current user: public

If you have questions about the server, please let us know.

Query: [L] COG0592 DNA polymerase sliding clamp subunit (PCNA homolog), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .
# Score Template Links and tools%idFirst MKFVVSRNELGNLIKKIQSVVPQNTPIPVLTHVLIETYNDELVFTATDLTVSTRCVTKAKVYEKGAISIPSKRFFQLVKELTEANLEISSSAGEMAQITSGSSCFRLLSMEKEDFPMLPDIQNALRFSLPAEQLKTMLQRTSFAVSREESRYVLTGVLLAIANGVATIVGTDGKRLAKIDAEVTLDKSFSGEYIIPIKAVEEIIKMCSDEGEAAIFLDQDKIAVECDNTLLITKLLSGEFPDFSPVISTESNVKLDLHREELITLLKQVALFTNESSHSVKFSFLPGELTLTANCTKVGEGKVSMAVNYSGELLEIAFNPFFFLDILKHSKDELVSLGISDSYNPGIITDSASGLFVIMPMRLHDDLast
1 -112.000[L] COG0592 DNA polymerase sliding clamp subunit (PCNA homolog)  ali  100  1MKFVVSRNELGNLIKKIQSVVPQNTPIPVLTHVLIETYNDELVFTATDLTVSTRCVTKAKVYEKGAISIPSKRFFQLVKELTEANLEISSSAGEMAQITSGSSCFRLLSMEKEDFPMLPDIQNALRFSLPAEQLKTMLQRTSFAVSREESRYVLTGVLLAIANGVATIVGTDGKRLAKIDAEVTLDKSFSGEYIIPIKAVEEIIKMCSDEGEAAIFLDQDKIAVECDNTLLITKLLSGEFPDFSPVISTESNVKLDLHREELITLLKQVALFTNESSHSVKFSFLPGELTLTANCTKVGEGKVSMAVNYSGELLEIAFNPFFFLDILKHSKDELVSLGISDSYNPGIITDSASGLFVIMPMRLHDD 366
2 -11.600[L] KOG1636 DNA polymerase delta processivity factor (proliferating cell nuclear antigen)  ali follow..  5.......................................................................................................................................RLVQGSLLKKVLESIKDLVNDANFDCSSTGFSLQAMDSSHVALVSLLLRSEGDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGGDTVTFDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSNEFSRICKDLSSIGDT----VVISVTKEGVKFSTAGDTTVDKPEDAIVIEMKEPVSLSFALRYMNSFTKATPSDTVTISLSSELPVVVVAEMGYIRYYLAPKIEEEE 259
3 -10.800[DL] KOG2810 Checkpoint 9-1-1 complex, RAD9 component  ali follow..  10  2.............................................................................................................................KYTLEGSNAR-VIAKAVQSLSK-----VGKEMFIEIDQQSLQMRAINATQSAVGSISFKRPPHSDFYCKISMKGCLAVFRNMNEVEYCELNLNQTNLQVNLRCKLETTKEATISIIDDQNI-TDQMPNIIRGDHKLLTDISNNFNSSEEE----LTLEANSGSVVAKNYIEGARVNDKFMRTQLKTKETVITFCIKEFRAFLLFAENASLTLEFDEAGMPFLLKIKKH............. 246
4 -7.040[K] COG0195 Transcription elongation factor  ali follow..  14  2......NSEFMDALTTLEK-ISKEVIIEAIEAALISGYKRNFN-QAQNVRVDVN-------RENGSIRVFARK--EVVEEVFDARLEISLDEAKGINPNYEVDDVVEIEVTPKDFGRIAAQTAKQVVT---QRVREAERGIIYADFIDREEDIMTGIVQRQDNRFIYVDLGKVEALLPLSEQ------------MPNESYRHNDRIKAYITKVEKTTKGPQIMISRTHPGLLKRLFELEVPE-------------------IYDGTVELKSVAREAGDRSKISVHAENPEVDPVGACVGPKGSRVQTELKGEKIDI---VEYVANALSPSKVVKVNVNEEEKTTQVIVPDYQLSLAI......... 317
