current user: public

If you have questions about the server, please let us know.

Query: [R] COG0645 Predicted kinase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst RFLAVTHGVSAVGKSQVAMRLVEALGAVRLRSDIERKRLFGEQPEHDRGQFAAGIYSSQASEATYAHLHQLAAKILQAGYPVVIDAAYLKQNQRQAACHIAEETGVPFLILDCQAPEAVIAGWLAQRQAEGKDPSDATLDVIRTQQATREPLTAAETVQSKRVDTHDAASLDGLVDGIRQRLPGLLast
1 -85.100[R] COG0645 Predicted kinase  ali  100  1RFLAVTHGVSAVGKSQVAMRLVEALGAVRLRSDIERKRLFGEQPEHDRGQFAAGIYSSQASEATYAHLHQLAAKILQAGYPVVIDAAYLKQNQRQAACHIAEETGVPFLILDCQAPEAVIAGWLAQRQAEGKDPSDATLDVIRTQQATREPLTAAETVQSKRVDTHDAASLDGLVDGIRQRLPGL 185
2 -49.500[G] KOG3354 Gluconate kinase  ali follow..  17  14KYVFVVIGPAGSGKTTMAKAVSEKLGFEYIEGDD-------LHPKANIEKMSQGHPLNDNDRWGWLHNCGAMELDKESIKGVVLTCSALKRSYRDILRSSLEHRPAILRFIYLAASRETLIKRTTSRKNHYMKAD-----MVESQLAILEAPTADEKVITISVENGKEQSEEECLDIVHKMVNE. 189
3 -40.800[G] COG3265 Gluconate kinase  ali follow..  21  3GKCIIVMGVSGTGKSCVGQALALALGAKFIDGDD-------LHPRANIQKMAAGQPLNDQDRAPWERLSDVAYSLQQKNEVGFLVCSALKKQYRDRLREGNEG----IRFLWLTGDYDLVLHRMQQRAGHFMPES-----LLKSQFATLEAPGSDEPVIPIDISSSIADVVEHCIAALSLE.... 169
4 -39.900[F] COG4088 Predicted nucleotide kinase  ali follow..  11  3..LIIVSGYPSSGKTTRSNELKKALEDRIHQNIDNTKDYR-IINDESLNIEKETYRESKNEKAARGLLYSAVQRELSKSTFVICDALNYIKGFRYQLYCESKSMYTTHCVIHVAVPQDLCRKFNSNKEQP---YPDDVLEQLMFRYEEPNGMTRWDSPLFTVLHDDASCPIDDIWSVLIH..... 178
5 -37.900[R] COG4639 Predicted kinase  ali follow..  18  10..LVVLIGASGAGKSTFARKHFQ--PFEVISSDFCRGLVSN------------DENSQSASRDAFDVLHYITTKRLAAGKLTVIDATNVQPEDRKTLLQMAKQYHCFTVAIVFDLPEELCHERNQQRSDR--QFGSHVVRRHTQMLRRSLRSLEKEGFRYV-YTLKSPEEIANVAIELQPLWNN. 174
6 -34.400[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  12  25..LILLNGGSSAGKTSLALAFQDLAAWMHIGIDLFWFALPP-SAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWTREWLVDALRVFE--GCRVWMVGVHVSDEEGARRELERGDRHPGWNRGSARAAHADAE-------------FELDTT-ATPVHELARELHESYQA. 209
7 -33.000[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  15  3..LVVITGLPASGKSTRARQLRDHFKVHLISENEAVPKAG---------GKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSKVSRTTQCTVFTCIPQEEAWTFNSQRTAPDELPGDSTRETFDALCQRYEEPQSNNDSPLVVVLPKDTLDMEAIYKALYE..... 192
8 -29.500[F] COG2019 Archaeal adenylate kinase  ali follow..  13  1.MRSVITGVAGVGKTTVLDIVARESGIPVVNGTLMFEVAKRRGLVENRDQI------RKLSRETQVDLQKLAGEEIGKMENAIVDTHMSIKTPFGYLPGLPEWVLRSIVFVIIEADPAIIKRRRDNDPTRARDDEGVD-EHQEMNRYFAAAYSIFSGATVKIVKNE-EGKPEQAADEIVRVI... 180
9 -29.400[G] COG2074 2-phosphoglycerate kinase  ali follow..  12  92.LIILIGGASGVGTSSIAFEVANRLGIRNMSTDMIREVMRKIVSRELLPSIYESSYTADHVESVSIGVEAVIERALTEGISIVIEGVHIVP---GFIREDLVNKENVAMFVLTVSDENVHKGRFYSRCRQMWARRPLKISYFWAIRRIHRYIENQARKHGVPVNIDVVTTIDSIIKSLTKTT... 294
