNSNKEQPYPDDVLEQLMFRYEEPNGMTRWDSPLFTVLHDDASCPIDDIWSVLIHNKNVKPNQATMVKPPAEVNYLYELDKTTQDVIMLILDNSN 218
13 -13.800[G] KOG3354 Gluconate kinase  ali follow..  18  17..FVVIGPAGSGKTTMAKAVSEKLGFEYIE-GDDLHPKANIEK---------MSQGHPLNDN-NCGGACAMELDKESIKGVVLTCSALKRSYRDILRSSLEHRPAIL-RFIYLAASRETLIKRTTSRK-----------------------------------KADMVESQLAILEAPTA-------DEKDVITISVENGKEQSEEECLDIVHKMVN 188
14 -13.300[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  14  26..ILLNGGSSAGKTSLALAFQDLAAECWMHIGDLFWFALPPEQLDLARVRPFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADD---VIWTREWLVDALRVFEGCRVWMVGVHVSDEEGARREL---------------------------------ERGDRHPGWNRGSARAAHADAE------------FELDTTAPVHELARELHESYQA... 209
15 -12.900[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  16  18..IVIVGPSGAGKDTLMDYAAAQLS--HFTRRVITRSCDAGGEN--HEFNQLEDAGAFA-HGLKYGIPAAVYRHLEAGDVVIANGSRSALPHFGTAFSRL--------KVVNIVARPDVLARRLEQR---------------------------------GRESRDDILRRLERSSLAVAGDFDV-------TTVDNSGAIEDAGKTIMQVLQQSAG 195
16 -12.300[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  14  1MPLVVIGLPASGKSTRARQLRDHFVERGRKVHLISENEAVPKAGFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDL---VILDAGNYIKGYRYELYCMSKVSRTTQ-CTVFTCIPQEEAWTFNSQRTAPDELPGDLCQRYEEPQSNNRWDSPLVVVLPKDTLDMEAIYKALQPLPPNQSTYNAPLGTTNYLFELD--KIVQAIIKEILGAVKI... 233
17 -12.200[E] COG0703 Shikimate kinase  ali follow..  16  73.NIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRT------GADVGWVFDLGE-REEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGV-------------VVYLETTIEKQLARTQRDK-------------------------KRPLLHVETPPREVLEALANERN-------PLYEEIADVTIRTDDQSAKVVANQIIHMLES... 239
18 -12.100[F] COG0283 Cytidylate kinase  ali follow..  14  5KVIAIDGPGASGKGTVAARVAAALGYDYLDTGALYRLELAKKLPAVFSDSRILLGGEDVSDGIVRASLLQRQRDFLTEKGLVADG--RDTGSVVFPQAELK---------IFLTAESKIRAERRAKQIGIPCEGLAFERILSDIEARDEADRNRKVAPLKQQPDALLLDTSRLTIEETVKKVLDWYRK............................. 217
19 -12.100[F] COG0125 Thymidylate kinase  ali follow..  11  6..ITFEGPEGAGKTTVLQEIKNILTAEGL---QVMATREPGGIDIAEQIREVIARRQHLVEKVKPALEQGFIVLCDIDSPLAYQGYARGLGIDEVLSNEFAIGDMMPHVTVYFSIDPEEGLKRIYAN--------------------------GSREKNRLDLEKLDFHTKVQEGYQELMK-----RFPERFHSVDAGQSKDLVVQDVLKVIDEA.. 206
20 -11.400[F] KOG0707 Guanylate kinase  ali follow..  16  140..IVISGPSGVGKGTLISMLMKEFP-------SMFGFSVSHTTRSPRSMEMDGVHYHFADKKVMEKEIKD--------GKFLEFASVHGNLYGTSIESVEAVTDSGKRCILDIDVQGARSVRASS---------DAIFIFVCPPSMKEL-----DRLRARGTETEEQIQKRLRNAEAE----IKEGISSGIFGLILYNDNLEECYKKLKVNHLLLIA 323
