current user: public

If you have questions about the server, please let us know.

Query: [F] COG0572 Uridine kinase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MTDKAHQCVIIGIAGASASGKSLIASTLYRELREQVGDQHIGVIPEDGYYKDQSHLSMEERVKTNYDHPSAMDHNLLLEHLQALKAGKPVELPLYSYTEHTRKKETVHLEPKKVIILEGILLLTDIRLRQEMNFSIFVDTPLDICLMRRMKRDVNERGRSMDSVMAQYQKTVRPMFLQFIEPSKQYADIIVPRGGKNRIAIDILKAKISQFFELast
1 -106.000[F] COG0572 Uridine kinase  ali  100  1MTDKAHQCVIIGIAGASASGKSLIASTLYRELREQVGDQHIGVIPEDGYYKDQSHLSMEERVKTNYDHPSAMDHNLLLEHLQALKAGKPVELPLYSYTEHTRKKETVHLEPKKVIILEGILLLTDIRLRQEMNFSIFVDTPLDICLMRRMKRDVNERGRSMDSVMAQYQKTVRPMFLQFIEPSKQYADIIVPRGGKNRIAIDILKAKISQFFE 213
2 -76.800[TZ] KOG4203 Armadillo/beta-Catenin/plakoglobin  ali follow..  22  58LAQKNDGLILVGLAGPSGAGKTIFTEKILNFMPS------IAIINMDNYNDG------TRVIDGNFDDPRLTDYDTLLDNIHGLRDGKPVQVPIYDFKSSSRIGYRTLEVPSSRIVILEGIYALSEKLRPLLDLRVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLKTAQIKILNKFNPFSGFQNPTYILKSSKA 258
3 -72.000[C] COG3954 Phosphoribulokinase  ali follow..  16  2....SAKHPVIAVTGSSGAGTTTTSLAFRKIFAQ--LNLHAAEVEGDSFHRMAIRKARDAGRHISYFGPEANDFSLLEHTFIEYGQTGKGQSRKYLHTYGTFTPWQPLPEPTDVLFYEGLHGGVVTDVARHVDLLVGVVPIVNLEWIQKLIRDTSERGHSREAVMDSVVR-SMDDYINYITPQFSRTHINFQRVPTVDTSNPFAAKGIPSLDE 227
4 -66.500[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  15  2....TRKTIIVGVSGASCSGKSTLCQLLHAIFE------GSSLVHEDDFYKTDAEIPV-KNGIADWDCQESLNLDAFLENLHYIRDHGVLPTHLRNRENKNVAPEAIPTLEQHLVFVDGFMMYVNEDLINAFDIRLMLVTDFDTLKRRREARTGYITLEGFQDPPHYFENYVWPGYVHGHSHLFVNGDVTGKLLDKRIQLSPSSKMSVRDNVQ 219
5 -57.700[H] COG1072 Panthothenate kinase  ali follow..  23  74.TNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLK-ERGLMKKKGFPESYDMHRLVKFVSDLKSGPNVTAPVYSHLIYDVIPDGDKTVQPDILILEGLNVLQSGFVSDFVDFSIYVDAPEDLLQTWYINRFLKFREGAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSANHAVEEVRLRK....... 308
6 -52.900[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  22  121.MFSPNLKRLVGLAGPPGAGKSTVANEVVRRVNKLWPPDVAIVLPMDGFHLYLDAMEDPKEAHARRGAPWTFDPALLLNCLKKLKNEGSVYVPSFDHGVGDPVEDDIFVSLQKVVIVEGNYILLEEDISDMFDEKWFIDVNLDTAMQRVENRHI-STGKPPDVAKWRVDYNDRPNAE-LIIKSKTNADLLIRS.................... 330
7 -39.500[R] COG4240 Predicted kinase  ali follow..  17  83..QQLKRPFIQGILGSQGTGKTTMSLVIQLILQHL--GYRTLSLSLDDLYKTYSDRLVLLQQDIWRGPPGTHDIDLGLNVLEQIRQGKPVIVPRFDKSAHAGAGDRDVITGVDILIFEGWFVGVRPIDPSLFNFPPSILTDEDKAFARDMNLRLNHY-LPLWEKLDSLILLYPTDYR-CSLEWRKQAEQKMIAAGKTGMSNTQIEEFVNYFWR 297