10 -26.500[R] KOG4622 Predicted nucleotide kinase  ali follow..  14  20..LCVLCGLPAAGKSTFARALAHRLQIGVVAYDDVMPDAFLAGARARPAPSQWKLLRQELLKYL-QSCYLLTKTAVSRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQRPQALPP------ETIHLMGRKLEKPNPEHNSLTIPSPACASEASLEVTDLLLTALE.. 248
11 -26.000[L] KOG2134 Polynucleotide kinase 3` phosphatase  ali follow..  17  16..VVLLIGPPGSGKSTFCDTAMRSRPWSRICQDIVNNGKAG----------------------TKAQCLKMATDSLREGKSVFIDRCNLDREQRSEFIKLGGP-EFEVHAVVLELPAQVCISRSVKRTGHEGNLQGRAAAVVNKMLQSKELPKVNEGFSRIMFCYSDADVDNAV........... 167
12 -24.500[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  13  6...ILLTGTPGVGKTTLGKELASKSGLKYINVGDLARE----------EQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWF-----------IVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYE-EATASYKEEIVHQLPSNKPEELENNVDQILKWIEQ. 165
13 -24.100[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  16  1.MLIAITGTPGVGKTTVAKLLAKKLNYEYVSLKDFALE------------KGCGRRVNDEVEVEIDELAYFIERELKGK-NAVLDGHLSHLMPVD-------------LVVVLRAHPKLIGERLRERGYDREKIGEVEAELVDAVLIEAIEEHENV----IEVDTT-NKSPEDVVEEIVSLINS. 153
14 -24.000[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  13.VFLIVAGPNGSGKSSVYANADLELSVWIVNPDLLAGRISEVENKP----------LPEANLVAVQRIEAWIQSSISVHKTIGVETVLSTDKYRRLVEAAEAVGFAIWLFYTVLDSPERSIERIKLRVAKGRARYARSLDQLPWFLERADRASGATPKLIGEKQDGVIGLDENALAVVASAVKSI 203
15 -23.700[S] COG5324 Uncharacterized conserved protein  ali follow..  11  391KFLIFPISVIGCGKTTTSQTLVNLFSWGHIQNDDITGK-----------------------DKSQLMKKSLELLSKKEIKCVIVDRNNHQFRERKQLFEWLNELKEDYLVYDLSEIRDITLQRVIKRGNNHQSIKWDEVGIMNGFLKRYQPVNLDKSPLMIELDFGQADSSLTNAKQILNEIHKA 580
16 -21.500[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  14  36.LVVFVLGGPGAGKGTQCARIVEKYGYTHLSAELLRDERKNPDSQYGEKYIKEGIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDK. 226
17 -21.400[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  14  84..VICVEGPIAAGKSKFAKELAEELDMEYYPAVDLDRKLDPQLPPSCRSYDVRNFCLDPSHDLAASQYIDALQHVLSTGQGVVLERSPYSSVYNELRQNTIGELLKPHLVIYLDLPVDAVKKQIKARNVDYEVQSKVSDAYLSDLEQLYKQQDISTHAELLIYDWTAGGETEVVVEDIER..... 306
18 -21.000[E] COG0703 Shikimate kinase  ali follow..  13  74...IFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDLEGEEGF-RDREEKVINELTEKQGIVLATGGGSVK-----SRETRNRLSARG-------VVVYLETTIEKQLARTQRDKKRP-HVETPPREVLEALANERNPLYEEIADVTIRTDDSAKVVANQIIHMLES..... 239