21 -11.200[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  11  15..LIVAGPNGSGKSSVYANADLELEGRSVWNPDLLAGRISEVENKPLPEANLVAV------QRIEAWIQSSISV---HKTIGVETVLSTDKYRRLVEAAEAV-GFAIWLFYTVLDSPERSIERIKLR-----------------------AKGGHDV------PADKVRAR---YARSLDQLPWFLERADRAWIWDNSGATPKLIGEKQD....... 183
22 -11.100[F] COG1428 Deoxynucleoside kinases  ali follow..  15  9..IVLAGMIGAGKSSYTELIANELGTKAFYE-YFLNTRFRSIKAALTDQNNVLDR-SIYEDALFTQINFEEGNISEPEMDTYLDLL------DNMMEELAYMPKKAPDLLIYLRGSLDTVLSRISLR-------------------------------GRPYEQTFDNPGLLDYYKHLHSRYDSWFEDKSDTLVINIDSDAKYVMQLIHEKLKR... 214
23 -10.900[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  18  130..VGLAGPPGAGKSTVANEVVRRVN--HLYRSQLDAMEDPKEAHARRGAPWTFDPALLLNDHGVGDPVEDDIFVSLQHKVVIVEGNYILLEEGS------KDISDMFDEKWFIDVNLDTAMQRVENRHI--STGKPPDVAKWRVDYN---DRPNAELIIKSKTNADLLIRSMNI........................................... 333
24 -10.900[L] KOG2134 Polynucleotide kinase 3` phosphatase  ali follow..  17  17..VLLIGPPGSGKSTFCDTAMRSSHRSRICQDIVNNGKAGTKAQCLKMATDSLREGKSV----------------------FID---RCNLDREQRSEFIKLGGPEFEVAVVLELPAQVCISRSVKR.......................................................................................... 119
25 -10.500[F] COG0194 Guanylate kinase  ali follow..  12  48..IVLSGPSGVGKGTVRQAIFSQED-------TKFEYSISVTTRSPREGEVNGVDYFFKTRDEFEQMIADNKLLEWAEYVGNYYGTPV--------DYVEQTLQDGKDVFLEIEVQGALQVRNAFPEGL--------FIFLAPPSLSEL-----NRIVTRGTETDALIENRMKAAKAEIEMMDAY---------VVENDNVETACDKIKAIVLA... 225
26 -10.400[G] KOG0234 Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase  ali follow..  13  39TLIVMIGLPARGKTYVSKKLTRYLNWIGVPTGVYRREAVKSYKSYD--FRHDNEEAMKIRKQCALVALEDVKAYLTEENG-VFDATNTTRERRDMILNFAEQNSFKV-FFVESVCDDPDVIAA-----------NILEVKVSSPDYPERN----------RENVMEDFLKRIECYKVTYRPLLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIH. 246
27 -10.300[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  16  85..ICVEGPIAAGKSKFAKELAEELDMEYYSYGYDMRKQLPPSCRSYDVRNFCLDPSHDLAAQFQIRMYMLRYSQ-STGQGVVLE-FMEAMFRQGYLSQNTIGELLKPHLVIYLDLPVDAVKKQIKAR--------------------------NVDYEVQSKVFSDAYLSDLEQLYKQQ--YLKDISTHAELLIYDWTAETEVVVEDIERIDFN... 310
28 -10.300[H] KOG3220 Similar to bacterial dephospho-CoA kinase  ali follow..  12  2FIVAVTGGIATGKSTISKVFER-QGIPVIDADKIAREIVEPGQPCWRQIREVFGDEVLLPSKEINRAVLGKMIFEDKELRGKLNKITHPTIHRKIFWQVCKLLVTGHAWIV-LDLPETGVLMDFIHKIVCVTCDSDKQL---------------ERLIARNELSESEARHRVDSQMPLDK------KCEKSHFVIDNNGSVEEAESSAMSIYNLMRD 198
29 -10.200[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  13  9RTVAILGGESSGKSTLVNKLANIFNTTSAW--EYGRDYVFSHLGGDEIALQYSDYDKIALGHAQ----YIDFAVKYANKVAFID-FCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSSVDRKEFQNLLVEMLEENNI-RVEEEDYDSRFLRCVELVREMMG............................................ 184