8 -34.100[R] KOG2878 Predicted kinase  ali follow..  13  19.PKPEGRPFILGISGPQGSGKSTLASALDTELTRK--NESVVKFSLDDFYLTHAEQVELAKNNQHRGLAGTHDVTFLNNVLNAFVKDEEVSIPFYDKSKFGGYGDKANPKTTTYVIFEGWMVGFEPLDSCMLSVRARSTRWQNIEGSLLWVNRKLADYQPIFQKIDSLVELEAQEINYVYR-QQEHALKARIHKGMSDEEVIEFVNHYMPQYV 246
9 -21.100[F] COG1428 Deoxynucleoside kinases  ali follow..  13  2...EGVGNKVIVLAGMIGAGKSSYTELIANELGTKAFYESIK---LEMFYDDPKRWAF------------ALQIYFLNTRFRSIKAALTDQNNVLDRSIYEDA-EEGNISEPEMDTYLDLLDNMMEELAYMPDLLIYLRGSLDTVLSRISLRGRPYEQTFDNPGLLDYYKHLHSRYDSWFESYDKSDTLVINIDENKPSDAKYVMQLIHEKLK 213
10 -18.800[F] COG0283 Cytidylate kinase  ali follow..  12  2.....NRQKVIAIDGPGASGKGTVAARVAAALG-------YDYLDTGALYRLTALYAQKQ----GVGWHDEENVSELAKKLPAVFSDSRILLGGEDVSDGIRTEAQRDFLTEKGLVADG------SVVFPQAELKIFLTAESKIRAERRA-KQIGIPCEAFERILSDIEARDEADRNRKVAPLKQQPDALLTSRLTIEETVKKVLDWYRKV.. 218
11 -17.700[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  11  17.MAGMPEGKLILLNGGSSAGKTSLALAFQDLAAECW-----MHIGIDLFWFALPPEQLDLARVRPEYYTWDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRA----YLDNGMNVIADDVIW-ALRVFEGCRVWMVGVHVSDEEGARR-----ELERGDRHPGWNRGSARAAHA---------DAEYDFELDTT---ATPVHELARELHESYQ 208
12 -17.200[F] COG2019 Archaeal adenylate kinase  ali follow..  13  1........MRSVITGVAGVGKTTVLDIVARESG-------IPVVNYGTLMFEVAKRRGLVENRDQIRKLSRETQVDLQKLAGE------------------------EIGKMENAIVDTHMSIKTPF----ASVFVIIEADPAIIKRRRDNDPTRARDDEGVDSIREHQEMNRYFAAAYSIFSGATVKIVKNEEGKPEQAADEIVRVIK.... 181
13 -17.100[G] COG2074 2-phosphoglycerate kinase  ali follow..  14  87...QCKEPLIILIGGASGVGTSSIAFEVANRLRKIVSRELLPSIYESSYTAYQSLRIPPPPELDEVLIGFRDHVESVSIGVEAVIE--------------------RALTEGISIVIEGVH-IVPGFIREDLVAMFVLTVSDENVHKGRFYRCRQMWARRPLKRYISYFWAIRRIHRYIENQARKHGVPVIENI-DVVTTIDSIIKSLTKTTV 295
14 -17.000[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  14  76.KRFDENSKVICVEGPIAAGKSKFAKELAEELDMEYYPAVDL--YINSYGYDMRKLDPQLPPSCRCLDPSQFQIRMYMLRYSQLSTGQGVVLERSDFVFMEAMFRQGYLSRGARSVYNELRQNTIGELLK--HLVIYLDLPVDAVKKQ-----IKARNVDYEVQSKAYLSDLEQLYKQQYLKDISTHAELLIYDWTAGGETEVVVEDIERI.. 307
15 -16.800[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  15  9.RRTLSPGTMIVIVGPSGAGKDTLMDYAAAQLSG----------RPGFHFTRRVITRSCDAGGENHDAVSMHEFNQLEDAGAFAVSWQ-----AHGLKYGIPAAVYRHLEAGDVVIANGSRSALPHFGTAFSRLKVVNIVARPDVLARRLEQ----RGRESRDDIL------RRLERSSLAVAGDFDVTTVDNSGAIEDAGKTIMQVLQQ... 192