19 -20.900[P] COG0529 Adenylylsulfate kinase and related kinases  ali follow..  18  4.AVLWFTGLSASGKSTIANRLEQRLHTYLLDGDNVRHGLNS--------------FSDADRVENIRRVGEVARLMADAGLITPVSFISPFREERDQVRARLP--EGEFIEIFIDTPIEECMAR--DPKGLYAQALRGEIKAFTGIDSPYEPPVAPE----LRLNTA-GRTVDELIAEVENYL... 169
20 -20.600[G] KOG0234 Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase  ali follow..  15  38PTLIVMIGLPARGKTYVSKKLTRYLNTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDPDVIAANILEVKVSSPDYPERNRENIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQS. 236
21 -20.400[F] COG1428 Deoxynucleoside kinases  ali follow..  12  8..VIVLAGMIGAGKSSYTELIANELGTKAFYESIKDNRLEMFYDDPKRWAFALQIYFLNTRFRSIKAALTDQNNVLDRSTQINFEEGNISEPEMDTYLDLLDNMMEELLLIYLRGSLDTVLSRISLRGRPYEQDNPGLLDYYKHLHSRYDSFESYDKSDTLVINIDEPSDAKYVMQLIHEKLK.. 213
22 -20.000[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  15  17..MIVIVGPSGAGKDTLMDYAAAQLSVITRSCDAGGENHDAVSMHEFNQLEDAGAFAVQAHGLKY--IPAAVYRHLEAGDVVIANGS-------RSALPHFGTAFSRLKVVNIVARPDVLARRLEQRG------RESRDDILRRLERSSLAVAGDFDVTTVDNSGAIEDAGKTIMQVLQQ..... 192
23 -19.800[P] KOG0635 Adenosine 5`-phosphosulfate kinase  ali follow..  15  116.CVVWITGLSGSGKSTVACALSKALLTYTLDGDNVRHGLNR--------------FKAEHRTENIRRIGEVAKLFADVGVICIASLISPYRRDRDACRSLLPDGD--FVEVFMDVPLHVCESR--DPKGLYKLARAGKIKGFTGIDDPYEAPVNCE----VVLKHTGSCSPRQMAENIISYLQN. 287
24 -19.600[F] COG1102 Cytidylate kinase  ali follow..  5CLVITVSGLAGSGTTTLCRNLAKHYGFKHVYAGLIFRQM----AKERGMSLEEFQKYAELHPEIDREVDRRQVEAAKECNVVIEGRLAGWMVKNADLK------------IWLDAPIRVRAERVAKREG--ISVEEAFMKIAEREMQNRKRYLNDLSIYDLIIDTSKEGVFAIVKAAIDHLYEKV 181
25 -19.600[F] COG0563 Adenylate kinase and related kinases  ali follow..  14  1.MNLILMGLPGAGKGTQAEKIIEKYGIPHISTDMFRAAMKNETELGLKAKMDAGELVPDE---VTIGIVRDRLSQDDCQNGFLLDGFPRTVAQAEALEDILASLDKKLYVINIDVPEQLLMDRLTGRRQRDDDKPETVKKRLEVNQKQAQPLIDFYSEKGYLQNINGDQDISRVFEDINELLKGL 215
26 -18.600[F] KOG3078 Adenylate kinase  ali follow..  14  16.IRAVLLGPPGAGKGTQAPRLAENFCVCHLATDMLRAMVASGSELGKKLKMDAGKLVSDE---MVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLSVIEFSIPDSLLIRRITGRLRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKA 230
27 -16.800[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  14  127KRLVGLAGPPGAGKSTVANEVVRRVNAIVLPMDGFHLYRSQLDAMEDPKEAEGSVYVPSFDHGVGDPVED-DIFVSLQHKVVIVEGNYI---EEGSWKDISDMFDEK---WFIDVNLDTAMQRVENRHSTGKPPDVAKWRVDYNDRPNAELIIKSKTNADLLIRSMN.................. 332
28 -16.500[F] COG0194 Guanylate kinase  ali follow..  11  46.LLIVLSGPSGVGKGTVRQAIFSQEDTKF-EGEVNGVDYFFKTRDEFEQMIADNKLLEEYVGNYYGTPVDYVEQTLQDGKDVFLEIEV------QGALQVRNAFPEGLFIFLAPPSLSELKNRIVTRG------TETDALIENRMKAAKAEIEMMDAYDYVVENDNVETACDKIKAIVLAE.... 226