5 -5.140[DL] KOG3194 Checkpoint 9-1-1 complex, RAD1 component  ali follow..  13  8.................................................................................................................................CLKQIQSTLRCIDFS---KECTIEITGLRFAVEESQSLQAHAFLDKSLFQTFNFQGDSDGDTYMFTMISPLLQSLSIYTDGKERISTSAWDKVQYNGPGCPFIWEVEEMAGYATACELASTLCTKIIMKSNWLYDALVELDNNMGENL-IIHTSSQKSTFLLRCVGAEYPNEKSVLESFETDSENTYSYRFSLIRHALKALQGSKVNLRIDENGTLSI-GLCTFVDFCIVPLDLVSE 285
6 -4.370[DL] KOG3999 Checkpoint 9-1-1 complex, HUS1 component  ali follow..  6.......................................................................................................................................RISNLYTLTRLVQALDKIGRFCWLRLMPETVNFVIVPDFRMTQVWSVLEVETDNVINLEVPIDNFYKALRSAANASDSTVRLSKKNLSTTWSGRAFGSNIVTHNIP--EPTAPEPDCHIFLPQLNFLRHVVDKYKSLSDNMSGELQLSVNIPSARVSTPSQVEDISRHPSQTRAPEEFVHMRLDSKDLVNMLKISSVAKRVIACFCEGHALVLDEHTAVLTYYISTYVD.. 287
7 -4.270[E] COG1362 Aspartyl aminopeptidase  ali follow..  92..................AITGAHTDSPALR-VGVETYGGAIWHSWFDKDLGVAGRVFVKDAKTGKSIARLVDLNRPLLKIPTLAIHLDRDVNQKFEFNRETQLLPIGGLQEDK-KEINNGEFTSIKTIVQRHHAELLGLIAKELAIDTIEDIEDFELILYDHNASTLGGFNDEFVFSGRLDNLTSCFTSMHGLTLAAD----TEIDRESGIRLMACFDHEEIGSSSAQGADSNFLPNILERLSILKGDGSDQTKPLFHSAILETSAKSFFLSSDVAHAVHPNYANKY---SQHKPLLGG----------GPVIKINANQRYMTNSPGLVLVKRLAEAAKVPLQLFVVANDSPCGSTIGPI..... 436
8 -4.270[E] KOG2596 Aminopeptidase I zinc metalloprotease (M18)  ali follow..  92..................AITGAHTDSPALR-VGVETYGGAIWHSWFDKDLGVAGRVFVKDAKTGKSIARLVDLNRPLLKIPTLAIHLDRDVNQKFEFNRETQLLPIGGLQEDK-KEINNGEFTSIKTIVQRHHAELLGLIAKELAIDTIEDIEDFELILYDHNASTLGGFNDEFVFSGRLDNLTSCFTSMHGLTLAAD----TEIDRESGIRLMACFDHEEIGSSSAQGADSNFLPNILERLSILKGDGSDQTKPLFHSAILETSAKSFFLSSDVAHAVHPNYANKY---SQHKPLLGG----------GPVIKINANQRYMTNSPGLVLVKRLAEAAKVPLQLFVVANDSPCGSTIGPI..... 436
9 -3.890[E] COG2309 Leucyl aminopeptidase (aminopeptidase T)  ali follow..  1MVLPNFKENLEKYAKL------------LVANGINVQPGHTLALSIDVEQRELAHLIVKEAYALGAHEVAPMERLDNVPEYKIAEMNYLLENKASRLGVRSSDPGALNGVDADKLSASAKAMGLAMKPMRIATQSNKVSWTVAAAAGLEWAKKVFPNAASDEEAVFKTCRVYEADPVKAWEEHAAILKSKADML--NKEQFSALHYTAPGTDLTLGLPKNHVWESAGAVNAQGEEFLPNMPTEE-TAPDFRRADGYV-------TSTKPLSYNGNIIEGIKVTFKDGQIVDITAEKGDQVMKDLVFENAGARECALVPDPS............................................. 327
10 -3.730[G] COG3866 Pectate lyase  ali follow..  1MGRRFSKRLLVAILASSMAISATFSANASTKYGKNYVSSVTKAVETSAVSILESEGSLESANVEWSPVQGAASYNVYYKAADALDSSYTKIDDELIRQYPSSFRADVLGLAAGNYPVVNGVDAINEEATTQALTVKANKREGFAFSNDDGTVASNAEILYITASNVNTVTENV---LVNILAGRQKGYDKSPLIIRMIGEIKASDITNEHTYIQLKGCYNVTFEGVGKRNLELRNVGIMMFGDDAISLDTDNQNIWVHNNDLFYGAAGHDADQVKGDGSCDIKQDSTFVSVSYNHFH-DSGKSSLCGMQDTQNYYVTYHHNWFVHVYNNYFDGNAKYGVGVTKGASAFVEANYFRDCKYPMLSSLQ 422

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.