16 -16.600[H] COG0237 Dephospho-CoA kinase  ali follow..  18  2.......TLVIGLTGGIASGKSTVANMLIEK--------GITVIDADIIAKQAVEKGMPAYRQIIDEFGEDINGDIDRKKLGALVFTNEQKRLALNAIVHLNRRDEAVANREAFVVLD-IPLLFESKLESLVDKIIVVSVTKELQLERLMKRNQLTEEEAVSRIRSQMPLEEK----------TARADQVIDNSGTLEETKRQLDEIMNSW.. 196
17 -16.500[H] KOG3220 Similar to bacterial dephospho-CoA kinase  ali follow..  14  2........FIVAVTGGIATGKSTISKVFERQ--------GIPVIDADKIAREIVEPGQPCWRQIREVFGDEVSKEINRAVLGKMIFEDKELRGKLNKITHFWQVCKLLVTGHAWIVLDLPLLFETGVLMDFIHKIVCVTCDSDKQLERLIARNELSESEARHRVDSQMPLDKK----------CEKSHFVIDNNGSVEEAESSAMSIYNLMRD 198
18 -16.300[R] COG0645 Predicted kinase  ali follow..  16  2........FLAVTHGVSAVGKSQVAMRLVEALG-------AVRLRSDIERKRLFGEQPEHDGIYSSQASEATYAHLHQLAAKILQAGYPVVIDAAYLKQNQRQAACHIAEETGVPFL------------------LDCQAPEAVIAGW-----LAQRQAEGKDPSDATLDVIRTQQATREPLTAAETVQSKRVDTHDAASLDGLVDGIRQRL. 182
19 -15.900[F] COG1102 Cytidylate kinase  ali follow..  15  2....PKGCLVITVSGLAGSGTTTLCRNLAKHYG-------FKHVYAGLIFRQM-----------------AKERGMSLEEFQKYAELHP--------IDREVDRRQVEAAKECNVVIEGRLA---GWMVKNADLKIWLDAPIRVRAERVAKREGISVEEAFMKIAEREMQNRKRYLNLY---DLSIYDLIIDTSWSPEGVFAIVKAAIDHLYE 179
20 -15.700[F] COG4088 Predicted nucleotide kinase  ali follow..  15  3.........LIIVSGYPSSGKTTRSNELKKALEDRIHQNIDNTKDYRVIIINDESLNIEKETYRESKNEKAARGLLYSAVQRELSKSTFVICDALNYIKGFRYQLYCESKSMYTTHC------------------IHVAVPQDLCRKFNSNKEQPYPDDVLEQLMFRYEE........................................... 146
21 -15.100[R] KOG4622 Predicted nucleotide kinase  ali follow..  16  12.SDGPRKRGLCVLCGLPAAGKSTFARALAHRLQQE-QGWAIGVVAYDDVMPDAFLAGARARAPSQWKLLRQELLKYLEYFLMAVINGCQMSVPP-FEAQSCYLLTKTAVSRPLFLVLDDNFYYQSMRYESLGFCQLFLDCPLETCLQRNGQRPQALPPETIHLMGRKLE---KPNPEKN-----EHNSLTIPSPACASEASLEVTDLLLTALE 248
22 -14.700[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  17  6.LKKLEQPVFLIVAGPNGSGKSSVYANADLELEG----RSVWIVNPDLLAGRISEVENKPLPEANLVAVQRIEAWI-----------------------------QSSISVHKTIGVETVLSVEAAEAVGFAIWLFYTVLDSPERSIERIKLRVAKGGHDVDKVRARYARSL-----DQLPWFLERADWIWDNSGATPKLI............ 178
23 -14.100[G] COG3265 Gluconate kinase  ali follow..  16  2......SGKCIIVMGVSGTGKSCVGQALALALGAKF-------IDGDDLHPRANIQKMAAGQPLNDQDRAPWLERLSDVAYSLQQKNEVG-----------------------FLVCSALKKQYRDRLREGNEGIRFLWLTGDYDLVLH--RMQQRAGHFMPESL------LKSQFATLEAPGSDEPDVIP---IDISSSIADVVEHCIAALS 167
24 -13.700[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  13  2.....KRPLIIGVGGPVGAGKTMLIERLTRYLSTK--GYSMAAITND--YTKEDARILLNTSVLPADRIAGVETGGCPHTAIREDAS---------MNFAAIEEMCDKHPDLQLLFLESG-NLSATFSPDLVDFSIYI-IKSDLFIINKV--DLAPYVGANVEVMKADTLKSRGNKD------------FFVTNLKTDEGLKSVADWIEKRLQ 200