29 -16.300[F] COG0572 Uridine kinase  ali follow..  16  9.VIIGIAGASASGKSLIASTLYRELRIGVIPEDGYYKDQSHLSMEER------VKTNYDHPSAMDHNLLLEHLQALKAGKPVELPLYSYTEHTRKKETVHLEPKKVIIL-IFVDTPLDICLMRVNERGRSMDSVMAQYQKTVRPMFLQFIEPSKQYADIIVPRGGKNRIAIDILKAKISQFF... 212
30 -16.100[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  10  11...VAILGGESSGKSTLVNKLANIFNTTSAW-EYGRDYV-----FSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTGREHPFVQALIDEYRFDLVIL---LENNTPWVADGLRSLGSSVDRKEFQNLLVEMLEENN-------EFVRVEEEDYDSRFLRCVELVREMMGE. 185
31 -16.100[F] COG0125 Thymidylate kinase  ali follow..  16  4.LFITFEGPEGAGKTTVLQEIKNILTAEGLQAEQIREVILNENNILMDPKTEALLYAAARRQ----HLVEKVKPALEQGFIVLCDARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDLKLDFHTKVQEGYQELMKRFPERFHSVDAGQDLVVQDVLKVIDEALKKI 210
32 -15.700[F] KOG0707 Guanylate kinase  ali follow..  11  137EKPIVISGPSGVGKGTLISMLMKEFPSMF-SMEMDGVHYHFADKKVMEKEIKDGKFLESVHGNLYGTSIESVEAVTDSGKRCILDID-------QGARSVRASSLDAIFIFVCPPSMKELEDRLRAR---GTETEEQIQKRLRNAEAEIKEGISSGIFGLILYNDNLEECYKKLKVNHLLLIAQ. 324
33 -14.800[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  6.IIVGVSGASCSGKSTLCQLLHAIFGSSLVHEDDFYK-------TDAEIPVKNGIADWDCQESLNLDAFLENLHYIRDHGVLPTHLRNRENKNVEFKAPAIPTLEQHLVFVMLVTDFDTLKRRREARTGYITLEG--ENYVWPGYVHGHSHLFVNGDVTG-SSKMSVRDNVQWAINSILNAL... 229
34 -14.600[F] COG0283 Cytidylate kinase  ali follow..  14  4QKVIAIDGPGASGKGTVAARVAAALGYDYLDTGALYRLTAGWHDEENVSELAKKLPAVFSDSRILLGGEDVSDGIRTEAIGMGASAVAQLPKVRASLLQRQRDFLTEKGLVFLTAESKI---RAERRAKQIGIPCGLAFERILSDIEARDEADRNRKVAALLLDTS-RLTIEETVKKVLDWYRKV 218
35 -13.900[H] COG1072 Panthothenate kinase  ali follow..  13  80PYIISIAGSVAVGKSTTARVLQALLSVELITTDGFLHPNQVLKERGLMKKKGPNVTAPVYSHLIYDVIPD-GDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFV-IYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPT........ 285
36 -13.500[H] COG0237 Dephospho-CoA kinase  ali follow..  14  1..MTLVIGLTGSGKSTVANMLIE-KGITVIDADIIAKQAVEKGMPADRKKLGALVFTNEQKRLALNAIVRRDEAVANREAFVVLDIPLLFESKLESLVD---------KIIVVSVTKELQLERLMKRNQ-------LTEEEAVSRIRSQMPLEEKTARADQVIDNSGT--LEETKRQLDEIMNSW 196
37 -13.200[R] KOG2878 Predicted kinase  ali follow..  18  25PFILGISGPQGSGKSTLASALDTELTVVKFSLD--------------------DFYLTHAEQVELAKNNPNNPLVQHRGLAGTHDVTFLNNVLNAFVKGSDEEVSIPFY----KSKFGGYGDRGDESQWKKANPKTTTYVIFEGWMVGFEPLDSC.............................. 161
38 -13.000[J] KOG1384 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  20  67..VVVILGATGAGKSRLSVDLATRFPSEIINSDKIQHHLLGV--NPEHGELTAGEFRSAASNVVKEITSRQKVPIIAGGSNSFVHALLAQRFDPKF-CLISSDLRYECCFIWVDVSETVLYEYLLRR-EELSRFYDPVKSGLETRFGIRKAIGVPEFDGYFK-DALRKAAYDKAVDDIKRNTWTL 294