30 -9.830[R] KOG4622 Predicted nucleotide kinase  ali follow..  12  21..CVLCGLPAAGKSTFARALAHRLQIGVVAYDDVMPDAFLAGARARPAPSQWKLLRQELLKYLCYLLTKTAVSRPLF---LVLDDNFYYQSMRYEVYQLARKYSLGF-CQLFLDCPLETCLQRNGQRPQALPPETIHLMKLEKPNPEKNAWEHNSLTIPSPACASEASLEVTDLLLTALENPVKYAEDNMEQKDTDRIICSTNILHKTDQTLRRIVS 285
31 -9.790[R] COG2607 Predicted ATPase (AAA+ superfamily)  ali follow..  85.NVLMSGARGTGKSSLVKALLHEYADKGLRLIEVDKSDLIGLPYLLTLLKECPEKFIVFCDDLSFESGDETYKALKTALDGGLSQRCANVLVYATSNRRHLMPEYFDENAGTTGMRGEIHQKEAVEEKISLSDRFGLWLSFYPFDQNDYLAAVQNWLEDFGVPYDETAQMAALQWAQTR...................................... 262
32 -9.590[R] COG3596 Predicted GTPase  ali follow..  15  39PVIGIMGKTGAGKSSLCNALFAGEVSPVSDVAACTRDPLRFRLQIGEHFMTIVDLPGV--DTEYAALYREQLPRLDL---WLIKADDRALATDEHFYRQVIGEAYRHKMLFVISQSDKA.................................................................................................. 160
33 -9.480[H] COG0237 Dephospho-CoA kinase  ali follow..  16  3LVIGLTGGIASGKSTVANMLIE-KGITVIDADIIAKQAVEKGMPAYRQIIDEFGEDILLSNGDIDRKKLGALVFTNEQKRLALNAIVHPAVRQEMLNRRDEAVANRVDKIIVVSVTKELQLERLMKRNQLTEEEAVSRIRSQMPLEEKT-----ADQVIDNSGTLEETKRQLDEIMNS....................................... 195
34 -9.420[H] COG1072 Panthothenate kinase  ali follow..  13  83..ISIAGSVAVGKSTTARVLQALLSVELITTDGFLHPN-ERGLMKKKGFPESYDMHRLVKSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHD--VFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKL-------------TKEEAIKTAMTLWKEINWLILPTRERASLILTKSANHAVEEVRLR.......... 307
35 -9.400[S] COG2326 Uncharacterized conserved protein  ali follow..  16  60IVIVFEGRDAAGKGGVIKRITERVSPRVFRVVALPAPTDREKTQMQRYIQQFPAAGEVV-NRPGVERVMGFCSEKK---------AKRFLEIAPRFEAAMIESGIVL-LKYFLDVSEEEQDRRFRQRI-------------NDPLRQWKLSPMDVESYRRWWDYTRAYDEMIRMTDTDDAP---------IVPSDNKKQARVNCIAHILSSIPYE.. 252
36 -9.290[T] COG5635 Predicted NTPase (NACHT family)  ali follow..  15  53.CLVLLGEPGVGKTHELEKLQRFTEETICEYSKVLGLNLRTFTNLKEDLFRFLDS-----DEGLVDEFKKPKYRSHINRLHLR----RTLAFPSILEEALKALESNFAIYELAPLRRIDVINAVEAEGFSSD-RDIVPLAIKPISLGFLLN-----TYRRHNSQFPPEQKRYESYLEGCKCLCEEVSKCRHALKETGNLDIDQRLIVAARI...... 287
37 -9.130[S] COG5324 Uncharacterized conserved protein  ali follow..  12  394..IFPISVIGCGKTTTSQTLVNLFSWGHIQN-DDITGKDKSQLMKKSLELLSKKEIKCV--------IVDRNNHQFRERKQLFEWLNELKEDYLVYDTNIKVIGVSFAPYDKLSEIRDITLQRVIKR--------------------------NHQSIKWDELGEKKVVGIMNGFLKRYQPVNLDKSPDNMFDLMSSLTNAKQILNEIHKAYPIL.. 584

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.