25 -13.700[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  17  3.........LVVITGLPASGKSTRARQLRDHFVER--GRKVHLISENEAVPKAGFGKNSHTGDSQKE--KVVRSDLKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSKVSRTTQCT-----------------VFTCIPQEEAWTFNSQRTAPDE........................................................ 129
26 -13.100[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  12  6..........ILLTGTPGVGKTTLGKELASKSG-------LKYINVGDLAREEQ-----------------------------LYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDY---GCDFFPERWFHIVFVLRTDTNV-LYERLETRGYNEKKLTDNIQCEIFQVLYEEATAS-YKEEIVHQLPSNKPEELENNVDQILKWIEQWIK 168
27 -12.900[R] COG4639 Predicted kinase  ali follow..  19  1MKITIPELSLVVLIGASGAGKSTFARKHFQPF---------EVISSDFCRGLVSNDENSQSASRDA-------FDVLHYITTKLAAGKLTVIDATNVQPEDRKTLLQMAKQYHCFTV------------------IVFDLPEELCHERNQQRSDRQFGSHVVRRHTQMLRRSLR....................................... 142
28 -12.400[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  14  1........MLIAITGTPGVGKTTVAKLLAKKLNYE--------------YVSLKDFALEKGCGRRVNDEVEVEIDELAYFIERELKGKNA-------------------------VLDGHLSHLMP-----VDLVVVLRAHPKLIGER-----LRERGYDREKIGENVEAELVDAVLIEAIEEHENVIEVDTTNKSPEDVVEEIVSLINSGIK 156
29 -12.400[G] KOG3354 Gluconate kinase  ali follow..  13  8.PTNQPYKYVFVVIGPAGSGKTTMAKAVSEKLG-------FEYIEGDDLHPK--------------------------ANIEKMSQGHPLRWGWLHNCGGACAMELDKESIKGVVLCSALKRSYRDILRSSLEHRIYLAASRETLIKRTTSR----KNHYMKADM------VESQLAILEAPTADEKDVIISVENGKEQSEEECLDIVHKMVN 188
30 -12.000[H] COG1763 Molybdopterin-guanine dinucleotide biosynthesis protein  ali follow..  17  3.........IFGITGWKNSGKTTLTEKLVAELVRR--GWKVSTVKHAHHDFDIDKPGAD---SFRHRQAGATEVAIVSGNRWALMHELRGEDEP------PLESILSRLAPCDIVLVEGYKRESHRKI..................................................................................... 110
31 -11.500[L] KOG2134 Polynucleotide kinase 3` phosphatase  ali follow..  15  7IEADKAKQIVVLLIGPPGSGKSTFCDTAMRSSHRPW-----SRICQDIVNNGKAGTKAQCLKMAT----------------DSLREGKSVFIDRCNLDREQRSE--IKLGGPEFEVH------------------VVLELPAQVCISRSVKRTGHEGNLQGGRA----AAVVNKMLQSKELPKVNEG-MFCYSDADVDNAVNMYNK....... 172
32 -11.500[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  15  11..........VAILGGESSGKSTLVNKLANIFFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSSVDRKEFQNLL-MLEENNIEFVRVEEEDYDSRFLRCVELVREMMGEQR........................................ 187