39 -12.900[C] COG3954 Phosphoribulokinase  ali follow..  11  6.PVIAVTGSSGAGTTTTSLAFRKIFAAAEVEGDSFHRYT-EMDMAIRKARDAGRHISYFGPEANDFSLLEHTFIEYGQTGKGVLFYEGLHGGVVTPQHDVARHVDLL---VGVVPIVNLWIQKLIRDTSERGHSREAVMDSVVRSMDDYINPQFSRTHINFQRVPTVDTSNPFAAKGIPSLDESF 229
40 -12.800[J] COG0324 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  14  5..AIFLMGPTASGKTDLAIQLRSQLPVEVISVDSALKGM--IDILDPSESYSAMNFRDDALREMADITAQGKIPLLVGGTMLYYKALIADENIRAELEQKAAQQGWAALHTELAKIDPISAARISQRINRALEVFYITGKSLTELTEEKGEALPYDFVQFAIAPQDRHVLHERIEQRFHKMIEL. 217
41 -12.700[S] COG2326 Uncharacterized conserved protein  ali follow..  14  59RIVIVFEGRDAAGKGGVIKRITERVSPRVFRVVALPA--------------------PTDREKTQIYMQRYIQQFPAAGEVVIFDRSWYNREIAPRFEAAMIESGIVLLKYFLDVSEEEQDRRFRQRINDPLRESYRRWWDYTRAYDEMIRMTDTDDAPWWIVPSDNKKQARNCIAHILSSIPYE 252
42 -12.600[H] KOG3220 Similar to bacterial dephospho-CoA kinase  ali follow..  11  2.FIVAVTGGIATGKSTISKVFER-QGIPVIDADKIAREIVEPGQPCNRAVLGKMIFEDKELRGKLNKITQVCKLLVTGHAWIVLDLPLL---ETGVLMDFIHK------IVCVTCDSDKQLERLIARNE-------LSESEARHRVDSQMPLDKKCEKSHFVIDNNGS--VEEAESSAMSIYNLM 196
43 -12.400[R] COG3911 Predicted ATPase  ali follow..  9...FVLTGGPGSGKTTLIAALRRA--GFATSVVAGRGIVRDQSSIGGTALPWSDR--TLFAELMLSWEMRSYQNAVEQKGPVFFDRGVPETPVADHVSTAAKRFRYNPRVF-IAPPWPDIFAQDEERKQTPDEAKCTYHALAEIYTEL------------YELVPLPLAPVETRLRFVLADAG.. 181
44 -12.200[C] COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain  ali follow..  23  2KQVAVISGKGGTGKTTFSATIHALEGGVVADCDVDAPNL.................................................................................................................................................. 40
45 -11.800[TZ] KOG4203 Armadillo/beta-Catenin/plakoglobin  ali follow..  66.ILVGLAGPSGAGKTIFTEKILNFMPIAIINMDNYND------------GTRVIDGNFDDPRLTDYDTLLDNIHGLRDGKPVQVPIYDFKSSSRIGYRTLEVPSSRIVILVSVTGGVHFLVKRVLRAGQEPEEIIHQISETVYPMYKAFIEPDLKTAQIKILNKFNPFSGFQNPTYILKSSKA.. 258
46 -11.800[R] KOG2486 Predicted GTPase  ali follow..  11  138...FALVGRSNVGKSSLLNSLVRRKRLALTSKKPGKTQCINHFRINDKWYL-PGYGYASAPHELKQDWNKFTKDYFLNRSTLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCDK--------KKKKNGGKKPEANIKEFQDLIQGFFETTPP----WIMTSSVTNQGRDEILLHMAQLRN.. 313
47 -11.700[L] COG2255 Holliday junction resolvasome, helicase subunit  ali follow..  58...VLIFGPPGLGKTTLANIIANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEILYPAMEDYQLDIMIGEGPAARSIKL----------PFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVADLEHIVSRS-ELTPEGAHQLARRSRGTPRITNRLLRRVRD..... 232
