current user: public

If you have questions about the server, please let us know.

Query: [R] COG0824 Predicted thioesterase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MPFTYHRTINFQDTDAAGVVYFANILSICHEGYEASLRTSGISLKEFFTNPSMAFPIVHASVDFLRPLFCGAQVIISLVPQKIGAEKFEINYEIYLADVLVAKAVTRHVCIDANTRSKQELSMEIIQWLDGYRKDTEEVERRKAREVVLast
1 -89.500[R] COG0824 Predicted thioesterase  ali  100  1MPFTYHRTINFQDTDAAGVVYFANILSICHEGYEASLRTSGISLKEFFTNPSMAFPIVHASVDFLRPLFCGAQVIISLVPQKIGAEKFEINYEIYLADVLVAKAVTRHVCIDANTRSKQELSMEIIQWLDGYRKDTEEVERRKAREVV 148
2 -28.000[R] KOG4366 Predicted thioesterase  ali follow..  49.TTTVNGLCLTNDVDTLYHMNNARYFRELDFARVDFYERTNL---RTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYWDEQSLFMEHRFVRDKFVHCIAICRQRVIDVSMEAVMS-RATVLTSLAAPSPAAGGISNPAMDT.. 204
3 -26.900[I] COG3884 Acyl-ACP thioesterase  ali follow..  12  18..FDREWPLRVGDIDRTGRLRLDAGVRHIQDIGQDQLREMGFE------ETHPLWIVRRTMVDLIRPVEFQEMLRLRRWCSGTSNRWCEMRVRIDGRKGGLIESEAFWININRETQMPARIADDFLAGLHRTTSVD............ 145
4 -19.400[R] COG5496 Predicted thioesterase  ali follow..  10  9LTHQMTYIVPANRTVPHDVLATGYMVGIIEWACMELLRPH---------DDGEISLGTHVNFSHAAPTVPGSTVTIDVEVTEINRRAVTFNITAADEFATISTGTHQRGVVNREKFVSR............................. 131
5 -17.600[I] KOG2763 Acyl-CoA thioesterase  ali follow..  11  70VLLETDALLRQRFVYGRGLLRMGRIIEELDLAVWICHLHIHLPNLPEGVPLPYTFITMLVDAHFLQDKIADADVSLSGHVSYTDNNFMEVTAYVRQSGMLLAKGIFVVEARDAINNGPAPVNPLVPANELEESLHQEAQKRHQERA.. 218
6 -15.800[I] COG1607 Acyl-CoA hydrolase  ali follow..  15  2..................................SYIDDIASISAARHCRRETVTASMD-SVDFLKPIGQKDSVCLESYVTWVGTSSMEVFVKVIKEHELAATSFLTFVALDSNG-KPVPVPRVVPETEEEIMLHNTAVQRANER... 116
7 -12.400[R] KOG3328 HGG motif-containing thioesterase  ali follow..  11  42...RVEFEVEKDQSNHFNTLHGGCTSTLIDIFTTGALLLTK---------PARPGVSVDLHVTYLTAAKIGETLVLDSTVIKQGKTLAFTKAELYRKNCLKMASKYMQI....................................... 138
8 -10.700[S] KOG4781 Uncharacterized conserved protein  ali follow..  10  150.................DTIHPGLIATCMDEV---------LAICSFLSLPNKIAVTANLKLSNPTKAYTNHFYILRSHLEWTKGRKAQTHGTAYSKSTCVAIADGLFG-------MLSSFP.......................... 245
9 -10.100[Q] COG2050 Uncharacterized protein, possibly involved in aromatic compounds catabolism  ali follow..  15  41AEITFDNDDKLVGNIAQKILHGGVIAAVLDVAVGNSLIRHEPLIQEQLQIKLAKMGTIDLRVDYLRPGR-GEHFIARSSILRSGNKVAVARVELHNEQIHIASATATYLV...................................... 155
10 -9.030[I] COG0764 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratases  ali follow..  14  98............................................................EARFKRPVLPGDQMELNVQVIKKRRGITAFTGVATVNGEIACEAKLMCA....................................... 146

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24