33 -11.500[F] COG0194 Guanylate kinase  ali follow..  17  39.CRMKERGLLIVLSGPSGVGKGTVRQAIFSQEDTK--------FEYSISVTTRSPREGEVNGDYFFKTRDEFE--------QMIADNKLLEWAEYVYGTPVDYVEQTLQDGKDVFLVQGALQVRNAFPEGLF---IFLAPPSLSELKNRIVT----RGTETDALIENRMKAAK----AEIEMMDAYDYVVENDNV--ETACDKIKAIVLA... 225
34 -11.100[J] COG0324 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  18  2......KPTAIFLMGPTASGKTDLAIQLRSQLPVE-------VISVDSIYKGMD---------IGTAKPSKEELALAPHRLIDILDPSE-SYSAMNFRDDALREMADITAQGKIPLLVGGTMLYYKALIE----GLSPLPSADENIRAELEQKAAQQGWAA---LHTELAKIDPISAARINPSDSQ........................... 159
35 -10.700[F] COG0125 Thymidylate kinase  ali follow..  11  2......SGLFITFEGPEGAGKTTVLQEIKNILTAE-PGGIDIAEQIREVILNENNILMDPKTEA-----AAARRQHLVEKVKALEQGFIVLCDRF-YQGYARGLGIDEVLSINEFAIGDMM-----------HVTVYFSIDPEEGLKRIYANGSREKNR-LDLEKLDFHTKVQEGYQELMKRFPERF-HSVDAGQSKDLVVQDVLKVIDEALK 208
36 -10.600[F] KOG0707 Guanylate kinase  ali follow..  19  133...RGNAEKPIVISGPSGVGKGTLISMLMKEFPS--------MFGFSVSHTTRSPRSMEMDGHYHFADKKVME--------KEIKDGKFLEFASVHYGTSIESVEAVTDSGKRCILVQGARSVRASSLDAIF---IFVCPPSMKELEDRLRARGTETEEQIQKRLRNAEAEIKEGISSGIF------GLILYND-NLEECYKKLKVNHLLL.. 321
37 -10.400[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  12  29.SPRLMKPLVVFVLGGPGAGKGTQCARIVEKYG-------YTHLSAGELLRDERKNPDSQYGEL-----------------KYIKEGKIVPVEIISLLKREMDQTMAANAQKNKFLIDGFLQGWNKTMDGKADVSLFFDCNNEICIERCLERKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVK---KIDASKSVDEVFDEVVQIFD 225
38 -10.400[J] KOG1384 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  12  59.RSRNRKDKVVVILGATGAGKSRLSVDLATRFPSE-------IINSDKVYEGLE---------ITTNQITLQDRRGVPHHLLGVINPEHGELTAGEFRSAASNVVKEITSRQKVPIIAGGSNSF---------VHALLAQRFDPKFDPFSSGSCLISSDLRYECCFIWVDVSETVLYEYL---LRRVDEMMDSGMFEEL.............. 230
39 -10.300[P] KOG0635 Adenosine 5`-phosphosulfate kinase  ali follow..  15  111...LQQKGCVVWITGLSGSGKSTVACALSKALFER--GKLTYTLDGDN-----------------------------------VRHGLNRDL---TFKAEHRTENIRRIGEVAKLFADGVICIASDACRSLLPDGDFVEVFMDVPLHVCESRDPK--KLARAGKIKGFTGIDDP----YEAP--VNCEVVLKHTGDDSCSPRQMAENIISYLQ 286
40 -10.200[F] COG1618 Predicted nucleotide kinase  ali follow..  12  3IEGKEKTMLRIAVTGSPGVGKSTVVAKTAEKLAEKPGFKIGGIRTAE--------RKEGHREGFSIRDLATGKTGILSHVKGSGPRLGKYHVNLDDLERIGANAVRNALACDLVVIDEGPMELISQSFVSAV-------------------EEVLESDKPVLAVLH------HSSRHPLAQRFRKGFEVLTVDKGNRDELPEKITNRFLRKL. 183