48 -11.600[R] COG2842 Uncharacterized ATPase, putative transposase  ali follow..  16  93..LATVYGMSGVGKTKAIQEFAKSHANVWL----VTASPSRSSLSEILYEIALELGISDAPRRKGTLSRLIARKIKGTEGLLIVDADHLPYEALEELRIMQEEAGIGLVLVGNDKVYTRMKARLWSRVAKNTSIQKTKKADTQAVAQAWGLETDEEALKVMQSITETGGGLRILTQTYACR.... 277
49 -11.300[K] KOG1534 Putative transcription factor FET5  ali follow..  3KVAAFVCGVASSGKSTFCGALMS-----YMKSVGRSCHLVNLDPAAENFE-----WEPTVDIRDLISIDDVMEELDYGPNGGLIYCFEFLMENLDWLNEEIGDYDEDYLIFDMPGQIELYTHV----------------PILPALIRHLQVTLNFRPCAVYLLESQFLVDRTKFFAGVLSAMSAM 161
50 -11.200[T] KOG0609 Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase  ali follow..  15  346RKTLVLIGVSGVGRRTLKNRLINSDVDKF-ALEENGSSYWFMDREEMEEAVRNNEFLEEHNGNLYGTHLQSIKDVINSGRMCILDCA-------NALKILHNSQELMPFVIFVAAPGEQLKTIYADRRA-----TGSNRNLSATLVALLDLCLNTQTLLNTFAFYDFSEQDDDLVATVEE..... 528
51 -11.000[R] COG1341 Predicted GTPase or GTP-binding protein  ali follow..  15  34..KVMIIGDVDTGKTTLTIYLANELRVAIIDSDIVDSHFTSLDDLKAFSHYFIGTITPNQYFGEMVVVMKLSELAMKFSDVVLIDTTGMIYGSGVELKRMKIEAVKPNLILALERNNEL.................................................................. 171
52 -11.000[F] COG1618 Predicted nucleotide kinase  ali follow..  14  13...IAVTGSPGVGKSTVVAKTAEKL------AEKPGFKIGGIRTAERKEGHREGFSIRDLATGKTGILSHVKGSGPRLGKYHVNLDDL----ERIGANAVRNALACDLVVIDEIGPMELISQSFVSAVEEVLESDKPVLAVLHHSSRHPLAQRFRKGFEVLTVDKGNRDELEKITNRFLRKLG.. 184
53 -10.900[DL] KOG1970 Checkpoint RAD17-RFC complex, RAD17/RAD24 component  ali follow..  10  132..ILLITGPPGCGKTTTLKILSKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIYNKLQMLGDDLRTDKKIILVEFYRDSHTLHEVLRKYVRIGRCPLIFIISDSLSGDNNQRQEECSISNISFNPVAPTIMMKFLNRI--VTIEANKNGGKITVPDKTSLELLCQGIRSAINSL 340
54 -10.900[L] COG2256 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  14  54...MILWGPPGTGKTTLAEVAANYANAEVERVSAVTSGVKEI-----------------------RAAIEKARENKLSGRRTILEVHRFNKSQQDAFLPHIEDGTVTFIGATTENPSFELNNALLSRARVYKLTSLNQQEILQALHQAIADTERGLGKVAAVFADNVLDRLAELVNDARMSLNYL 216
55 -10.600[R] COG1660 Predicted P-loop-containing kinase  ali follow..  19  8..LVIVTGMSGAGKTVAIQSF-EDLGYFTI--DNMPPALVP----------------------KFLELIEQTNENRRVALVVDMRSRLFFKEINSTLDSIESNPSIDFRILFLDATDGELVSRYKERRSHPLAADGRVLDGIRLERELLSPLKSMSQ---HVVDTT................... 144
56 -10.600[R] COG2607 Predicted ATPase (AAA+ superfamily)  ali follow..  11  86...VLMSGARGTGKSSLVKALLHEYADKGLR-EVDKSDLIGLPYLLTLLKECP-VFCDDLSFESGDETYKALKTALDGGANVLVYAT---SNRRHLMPEYFDENAGTTGMRGEIHQKEAVEERFGLWLSFYPFDQNDYLAAVQNWLEDFGPYDETAQMAALQWAQTRGSRSGRSAWQFACDWAG. 279
57 -10.500[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  12  5.LIIGVGGPVGAGKTMLIERLTRYLSMAAITNDIYTKE--SVLPADRIAGVETGGCPHTAIREDASMNFAAIEEMCHPDLQLLFLESGGDNLSATFSPDLV---DFSIYIIDVAQGEKIPRKGFIINKVDLAPYVGANVEVMKADTLKSRG-----NKDFFVTNLKTDEGLKSVADWIEKRL... 199
58 -10.400[H] COG2087 Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase  ali follow..  13  7..SVFILGGARSGKSRFAEELAGKAGATGRAWDDEMRDRISHHQERRGGEW--------TTHEAPVDIATVLQRLDSPDSVILIDCLTLMETAFAELEAAIVSTRAKLILVSNEVGLGIVPENRMARE......................................................... 141
59 -10.300[R] COG0218 Predicted GTPase  ali follow..  14  28...IALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDDKMRF-PGYGYARVSKKEREKWGCMIEEYLTTRENLLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADK-------------------PRGKWNKHESAIKKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKL... 195
60 -10.200[DL] KOG2035 Replication factor C, subunit RFC3  ali follow..  15  40...LLFCGPSGAGKKTRIKCLLRELYGVGVEKTQLIMKSFTSPSNKKSSNYHIEMTPSDVGIYDRVVVQDLVKEMAQTSQ-VLCEADSLTRDAQHGLRRTMEKYANNCKIVLSCESLSRIIEPLQSR--NVPAPTDEDVTKVLRKVIERESFLLPENVLQKIVEKS-EGNLRRAILMTEA..... 234
61 -10.200[R] KOG1533 Predicted GTPase  ali follow..  11  36...VLVIGAPGAGKSTFCAGLTD-----IFSQTKRPFLTINLDPANDTMA-----YAPDVNITEMITVNDVMDRLGLGPNGALKYCIETLGANCNWLLQKIEANHKKYLIIDCPGQLELYK-------------EGELWKVIRFLEKS-----GVRLCALHLADSLYCSDPSKFISVALSTLATM 190
62 -10.200[L] KOG0991 Replication factor C, subunit RFC2  ali follow..  12  72...IIIAGPPGTGKTTSILCLARA-----LLGPALKDAMLELNASNDRG---------DVVRNKIKMFAQQKVTLPKGRHKIIIEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCARYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTA-QGDMRQALNNLQSTFS.. 241
63 -10.100[R] COG3910 Predicted ATPase  ali follow..  10  38..ITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVAKAFYFARKKYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEET------------PEIFRGIVRNNSLDRRSHGEGFLDIMHRRLHGAGLYFLDEPESP--LSPQKQLELAAIIRQAADS.... 202
64 -10.100[L] COG0470 ATPase involved in DNA replication  ali follow..  49...LLFYGPPGTGKTSTIVALARE-----IYGKNYSNMVLELNASDDRG---------DVVRNQIKDFASTRQIFSKGFKLIILDADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFQPLPQEAIERRIANVLVHEKLKLSPNAEKALIELS-NGDMRRVLNVLQS..... 214
65 -10.100[R] KOG2170 ATPase of the AAA+ superfamily  ali follow..  13  104.LVLSFHGYTGSGKNYVAEIIANNTFRLGLRSTFVQHIVATND-LTTVQKCQRSIFIFDEADKLPEQLLGAIKPFLDYYRSIFILLSNKGGGEIARITKEQYESGYPREQLRLEAFERELMNFSYNEKGGLQMSELISNHLIDHFVP-FLPLQREHVRSCVGAYLRKRVSNVDFVERVLNSLQ.. 315
66 -10.000[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  12  58...VLLSGLSGSGKTVLFYQLR--------DGSSHQGAVTSMEPNEGTFVLHNENNTKKGKVKPVHRLISKLEEYLPRAAAVVVDALEFLPNIRAASEYLVIKNKTPVLLC--AHTKEFIRKQMERVSRSAISTADIANDFTLGIEGEVFSFSHCHNKVTVAEASGLTGETDQVQEFIREHVK.. 259