41 -10.100[G] KOG0234 Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase  ali follow..  15  35....TNSPTLIVMIGLPARGKTYVSKKLTRYLN----GVPTKVFNLGVYRREAVKSYKSYD--FRHDNEEAMKILVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNSFKVFFVESV---------------------DDPDVIAANILEVKYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQ 235
42 -9.910[R] KOG1533 Predicted GTPase  ali follow..  12  27.GSTHWTMYGVLVIGAPGAGKSTFCAGLTDIFSQT--KRPFLTINLDPANDTMAYAP-------DVNITEMITVNDVMDRLGLGPNGALKYCIETLGANCNWLLQKIEANHKKYLIIDG-------------QLELYKSEGELWKVIRFLEK............................................................. 157
43 -9.900[K] KOG1534 Putative transcription factor FET5  ali follow..  14  3.......KVAAFVCGVASSGKSTFCGALMSYMKSV--GRSCHLVNLDPAAENFEWEP-------TVDIRDLISIDDVMEELDYGPNGGLIYCFEFLMENLDWLNEEIGDYDEDYLIFD--------------QIELYTHVPILPALIRHLQVTLNFR........................................................ 132
44 -9.880[E] COG0703 Shikimate kinase  ali follow..  15  74..........IFLVGPMGAGKSTIGRQLAQQLNMEF-------YDSDQEIEKRTGADVGW-----FD-----------------LEGEE------GFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARVYLETTIEK-QLARTQRD---KKRPLLHVETPPREVLEALANERNPLYEEIADVTIRTD---DQSAKVVANQIIHMLE 238
45 -9.780[O] COG1219 ATP-dependent protease Clp, ATPase subunit  ali follow..  16  116..........ILMIGPTGSGKTLLAETLARLLNVPFTIADATTLTEAGYQKCDYDVEKAQMGIVYIDEIDKIS-EGVQQALLKLIEGTVASVPPQGGRKHPQQEFLQVDTRNILFICGGAFAFKEVEPEDLVKFGLFVGRLPVIATLDELDEAALMQ-EPKNALTKQYAKLFE-MEGVDLEFRPDALKAVARKALERKTGARGLRSILEGILL 381
46 -9.750[A] COG5623 Pre-mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1  ali follow..  14  116IRMSNFEGPRVVIVGGSQTGKTSLSRTLCSYALKF-NAYQPLYINLD--------------QQPIFTVPGCISATPIS---------DILDAQLPTWGQSLTSGATLLHNKQPMVKNFG-------LERINENKDLYL------ECISQLGQVVGQRLHLDPQV--------------------RRSGCIVDTPSQLDENLAELHHIIEKL.. 272
47 -9.710[R] COG3911 Predicted ATPase  ali follow..  21  2...QNDFDRVFVLTGGPGSGKTTLIAALRRA...................................................................................................................................................................................... 29
48 -9.650[P] COG0529 Adenylylsulfate kinase and related kinases  ali follow..  15  1.....QKPAVLWFTGLSASGKSTIANRLEQRLHAL--GKHTYLLDGDNVRHGLNS-------DLGFSDADRVENIRRVGEVARLMADAGL-----------------------ITPVSFISPFREERVRARLPEGEFIEIFIDTPIEECMARDPKGLYAQALRGEIKAFTGIDSPYEPPVAP-----ELRLNTAGRTDELIAEVENYLAE... 171