67 -9.950[D] COG3640 CO dehydrogenase maturation factor  ali follow..  11  6MPKLIISGRGGSGKSTLVTLIAHTLKVLVVDSDESNIGLLGIEPAEKTELFREKFDLESLSQEFVCWVGSLGLMQIGKIDHAMEGCACPMGAVTRDFLNHVRLEEDQWVLVDTEAGVEHFGRGIVEGADAVVMVVDPSSDAVLLAEKAAKLTHEADKRFGVILNKIDEETEPILTELLTS..... 219
68 -9.880[T] COG1493 Serine kinase of the HPr protein, regulates carbohydrate metabolism  ali follow..  35  149...VLITGSSGVGKSETALDLVRR-GHRLVADDSV...................................................................................................................................................... 179
69 -9.660[O] KOG0737 AAA+-type ATPase  ali follow..  16  451...ILLFGPPGTGKTMMAKAIANEAGASFVSMSTITSKWFG------------------EDEKNVRALFTLAAKVSPT---IFVD-SMLGQRTRVGEHEAMRKIKNEFMILVLAATDEAIIRRFERRIMVGLPSVESREKILRTLLSKEKTENLDFQELAQMTDGYSGSDLKNFCTTA....... 628
70 -9.610[R] COG4240 Predicted kinase  ali follow..  14  89.FIQGILGSQGTGKTTMSLVIQLILQTLSLSLDDLYKTYSDRLVLLQQDPRLIWRGPPGTHD---IDLGLNVLEQIRQGKSPVIVPRFDKSAHAGAGDRTKPDVITGVDILIFEG...................................................................... 204
71 -9.610[L] KOG2028 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  12  140...IVFWGPPGTGKTSIAKSLINSLSAVTSGVKDVRDAVESAKRLNLEGRKRT-VLFMDEVHRFNKSQQDTFLPVIEDGSILFIGATTENPSFHLITPLLSRCRVLTLNPLKPNHVETLLRRAVDDSERGLPNSVEVDDSVIEFLANNCD................................... 296
72 -9.540[L] KOG0990 Replication factor C, subunit RFC5  ali follow..  10  75...LLLYGPPGTGKTSTILAVARK-----LYGPKYRNMILELNASDD-----RGIDVVRQQIQDFASTQSFSLGKSSVKLVLLDEADAMTKDAQFALRRVIEKYTKSTRFALIGNHVNKIIPALQSR--RFAPLDGVHMSQRLKHVIEAERLVVSDCGLAALVRLS-NGDMRKALNILQS..... 242
73 -9.530[E] COG4917 Ethanolamine utilization protein  ali follow..  13  4...IAFVGSVGAGKTTLFNALQGNTPGEYFNHPRWYHALITTLQDVDM------IYVHGANDPESRLPAGLLDIGVSKRQIAVISKTDMPDADVAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE........................................ 159
74 -9.400[O] KOG0741 AAA+-type ATPase  ali follow..  13  256...ILLYGPPGCGKTLLARQIGKMLNAKVVNGPEILNKYVG------------------ESEANIRKLFADA---------------------EEEQRRLGANSGLHIIIFD---------DAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGM-TNRPDLIDEALLR........ 385
75 -9.330[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  12  41PIIIIVVGMAGSGKTSFLHRLVC-----HTFDSKSHGYVVNLDPAVMSLP-----FGANIDIRDTVKYKEVMKQYNLGPNGGILTSLNLFATKFDEVVSVIEKRADQLDYVLVDTPGQI----------EIFTWSASGAIITEAFASTFP------TVVTYVVDTPRSSSPITFMSNMLYACSIL 199

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.