49 -9.600[R] COG1341 Predicted GTPase or GTP-binding protein  ali follow..  11  26IESLRKPAKVM-IIGDVDTGKTTLTIYLANELLSR--GFRVAIIDSD--------------GQKGILPPATISLAFVDSHFTSLDDLKAFSHYFIGTIT-MKLSELAMKFSDVVLIIYGSGVELKRMKIEAVKPNLILALERN...................................................................... 168
50 -9.480[PH] COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components  ali follow..  13  24LNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKPRLEGRAIAKLPTKEVAKELAILPQGPSAPEGLTVHQLVDEEAVERALKATKLEDMADRAVDSLSGGQRQRAMTLAQETDIILLD--------------EPTTYLDMTHQIEILDLLFELNEKEDRTIVMVLHRYAHHLVAIKDKRIYAEGRPEEVITCDLVQNVFSMNCQV........ 245
51 -9.470[A] KOG2749 mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1  ali follow..  107.DSASSQGPRVIIVGDIDSGKSTLAKMLLNWAVKD--GWKPTFVDLN--------------GQSSITIPGTIAAAPIKMLVDPVEGFPLDKALIHYFELKEEFSANAESRASGMVIIVREGYALLLHAIRTFNASLVIVVGQE...................................................................... 259
52 -9.450[P] COG4604 ABC-type enterochelin transport system, ATPase component  ali follow..  15  20INERIPSGGITSIIGPNGAGKSTLLSIMSRLLAADFNGLDVAKTSGDKLATILSVLRQENHFTSRLTVSDLVDRQHIDAAMEFLNLMPLKDRYLDELSGGQRQRAMVLCQDTSYILLD--------------EPLNNLDMKHCVAMMKQLRRAADELHKTIILVIHAYSDHIIAMKNGEVIYRGAPAEIMQPSILEEIFDIKI.......... 237
53 -9.300[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  13  2...KNQSEINIGLVGHVDHGKTTLTKALSGVWTDTHSEETKRGISIRLGYADITFRKCPQCEAPMCYTTAEICERCGTETELLRKVS--VDAPGHETLMATMLSGAALMDGA-ILVIAANEPCPQPQTKEHLMALDVIGVKDVIVVQNKI-----------DIVSKERALESYREIKEFVKGTCAEDAPIIPVSAQQGANIDILIETIEERIK 198
54 -9.230[V] COG4167 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  14  33LSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEPTSGEQRIRMIFQDPSTSLNPRQRISQILDFPLRLNTDLEPEQRRKQIIETMRPDHVSYYPHMLAPGQKQARALILRPKVIIADEALASLDMSMRSQLINLMLELQEKQGISYI--VTQHIGMMKHISDQVLVMHQGEV-STADVLASPLHELTKRLIAG.................... 253
55 -9.130[J] KOG0469 Elongation factor 2  ali follow..  12  12LMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKSTAISLFFELEKKDLEFVKGENQFETVEVIDSPGHDFSS--EVTAALRVTDGALVVVSGVCVQTETVLRQAIAERI-----KPVLFMNKMDRALLELQLGAEELFQTFQRIVEN....................................... 196
56 -9.030[R] COG0802 Predicted ATPase or kinase  ali follow..  12  21LADKLLAGDVITLEGDLGAGKTSFTKGLALGLGIKRVVKSPTFTIIREYKGRLPNEEEEDLGFDEYFHGDGVTVVEWASLIEGRLPPVRLAITITHAGENERQLSFTAYGERWEEVLKEL............................................................................................. 149

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.